WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Poecilia mexicana LMXC00000000.1 (LMXC01) 149 59 0 23 41 21 4 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Poecilia mexicana V25 trav LMXC01017537.1 9350 VKCEQLNQPASVTVQPGQRLTISCQVSYDLGYYTAWIRQPAGKGLEWIGMKDSYGNVYFKDSLRNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARY
Poecilia mexicana V24 ighv LMXC01017537.1 7446 VKCEQLTQPASVTVQPGQRLTISCQVSYSLGYWTAWIRQPAGKGLEWIGMKYTGDSLYKDSLKNKFGIDLDTSSNTVTLNGQNMQPGDSAVYYCARE
Poecilia mexicana V23 trav LMXC01017537.1 5949 VKCEQLTQPASVTVQPGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKFTGNSHYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V22 ighv LMXC01017537.1 86 VKCEQLTQPASLTVQPGQTLTITCQVSYSFSSYYLAWVRQSSGKGLEWIGMKSFWYTFYQDSLKNKFSISLEGSSEAGTLHGQNMQPGDSAVYYCARWNN
Poecilia mexicana V21 ighv LMXC01017536.1 1182 VKCQQLTQPASVTVQPGQGLTISCQVSYSVSSYYTAWIRQPAGKGLEWIGMECIGCNKYYKDSLKNKFSISLDGSSNTVTLNGQNMQPDDSAVYYCARRDTV
Poecilia mexicana V20 trgv LMXC01009575.1 11462 ASLSKDVHQDPPWTLQVPQSSATISCSYSIIGYNQILWYKNPTSDSTLELIGFVYYTRVTLENEFKDRFNISGDGTKESELRVDKLQPEDSSRYYCAAG
Poecilia mexicana V19 trav LMXC01009574.1 14093 LSAEILQPADVISNRGDNVTFECLLGKQFMAHLTMCWYQQKHRGAQIEFILRKNQTNAGRFQLFIDHEENSFTLRIFGLLVSDSSTYYCAA
Poecilia mexicana V18 trav LMXC01009574.1 12641 LTVEVLQPADVISIEGDKVTFECKLGQRFMSYHTMFWYHQKHRGAQIEFILKEFQTDVGRFRSSVDHDKNSFTLGISGLLVNDSSTYYCAASHSDADK
Poecilia mexicana V17 trbv LMXC01009574.1 8595 VCECVLITQWPRDIISNSSAEMHCYQNDTDYEYLYWYRQLSGGQIQLIVYLLAGNANYEPDFKSGFKAERSHTKQWSLTVSSVQQKDEAVYLCAA
Poecilia mexicana V16 trav LMXC01009574.1 7564 IVASQPIIQQSPASILVEPGQAAHLHCYHGDNSYPYMLWYQSAAGGGRRTMDLIGLLHYENQSPEKGFEGRFNMTGHSKGKAQLIVSDAKPGDTAEYFCAAS
Poecilia mexicana V15 trgv LMXC01009574.1 2593 AAFGLEVHQSRSDLIVKPGEKVHIFCTHEKTNFWIMLWYQQPPADTALKLIGHLYTSSIKMEDEDDQNIRIVGDLSGSTAKNSSLVINMVEQKHTAIYYCAAQE
Poecilia mexicana V14 trbv LMXC01009573.1 6999 ASLSDEVHQTPSDLYKKQEQTAEIDCLHNINNYDRILWYKQTADRRMEFLGYMLATIGYPEKGAKVKIEGNANKGQTCTLTIDRLDMNSSAVYFCAAS
Poecilia mexicana V13 trbv LMXC01009573.1 5054 SSQSSKVDQHPADIYKYPNESKAEINCSHDDSTFTRILWYKQSASKGLQFLGYLYGGSGSPEKDVNVMINGKATKGETCTLTVKGLDQNSNAVYFCAAS
Poecilia mexicana V12 trbv LMXC01009573.1 3735 PSAYEVLQTPRFAAPKPGESVMIHCSHSVSIFERILWYKQEKHGALRFLGYMNRNFPNPEGDVKDKMDFGGDGSKHATLNISTVSENDSAVYFCAAS
Poecilia mexicana V11 trbv LMXC01009573.1 2036 SDSKDVDQTPPSIIKKIGESVDKEIRCSHSIPSYQVILWYKQDKHKALKLLGYQNNDFANLEQDVKGKISFEGDGRKQSILTVSNLTVDDSAVYFCAAS
Poecilia mexicana V10 trav LMXC01009570.1 687 VALGLEVRQSDSDLIRNPGDDVQVFCSHDKTDFRTMLWYQRRPGKTSLNLIGYLYYQAATMEALFNKSFSIQGDLGGSGAKNGSLLIKKVEREHