WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Poecilia latipinna LMXD00000000.1 (LMXD01) 165 60 1 23 55 21 4 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Poecilia latipinna V35 trav LMXD01010250.1 27265 VDGQTLTESESVVKTQGESHRLTCTASGFSISGRWMNWIRQAPGKGLEWLAAHYDDRSIYYSQSVRGRFTISRDDGRNQVYLQMNSLRTEDSAVYFCARE
Poecilia latipinna V34 ighv LMXD01010250.1 18178 VKSEQLTQPAAETVQPGQHLTIRCQVSYSMSSYTTHWIRQPAGKGLEWIGWKNAGGSSYKDSLRNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARD
Poecilia latipinna V33 ighv LMXD01010250.1 16787 SDGQTLTESESVVKRPGESHRLTCTYSGFSGDPNIAWIRQAAGKGPEWIAYIWWNSGGIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARE
Poecilia latipinna V32 ighv LMXD01010250.1 13777 TDGQTLTQSESVVKRPGESHRLTCTYSGFGGHYAMAWIRQAAGKGLEWIAFMWAESSSTYYSDSVKGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARR
Poecilia latipinna V31 ighv LMXD01010250.1 12207 TDGQTLTESESVVKRPGESHRLTCTYSGLGDPHMHWIRQAAGKGPEWIAYIWYSSGGIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARE
Poecilia latipinna V30 trav LMXD01010250.1 11028 IKCEQLTQPASETVQSGQRLTITCQVSYSMTTYATAWIRQPAGKGLEWIGWKYTGGSAYKDSLRNKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia latipinna V29 ighv LMXD01010248.1 11226 TDGQTLTQSESVVKSPGESHRLTCTYSGFSSTPYIGWIRQAAGKGLEWIAYIYSDSSGMYYSESVKGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARRDTV
Poecilia latipinna V28 ighv LMXD01010248.1 9581 VKCEQLTQPAAQTVQPGQSLTISCQVSYSLGSYPTFWIRQAAGKTLEWIGAARTGYTTDYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARR
Poecilia latipinna V26 trav LMXD01010247.1 1297 VNCEQLTQPASVTLQSGQSLTISCQVSYSISTYWTVWVRQSVGKGLEWIGGSGIGHITVFKDSLNNRLSISLDGSSKTVTLNGQNMQTEDSAVFYCARK
Poecilia latipinna V25 ighv LMXD01010247.1 33 QRMESIPSSSVVKNPGETLNLSCRGSGFTFTDYVMAWIRQPAGKGLEWIGSGYSTQSRNTYTSSVRGRIEISREDSNSITHLRLSNLRPEDSAVYYCAAQ
Poecilia latipinna V24 ighv LMXD01010246.1 33 QRMESIPSSSVVKNPGETLSLSCRGSGFTFTDYVMAWIRQPTGKGLEWIGLGYSRQSSNIYSSSVRGRIEISREDSNSMTHLRLSNLKPEDSAVYYCAVE
Poecilia latipinna V23 ighv LMXD01010245.1 1866 QRMESIPSSSVVKNPGETLSLSCRGSGFTFSSYAMHWIRQPAGQGLEWIGRGLNNPSSNTYASSLRGRIEVRKDSSNSMTHLRLSNLKPEDSAVYYCAAE
Poecilia latipinna V22 ighv LMXD01010244.1 4444 QRMESIPSSSVVKNPGETLSLSCRGSGFTFTDYAMAWIRQPTGKRLEWLGLGYSSQSSNIYASSVRGQIEISREDSNSITHLRLSNLKSEDSAVYYCA
Poecilia latipinna V21 ighv LMXD01010244.1 3213 VKCEQLTQQTSATVQPGQRLTIDCQVSYSVGGYWTHWIRQPTGKGLEWIGTSCDGCSPSFKDSLKNKFSITFISSSKTVTLNGQNMQPEDSAVYYCARQ
Poecilia latipinna V20 ighv LMXD01010243.1 6802 VKCEQLTQPGSVTVQPGQRLTISCQVSYSLGYYTAWIRQPAGKGLEWIGMKNTGASYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARLDTV
Poecilia latipinna V19 trav LMXD01010243.1 5303 VKCQKLTQPASVTVQPGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKYTGNSLYKDSLKNKFSIDLDTSSKTVTLNGQNMQPDDSAVYYCARY
Poecilia latipinna V18 trav LMXD01010243.1 3250 VRCEQLNQPASATVQPGQRLTISCQVSYDLSYWTAWIRQPAGKGLEWIGMKYTGNSLYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARY
Poecilia latipinna V17 ighv LMXD01010241.1 3618 VKCEQLTQPGSVTVQPGQRLTISCQVSYSLGYYTAWIRQPAGKGLEWIGMKNTGASYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARRDTV
Poecilia latipinna V16 trav LMXD01010241.1 2119 VKCQKLTQPASVTVQPGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKYTGNSLYKDSLKNKFSIDLDTSSKTVTLNGQNMQPDDSAVYYCARY
Poecilia latipinna V15 trav LMXD01010241.1 67 VKCEQLTQPASVTLQPGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKYTGNSLYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia latipinna V14 ighv LMXD01010240.1 2551 VKCEQLTQPASLTVQPGQTLTITCQVSYSFSSYYAAWIRQPAGKGLEWIGMKSVYHTFYQESLKNKFSIVLDSSSKTATLNGQNMQPGDSAVYYCARD
Poecilia latipinna V13 trav LMXD01010240.1 354 VKCQQLTQPASVTVQPGQGLTISCQVSYSVSSYYTAWIRQPAGKGLEWIGMERIGWREYYKDSLKNKFSISLDGSSNTVTLNGQNMQPDDSAVYYCARE
Poecilia latipinna V12 ighv LMXD01009347.1 201 LDGQTLTESEPVVKRPGESHKLTCTGSGFTFSSYEMDWIRQAPGKGLEWIAYISNPSGSTQYYSPSVQGRFTISRDNSKQQLYLQMNNLKAEDSAVYYCARH
Poecilia latipinna V11 ighv LMXD01009346.1 14246 VFCVELIQPDSKIVQPGGSLSITCRVSGYSLTDSNYATGWIRQRDGKTLDWILTMWYDGSLAQNNALKNKFSSNRDTSAGTITITGQTLQPEDTAVYYCVRY
Poecilia latipinna V10 ighv LMXD01009346.1 11730 SEPAVKRPGESHKLTCTTSGISFSSYCMNWIRQAAGKGLEWVAADCGGSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia latipinna V9 ighv LMXD01009346.1 10165 VRCDQLTQPASVTLQSGQTLTISCQVTYSLDQRHTHWIRQWEGKGWEWIGADRVGYSSYYKDSLKNQFSISLYSSSKTVTLNGQNMQPDDTGVYYCAR
Poecilia latipinna V8 ighv LMXD01009346.1 8707 VRCEQLTQPASLTVQPGGHLTISCQVSYSLSSARTHWIRQPAGKGLEWICSAHVGHDTFYKESVKNKFRLDLDQASKTVTLKGQNMQPEDTAVYYCARE
Poecilia latipinna V7 ighv LMXD01009346.1 4922 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIEYDSVRKFYSQSVQGRFTASRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia latipinna V6 ighv LMXD01009346.1 3371 VRCDQLTQPASVTLQSGQTLTISCQVTYSLDQRHTHWIRQWEGKGWEWIGADRVGYSSYYKDSLKNQFSISLYSSSKTVTLNGQNMQPDDTGVYYCAR
Poecilia latipinna V5 ighv LMXD01009346.1 1913 VRCEQLTQPASLTVQPGGHLTISCQVSYSLSSARTHWIRQPAGKGLEWICSAHVGHDTFYKESVKNKFRLDLDQASKTVTLKGQNMQPEDTAVYYCARE
Poecilia latipinna V4 ighv LMXD01009345.1 99 RSRVPQHCLTESDPVIKSPGASHTLTCTASGFTFGDYRMVWVRQAPGEGLEWIAYISTASTPIYYASSVQGRFTISRDDSRRQLFLQMNSLKAEDTAVYYCARC
Poecilia latipinna V3 trav LMXD01006241.1 51806 CRAQITVTQPAVETVTPGSTVTIRCTTNPAVLRYSDGDYAMFWYQQKPGQPPKLIIKYAKTLQSVTPSRFSGSGSGSDFTLTTSGVETEDAAVYYCKSIHVVNSDYV
Poecilia latipinna V2 igkv LMXD01006241.1 47120 QITVTQPAVETVTPGSTVTIRCTTNEDVYLDSDGDYYMFWYQQKPAQPPQLMIKYAKTLQSGTPSRFSGSGSGSDFTLTNSGVQAEDAAVYYCQSRHSGLE
Poecilia latipinna V1 igkv LMXD01006241.1 45564 LAANPSVTQSPAVKSAALGETVSLSCSASAGVDDDLSWYQQKPGQPPKLLFYKISSRQSAPSHFSSSGSEPQFTLTIRGVQADDAGDYYCMGA
Poecilia latipinna V0 iglv LMXD01005144.1 5751 VSGATVVTQTPPVVTVRKGETATMDCNLGTVDNTAYWYKQIPAGVPQWVLYFYRTYGSPSYGSGFSSPKFTSTHQSSTGYRLIINNVEERDSAVYYCKTWDSSVNEY
Poecilia latipinna V73 trav LMXD01022336.1 59 VMCEQLTQPGSLTVQPGQTLTVSCQVSYSVSSYYTAWIRQPAGKGLEWIGSKYTGDSYYKKSLENKFSIDLDTSSSTVTLNGQNMQPGDSAVYYCARD
Poecilia latipinna V72 trav LMXD01022335.1 3181 VWNEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTDNDMNWIRQKPGKGLEWIGWINTCSAVATYASSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAR
Poecilia latipinna V71 ighv LMXD01022334.1 1256 VKCEQLTQPASLTVQSGQTLSISCQVSYSLTSYSTHWIRQPAGKALEWMGAIWYDGSNAYASNVQRRITITRDTSKNTVYLSLSTMKPEESAVYYCAR
Poecilia latipinna V70 ighv LMXD01022334.1 253 VKCEQLTQPAALTVQPGQPLTIICQVSYSLSTRTHWIRQPAGKGLEWIGYMCSGCTGARKDSLKNKFTITVQASSKTVTLNGQNLQPEDSAVYYCARD
Poecilia latipinna V69 trav LMXD01022333.1 29 VMCEQLTQPGSLTVQPGQTLTVSCHVSYSVSSYWTVWIRQPAGKGLEWIGSKYTGDSYYKKSLENKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARD
Poecilia latipinna V68 ighv LMXD01022332.1 2931 VKCEQLTQPTSLTVQSGQTLSISCQVSYDLSRYHTNWIRQPAGKALEWMGVIWTDGSNDYASNVRGRIEITRDTNKKIVYLSLSAMKPEESAVYYCARD
Poecilia latipinna V67 ighv LMXD01022332.1 989 VKCEQLTQPASLTVQSGQTLTISCQVSYSLTSYHTSWIRQPAGKALEWMGVIWANGNNAYASNVQGRITITRDTSKKIVNLSLSAMKPEESAVYYCARE
Poecilia latipinna V66 ighv LMXD01022330.1 4085 VKCEQLTQPASLTVQPGQTLTISCQVSYSVTSSGTHWIRQPAGKALEWMGVIWASGSNNYATNVQGRIEITRDTSKNMVTLRLSTMTLEESAVYYCAK
Poecilia latipinna V65 ighv LMXD01022330.1 1669 VKCQQLTQPASLTVQPGQTLSISCQVSYSVTSYSTHWIRQPAGKALEWMGVIWASGRNAYASNVQGRIEITRDTNKKIVYLSLSAMKPEESAVYYCARY
Poecilia latipinna V64 trav LMXD01022330.1 480 VKCEQLTQPASVTLQPGQTLTISCQVSYSVRSYYTAWIRQPAGKGLEWIGSAADGSTTYYKDSLRNKFSLSIDSSSNTVTLNGQNMQPGDSAVYYCARD
Poecilia latipinna V63 ighv LMXD01022329.1 297 VKCEQLTQPASLTVQSGQTLTISCQVSYSVTSYGTHWIRQPAGKALEWMGVIWASGGNAYASNIRGRIEITRDTNKKIVYLSLSAMKPEESAVYYCARE
Poecilia latipinna V62 trav LMXD01022328.1 3166 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGTWTAWIRQPAGKGLEWIGVKGTGYTSYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYFCARDSQ
Poecilia latipinna V61 ighv LMXD01022328.1 1648 VKCEQLNQPASATVQPGQRLTISCQVSYDLGSYATHWIRQAAGKGLEWIGLTCRGCTSVYKDSLTNKFSFTLDDSSKTVTLNGQNLQPQDSAVYYCVRE
Poecilia latipinna V60 ighv LMXD01022327.1 3491 VKYEQLIQPASLTVQAGQRLTITCRVSYSVRTYRTNWIRQPVGKGLEWIGGAHIGYDTFYKDSLKNMFSMTLQGSSKTLTLNGQNLQPEDSAVYYCARG
Poecilia latipinna V59 trav LMXD01022327.1 682 EQPIQPASVTVQPGQRLTISCHVSYDPSSFHIHWIRQPAGKGLEWIGYTCQGCDPVYKDSLTNKFSFTVDSSSLSVTLNGQNLHPQDSAVYYCARSPTVT
Poecilia latipinna V58 ighv LMXD01022324.1 628 VKCEQLTQSASLTVQPGQPLTITCQVSFSVSSYRTYWFRQTSGKGLEWIGSARIGSKTYYKDAIQNKFSIGLDDSSKTLILNGQNMQPEDSAVYYCARE
Poecilia latipinna V57 igkv LMXD01018999.1 41 VRGQYTLIQPAAVRADLGGSATINCRISQNVYVSGSSHCLAWYQQKNGQTLKRLIYYASTRDSGTPSRFAGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia latipinna V56 ighv LMXD01018998.1 101 QVTVTQAAAVRADLGGSVTIRCRTSQNVHKGSYHDQFWFQKKDGEPPKLIIKYSDQLASGVSDRFSGSGSHSDFTLTIRQVEAEDTAVYYCM
Poecilia latipinna V55 igkv LMXD01018997.1 1708 TQQPAAVRADIGGSVNINCRISQNVYFSSSKHCLAWYQQKDGQTPKLLIYYASTKESGTPSRFSARGSNSDFTLTISGVQAEDAAVYYCQSLHNIGSQWP
Poecilia latipinna V54 igkv LMXD01016321.1 3540 SSGDIILTQTPGSQSVAPGQTVSIRCKTSSGVSSYGYSNLHWYLQKPAEAPKLLIYAATTRQSGVPARLSGSRSGPDFTLTISGVQAEDSGVYYCQQGWSSP
Poecilia latipinna V53 igkv LMXD01016321.1 1602 SDGQNVVVTQSAAKSVQLGQTVTIDCKASRQLTGCSTPCLSWYHHKPGEAPKALIYYTSSRFSGISSRFSGSGAGNGLDFTLTISGVQAEDAGVYYCQSYHSGPV
Poecilia latipinna V52 trbv LMXD01012740.1 70 ASDSKHVGQTPPSIIKKTGESVDKEIRCSHSIPNHDVILWYKQDENRTLQLLGYLNLNFVTVERDVKKTISFEGDGRTHSDLTVSDLTADDSAVYFCAARY
Poecilia latipinna V51 trbv LMXD01010566.1 26361 SSPSEKIVQIPDHVFKHQGETLAIRCSHRIQSYDQILWYRQTDDRELQLLGYMYGTASFPDKELNVTIDGDANKDKTCTITITGLSPDSSAVYFCAAR
Poecilia latipinna V49 ighv LMXD01010566.1 5795 LSLGLEVHQSHSDLIKKAGDEVHIFCTHERTDYRVILWYQQSPGDTAMKLIGYLYFKDPTIEDGYKKDFGISGDLGGDTAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia latipinna V48 trav LMXD01010566.1 3933 LSLGLEVHQSHSDLITRNGDKVHIFCTHEKTDYRVMLWYQRLPGDTAMKLIGHLYYDKPSMEDGYKKDFGISGDLGGETAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia latipinna V47 trbv LMXD01010566.1 1979 SSLSDQVYQVPDHILGKPGESAIIQCSHTIPNYDRVLWYKQSTQLQFLGHMYKNMDNPEAGLGVKLGGNAEKDQNCTLTLEVLNPNSSGVYFCAAR
Poecilia latipinna V46 trbv LMXD01010566.1 355 SSLSDQVHQTPSEKFCKTGDKPQISCRHEIQDYTRIFWYKQSTDHQMQLLGYMNVNDGYPETGANVKINGGATKGETCSLTIEGVNTSSSGVYFCAAS
Poecilia latipinna V45 trbv LMXD01010565.1 7399 ASLSDQVHQTPADMFYKPGEAAVINCSHTIDSYDRILWYKHSNGNQMQFLGYMNIKFGTPEPGVKVKINGSANKNDLCTLTVEDLSVSSSAVYFCAAR
Poecilia latipinna V44 trbv LMXD01010565.1 5502 SSLSDQVIQTPAQMFQKTKETARISCSHSIQTYNQILWYKQTEHQMQLLGYMTGTSPFPEKGVNVEMAGSANANQDCTLIIKELNVSSSAVYFCAAS
Poecilia latipinna V43 trbv LMXD01010565.1 3722 SSLSDQVDQFPANIIKNSGEDTVIKCSHQAPNYDRILWYKQTEDHQMQYLGYMNVNTGYPETGVKVKINGEATKGKTCSLMIEGVNTSNSGVYFCAAS
Poecilia latipinna V42 trdv LMXD01010564.1 4764 SSPSDKIVQIPADMFRNPGETAKISCSHSIPDYDRILWYKQSELHEMKLLGYMLGDDGYPEKELNVKIDGSANRDKNSTLTVAELSQDSSAIYYCAAR
Poecilia latipinna V41 trbv LMXD01010564.1 1852 QVLLACRSVKTPAEIYGSEGGTANIYCSHAVTEYNRILWYKQSDRQLIFLGYVYFGGTLTVDGLDVKMGGSADKDQNCTLMVERLGRSSSGVYFCAAS
Poecilia latipinna V40 trbv LMXD01010564.1 1245 SSLSDQVHQTPADLFQEPGGTAVINCTHSIDSYDVILWYKHSTSSQMQLLGYNDVVNGYPEKDVKVKISGSASKDKICTLTVEDLSVSSSAVYFCAAKYHSASY
Poecilia latipinna V39 ighv LMXD01010250.1 42447 SHAQTLTESEPVTKRPGESHTLTCTASGFTFPDYAMHWIRQAPGKGLEWVALVTKPSGSTQRYSPSVQGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARE
Poecilia latipinna V38 trav LMXD01010250.1 40955 QSLIESESVVKIPGDSHKLTCTASGFTFSDHWMHWVRQAPGKGLEWVAAVNYGGGNTYYSQSVRGRFTISRDNGKQQLYLQMNSLKTEDSAVYFCARDAQ
Poecilia latipinna V37 ighv LMXD01010250.1 37729 LKGEQLNQPPSMTVQVGRSVSITCHVSYSIDRDYTHWIRQPAGKGLEWISRDTAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia latipinna V36 ighv LMXD01010250.1 31896 IYCQTLTESEPAVKRPGESHKLTCTASGFTFSSYWMAWIRQAPGKGPEWIAFISSGSGSSKYYSQSVQGRFTISRDNGRDQLYLQMNNLRTEDSAVYYCAR
Poecilia latipinna V112 ighv LMXD01039421.1 6471 LKGEQLNQPPSMTVQVGRSVSITCHVSYSIDRDYTHWIRQPAGKGLEWISRDTAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia latipinna V111 trav LMXD01039038.1 312 IKCEQLTQPASETLQPGQRLTIRCQVSYSLSSYATAWIRQPAGKGLEWIGWKHTGGSSYKDSLRTKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia latipinna V110 trav LMXD01039037.1 15235 IKCEQLTQPASETLQPGQRLTITCQVSYSMSSYATAWIRQPAGKGLEWIGWKYTGGSSYKDSLRNTFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia latipinna V109 ighv LMXD01039037.1 11601 TDGQTLTESESVVKRPGESHRLTCTYSGFSGNPYIAWIRQAAGKGLEWIAYISGGSSYIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARR
Poecilia latipinna V108 ighv LMXD01039037.1 9453 TDGQTLTESESVVKRPGESHRLTCTYSWFSSDPDIAWIRQAAGKGPEWIAYISYHSRSIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Poecilia latipinna V106 ighv LMXD01038326.1 5570 VWSQIKLEQSTSEVKRPGETVKMSCVISGYSMTSYNIHWIRQRPGRGLEWIGWMNTGRNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARQ
Poecilia latipinna V105 ighv LMXD01038326.1 4198 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSYWMAWIRQAPGKGLEWVATEAGFTQYYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Poecilia latipinna V104 ighv LMXD01038326.1 3143 LNGQTLTESESVVKTPGESHTLTCTHSGFSGKPWIAWIRQVSGKGLEWISTIDSGGGTAYSQSVRGRFTISRDDSRSQVYLQMNSLSAEDSAVYYCARD
Poecilia latipinna V103 ighv LMXD01038325.1 5513 GFGQTLTESEPATKRPGESHTLTCTYAGISDGNADISWIRQAEGKGLEWVAYISAPKGSDKYYSPSVQNRFTISRDNNKDQVYLHMTSLRTEDSAVYYCARE
Poecilia latipinna V102 ighv LMXD01038325.1 4063 ARGQSLTSSEAVISKAGQSVILSCKVQGMPLMWLHWIRQKPLKALEWIGFIDSGTGTAFAQHLQGQFSITKDTSKNTVSLTVKSLKPEDSAVYYCARETQ
Poecilia latipinna V101 trav LMXD01038325.1 2488 VDGQTLTESEPVVKNPGNSHKLTCTGSGFTFSSYWMAWIRQAPGKGPEWVATIEYDSDSKFYSQSVQSRFTIFRDNNKQQVYLQMNSLKIEDSAVYHCARD
Poecilia latipinna V100 ighv LMXD01038325.1 1560 VTCDQLNQPPSVSVQAGEGLTITCQVSYAISNYWTHWIRQPARKGLECISRDKTVKESLKNKFSVNIDSSNSRVTLHGQNMQPEDTAVYYCAGER
Poecilia latipinna V99 ighv LMXD01038325.1 367 VDGQTLTESEPVVKNPGNSHKLTCTGSGFTFSSYWMAWIRQAPGKGPEWVATIEYDSDSKFYSQSVQSRFTISRDNNKQQVYLQMNNLKIEDSAVYYCTR
Poecilia latipinna V98 trgv LMXD01030743.1 8687 ASLSKDVHQDPPWTLQVPQSSVTISCSYSIIGYNQILWYKNPTSDSTLELIGFVYYTRVTLENEFKDRFNISGDGTKESELRVDKLQPEDSSRYYCAAG
Poecilia latipinna V97 trav LMXD01030741.1 12186 LSAEILQPADVISNRGDNVTFECLLGKQFMAHLTMCWYQQKHRGAQIEFILRKNQTNAGRFQLFIDHEENSFTLRIFGLLVSDSSTYYCAA
Poecilia latipinna V96 trav LMXD01030741.1 10756 LTVEVLQPADVISIEGDKVTFECKLGQRFMSYHTMFWYHQKHRGAQIEFILKEFQTDVGRFRSSVDHDKNSFTLGISGLLVNDSSTYYCAASHSDADK
Poecilia latipinna V95 trbv LMXD01030741.1 6706 VCECVLITQWPRDIISNSSAEMHCYQNDTDYEYLYWYRQLSGGQIQLIVYLLAGNANYEPDFKSGFKAERSHTKQWSLTVSSVQQKDEAVYLCAA
Poecilia latipinna V94 trav LMXD01030741.1 5675 IVASQPIIQQSPASILVEPGQAAHLHCYHGDNSYPYMLWYQSAAGGGRRTMDLIGLLHYENQSPEKGFEGRFNMTGHSKGKAQLIVSDAKPGDTAEYFCAAS
Poecilia latipinna V93 trgv LMXD01030741.1 711 AAFGLEVHQSRSDLIVKPGEKVHIFCTHEKTNFWIMLWYQQPPADTALKLIGHLYTSSIKMEDEDDQNIRIVGDLSGSTAKNSSLVINMVEQKHTAIYYCAAQE
Poecilia latipinna V92 trav LMXD01030740.1 10842 HCQDVTQLPKIIWTFEAESAEMNCSHTRDKGHNQMYWYRQRPGETMALVVYTVYGGQPDYEGNSKTKYSAVKDAIETGALTVKDLQPDDSGVYFCAVS
Poecilia latipinna V91 trbv LMXD01030740.1 6954 ASLSDEVHQTPSDLYKKQEQTAEIDCLHNINNYDRILWYKQTADRRMEFLGYMLATIGYPEEGAKVKIEGNANKGQTCTLTIDRLDMNSSAVYFCAAS
Poecilia latipinna V90 trbv LMXD01030740.1 3648 PSAYEVLQTPCFAAPKPGESVMIHCSHSVSIFERILWYKQEKHGALRFLGYMNRNFPNPEGDVKDKMDFGGDGSKHATLNISTVSENDSAVYFCAAS
Poecilia latipinna V89 trbv LMXD01030740.1 2010 ASDSKDVDQIPHSIIKKIGESVDKEIRCSHSIPSYQVILWYKQDKHKALKLLGYQNNDFANLEQDVKGKINFEGDGRKQSILTVSNLTVDDSAVYFCAAS
Poecilia latipinna V88 trav LMXD01030737.1 612 VALGLEVRQSDSDLIRNPRDDVQVFCSHDKTDFRMMLWYQRRPGKTSLNLIGYLNYQAATMEALFNKSFSIQGDLGGSGAKNGSLLIKKVEREHSAVYYCAASK
Poecilia latipinna V87 igkv LMXD01025439.1 118 AKSVQLGQTVTIDCKASRQVDCCYGSHSGHALAWYHQKPGEAPKALIYYTSSRYSGVSSRFSGSGAGNGLDFTLTISGVQAEDAGVYYCQSYHSGDV
Poecilia latipinna V86 ighv LMXD01022346.1 592 VWSQIKLEQSTSEVKRPGETVKMSCVISGYSMTSYNIHWIRQRPGRGLEWIGYMYTGNNRPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARQ
Poecilia latipinna V85 ighv LMXD01022345.1 2270 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSYWMAWIRQAPGKGLEWVATEAQVTQFYSQSVRGRFTVSRDDGREQLFLQMNSLKTEDSAVYYCARD
Poecilia latipinna V84 ighv LMXD01022343.1 6216 ESMESIPSSPLVKMPGETLSLSCRGSGFTFGSHGMNWVKQPAGKPLEWMGYIYTDGSDTDYSSSFQDRIEITRDNSNSMVSLRLSNLSPEDSAVYYCARR
Poecilia latipinna V83 ighv LMXD01022343.1 2825 VRCEQLTQPSSVVLQHGQQLSIGCQVSYSVGSHHTHWIRQPPGKGLEWIGGARVGYATYQKESLKNKFSFSLESSSNTATLNGLNMQPDDTAVYYCARQ
Poecilia latipinna V82 trav LMXD01022342.1 1663 IYGQTLTESAPVVKNAGDSHKLTCTGSGFTFSDFWMHWVRQTPGKGLEWVALIQSTSTAYAQSVQGRFIMSRDNNKEQVYLQMNNLKVEDSAIYYCA
Poecilia latipinna V81 trav LMXD01022341.1 1032 VLSIDLIQPDSQIVQPGQSLTIVCRPSGYSLTAVFATGWIRQRDGKPLEWIFHMWGHNGDFYQNDALKNKFSYSRDISAGTVTITGQNLQPEDAAVYYCVR
Poecilia latipinna V80 trbv LMXD01022339.1 7173 VFSEIKMDQTPSEGKRPGETVKMSCVISGFDMTRHFIHWIRQKPGRALEWVGRMNAGRNSADYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARR
Poecilia latipinna V79 trav LMXD01022339.1 6079 VLSIDLIQPDSQIVQPGQSLTIVCRPSGYSLTAVFATGWIRQRDGKPLEWIFDMWGHNGDFYQNDALKNKFSYSRDISAGTVTITGQNLQPEDAAVYYCVRR
Poecilia latipinna V78 trbv LMXD01022339.1 4290 VFSEIKLDQSETEGKRPGETVKMSCVMSGFDMTSYYIHWIRQKPGRALEWVGRMDTGKNAAIYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARR
Poecilia latipinna V77 trav LMXD01022338.1 2969 VYCIDLIQPDSKVVQPGQSLTITCRPSGYSMTDDDYATGWIRHREGKPMEWIFHMWGGGSLTKNYALKNKFSYIRDTSAGTVTITGQNLQPEDAAVYYCVRRRTVVQ
Poecilia latipinna V76 trav LMXD01022337.1 8222 VKCQQLTQPASVTVQPGQYLTISCQVSYSLSSDWTVWIRQPAGKGLEWIGGAGVGYATYYKESLKNKFSISLESSSKTVTLNGQNMQPGDSAVYYCARETQ
Poecilia latipinna V75 trav LMXD01022337.1 681 DVKCEQLTQPASLTLQPGQPLTISCQVSYDVTSYWTAWIRQPAGKGLEWIGDAKGSSTDYKDSLRNKFSISTDSSSKTVTLKGQNLQLEDAAVYFCAR
Poecilia latipinna V150 trav LMXD01026476.1 1232 CKGDSVTQTEREVVAAAGETRTLGCTYQTSDTTPTLLWYKQEENSFPKYMLKEYAKMRDEALEFSKDRFDAKVNNSEFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V149 trav LMXD01026472.1 1450 CKGDSVTQTEREVVAAAGETRILGCNYESISVTPTLFWYKLEENSFPQYMLKQQTSTTYKAPEFNSSRFDADLNKTKKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V148 trav LMXD01026470.1 1182 CKGDSVTQTEREVVAAAGETRTLGCTFETAYTTPTLFWYKQEVNSFPKYMLKRYSKTAENSPEFSKDRFDSDLNTKAKEKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V147 trav LMXD01026469.1 3208 CKGDSVTQTEREVVAAAGETRTLGCTFEASGTNYALFWYKQEENSFPKYMLKEYVKVPDKAPEFDSNRFNAEINDKSFNLKIQDLRLSDSAVYYCALQPTVTG
Poecilia latipinna V146 igkv LMXD01016083.1 2811 QVTVTQQPAALRADLGGSATIKCRTSQDVYYYRSCSCYLLAWYQQKDGQTPKLLIYATSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSYHSGSV
Poecilia latipinna V145 igkv LMXD01016081.1 1083 TQQPAAVRADLGGSVTISCRTSQDVYYYRSCSCYLLAWYQQKDGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAGVYYCQSFHVINSQYV
Poecilia latipinna V144 igkv LMXD01016081.1 7196 SSGQVTITQTPGSQSVVPGQTVSIQCKVNPSVHYCFNWYLQKPGEVPKLLIRCSSTRHTGIPDRFSGSNSGNTDFTLTISGVQAEDAGVYYCQS
Poecilia latipinna V143 igkv LMXD01016081.1 8391 VRGQVTVTQPAAVKADIGGSATINCRTSQKVFNSNYLAWYQQKDGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQS
Poecilia latipinna V142 igkv LMXD01016081.1 11803 QVTVTQQPAALRADIGGSVNINCRISQNVYSNNHLAWYQQKDGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSYHSGSV
Poecilia latipinna V141 igkv LMXD01016081.1 13306 SSAVITLTQTPGSQSVTPGQTVSISCKASSAVDDDLHWYLQKPGEAPTLLIYEASSRWTGVSDRFTASGYDIDFTLTISRVQAGDAGVYYCQHDEEVP
Poecilia latipinna V140 igkv LMXD01016081.1 17794 QITVTQQPAAVRADIGGSATIRCRTSQNVFNNNYLAWYQQKDGQSPKLLIYATSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia latipinna V139 igkv LMXD01016081.1 19203 SSADIILTQTPVSQSVAPGHTVSIRCKASSSAGTCLNWYLQKDKQSPKLLIYYASSRQSGIPDRFSGSGSGTDYTLTISGIQAEDGGDYYCQQCNSFP
Poecilia latipinna V138 igkv LMXD01006242.1 22330 QITVTQPAVETGTPGSTVTIRCTTNPAVHRWSDGNQGMFWYQQKPGQPPKLIIKYAKTLQSGTPSRFSGSGSGSDFTLTFSGVQTEDAAVYYCQSRHSGLE
Poecilia latipinna V137 trav LMXD01005145.1 406 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia latipinna V136 trav LMXD01005145.1 406 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia latipinna V135 trav LMXD01000595.1 5397 PLSVLTSSPVHLKSSFISAPVGGEVTLRCSYEGDESAWICWYKQTLGQNPKLISSFFVYSPENIFYGEFQNNSRFTLIRKNRTTNLIISNLKMSDSATYYCA
Poecilia latipinna V134 igkv LMXD01000592.1 18874 SGSDIQASVDQPKHATVLPGASVTLNCTVQTGSCGGEHRVYWFRNSDGSPPGLVYGHGTKNEQCETNPYRQTHTCVYDLPVENLDASHAGTYYCAVASC
Poecilia latipinna V133 trgv LMXD01000592.1 24115 QETHLTMSSSLNQETGFLLARVGEKVKMRCTYEGNEPAWICWYMQTLGQKPKLMSSMFVYGTEVTFYEEFKNSSHYVIEKEEHLHYLTIIDLKMSDSATYYC
Poecilia latipinna V132 ighv LMXD01050876.1 38 VGGQTLTESEPVTKRPGESHTLTCTTSGFTLSSYAMSWVRQAPAKGLEWIAYIGTSSSPLLYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia latipinna V131 ighv LMXD01049380.1 26 VGGQTLTESEPVTKRPGESHTLTCTASGFRISSYAINWIRQAPGKGLQWITYIGTYSFPIHYSQSVEGRFLISRDDSNNKIYLKMNQLKAEDTAVYYCARR
Poecilia latipinna V130 ighv LMXD01048877.1 68 VGGQTLTESEPVTKRPGESHTLTCTASGFRISSYAINWIRQAPGKGLQWITYIGTYSFPIHYSQSVEGRFLISRDDSNNKIYLKMNQLKAEDTAVYYCARR
Poecilia latipinna V129 trbv LMXD01047255.1 357 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSNYYMNWIRQAPGKGLEWLAYISSGGGSRYYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYFCARE
Poecilia latipinna V127 trbv LMXD01044710.1 135 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSSYEMNWIRQAPGKGLEWLAYISQSGGYTGYSQSVRGRFTISRDNNKQQLYLQMNSLTTEDSAVYFCARE
Poecilia latipinna V126 igkv LMXD01044234.1 330 TQHPTAVIADIERPVSINCRTSEDVYVYSSKHCLAWYQQKDGQTPKLLIDRTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSYHYINSQNL
Poecilia latipinna V125 trbv LMXD01043801.1 117 VDGQTLTESDSVVKRPGESHKLTCTASGFTFNSYEMDWIRQAPGKGLEWLAYISSGGGSRYYSQSVRGRFTISRDNNKQQLYLQMNSLTTEDSAVYFCARE
Poecilia latipinna V124 igkv LMXD01043486.1 723 SDGNPSVTQSPAVKSAALGETVSLSCSASAGVDDDLSWYQQKPGQPPKLLFYKISSRQSDTPSHFSSSGSEPQFTLTVSGVQADDAGDYYCMGVHSGPV
Poecilia latipinna V123 trbv LMXD01043317.1 1526 VDGQTLTESDSVVNKPGESHKLTCTASGFTFSSYEMNWIRQAPGKGLEWLAYISQSGGYTGYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYFCARE
Poecilia latipinna V122 trav LMXD01042854.1 5868 TDGQTLTQSESVVKSPGESHRLTCTYSGFSSTPYIGWIRQAAGKGLEWIAYISYHSRSIYYSDSVRGRFTISIDNSRSQVYLQMNSLTAADSAVYYCAR
Poecilia latipinna V121 ighv LMXD01042854.1 4218 VKCEQLTQPAAQTVQPGQSLTISCQVSYSLGSYPTFWIRQAAGKTLEWIGAARNGYTTDYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARR
Poecilia latipinna V120 ighv LMXD01042854.1 2951 VKCEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGTGASDYKDSLKNKFSIDAQSSSKTVTLNGQNMQPEDSAVYYCARY
Poecilia latipinna V119 ighv LMXD01042019.1 1902 SHAQTLTESEPVTKRPGESHTLTCTASGFTFPDYAMHWIRQAPGKGLEWVAGISWRSGTSQWYSSSVRGRFTISRDNNKQQVYLQMNSLKTEDSAVYYCARE
Poecilia latipinna V118 trbv LMXD01042019.1 278 VDGQTLTESDSVVKRPGESHKLTCTASGFTFNSYEMDWIRQAPGKGLEWLAAHYNDHNIYYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYFCARE
Poecilia latipinna V117 trbv LMXD01042018.1 1928 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSNYYMNWIRQAPGKGLEWVARISSSGRSTYYSQSVRGRFTISRDNNKQQLYLQMNSLTTEDSAVYFCARE
Poecilia latipinna V116 trav LMXD01040014.1 1000 CKGDSVTQTEREVVAAAGETRILGCNYESISVTPTLFWYKLEENSFPQYMLKQQTSTTYKAPEFNSSRFDADLNKTKKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V115 trav LMXD01039491.1 306 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGTWTAWIRQPAGKGLEWIGVKGTGYTSYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYFCARDSQ
Poecilia latipinna V114 ighv LMXD01039421.1 12302 VGGQTLTESEPVTKRPGESHTLTCTASGFTLSSYYMAWVRQAPGRGLEWIAYIGTYSSPISYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia latipinna V163 igkv LMXD01045452.1 374 KVLTQTPAVHSVSTGQQVVLSCNVQIDHGNYVSWYKQVPGGTPQYILRLHPSHSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYCSTWDDSASEAV
Poecilia latipinna V162 trav LMXD01042964.1 1054 CKGDSVTQTEREVVAAAGETRILGCTFETSVYSNVYLFWYKQEGNSSPKYMLKRFSSTRDNAADFSKDRFDAELNTDKKSVNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V161 igkv LMXD01042895.1 1400 QVTVTQQPAAVRADLGGSVTISCRTSQNIYSIYLAWYQQKDGQTPKLLIDRTGTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHSGSV
Poecilia latipinna V160 igkv LMXD01042895.1 6905 SSGQVTVTQTPGSQSVVPGQTVSIQCKVSPSTGYCFNWYLQKPGEEPKLLIRCASTRHTGIPDRFSGSNSGNTDFTLTISGVQAEDAGVYYCQSYHYISSQWV
Poecilia latipinna V159 trav LMXD01042070.1 2684 VICQLVTPVKDERSGSVDSLVSLSCNYSKGAADYFFWYRQHPGKPPEFLTFNTEVEETQKESQSKFSGRVRKTETRMDLLISSAAVTDSAVYYCAVR
Poecilia latipinna V158 trav LMXD01041112.1 4104 CKGDSVTQTEREVVAAAGSSVTLGCTYQTSYAATLFWYKLEVNSYPEYMLKRFSAGGDNAPGFKKDKFDAQHEKTSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V157 igkv LMXD01040164.1 3791 TQQPAALRADIGVSVNINCRISQNVYFSSSKHCLAWYQQKDGQTPKLLIYYTSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAGVYYCQSYHIISSQWV
Poecilia latipinna V156 trav LMXD01039338.1 5322 TDGQTLTESEPVIKRPGESHRLTCTYSGFSSDPSVAWIRQAAGKGLEWIAYVSSGSGYINYSDSVKGRFIVSRDNSRSRVYLQMNSLTAGDSAVYHCAR
Poecilia latipinna V155 trav LMXD01037872.1 472 CKGDSVTQTEREVVAAAGETRTLGCTFKPSGGNDALFWYKQEENSFPKYMLKEYVKIPDKAPEFDSNRFNAEINDKSFNLKIQDLRLSDSAVYYCALQPTVTG
Poecilia latipinna V153 trav LMXD01037869.1 1417 SSEDLLTPFKDDQLDLEGNNVTLSCNYSGTVNLLLWYRQTPSSSPQLVTSGYSDTTGRLSLRHEKTTKTFHLLISSAAVTDSAVYYCAVR
Poecilia latipinna V152 trav LMXD01026483.1 71 MGSMNTVTQEQREHVASEGSHTGLSCGYDGSIYNVQWYRQQQGSRPEFLLYITETGSIHPTRSDFSADIDKTQKRGNLLISSAAVTDSAVYYCAVQ
Poecilia latipinna V164 trav LMXD01048816.1 117 CKGDSVTQTEREVVAAAGETRTLGCTFEASGTNYALFWYKQEENSFPKYMLKQLSSMKDKAPEFNSSRFDADLNKDDKSFNLKIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V154 trav LMXD01037869.1 664 CKGDSVTQTEREVVAAAGSSVTLGCTFKASGTNYALFWYKQEENSFPKYMLKEYAKMRDEALEFSKDRFDAKVNNSEFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V151 trav LMXD01026478.1 8892 CKGDSVTQTEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKQLSSSKYKAPDFDNDRFDADLNKDDKSFSLKIQDLRPSDSAVYYCALQPTVTG
Poecilia latipinna V128 trgv LMXD01045715.1 524 LAAMATQLVQDDLTLTRRSGQSVSFSCGGTDQCGGYAVVWYQKKDTETFRAILYITSNGRTQKPFNHPQQDDFSADRNQNNCSLTIENVKKDHSASYYCSCDKSG
Poecilia latipinna V113 trav LMXD01039421.1 9682 QSLIESESVVKIPGDSHKLTCTASGFTFSDHWMHWVRQAPGKGLEWVAAVNYGGGNTYYSQSVRGRFTISRDNGKQQLYLQMNSLKTEDSAVYFCARDAQ
Poecilia latipinna V107 trav LMXD01039037.1 3811 VKCEQLNQPASVTLQPGQRLTISCQVSYSLSSYPTAWIRQPAGKGLEWIIRGGVGYSTYYKDSLRNKFSISFVSSSKTVTLNGENMQPEDSAVYFCARE
Poecilia latipinna V74 ighv LMXD01022336.1 1316 VWSEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTDYSMNWIRQKPGKGLEWIGWINTYTAVATYASSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAR
Poecilia latipinna V50 trav LMXD01010566.1 11571 VSIGVIIDQPASLLHEVGQQNVNLKCKQDDDQYLNMYWYRQISNGSMELVAYSLGKDISTIEAPFKDTKYSMSRPSTLSTTLQINQAEPGDSAVYYCASSK
Poecilia latipinna V27 trav LMXD01010248.1 8314 VKSEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGDGYSYYKDSLKNKFSIDAQSSSKTVTLNGQNMQPEDSAVYYCARYDHSDT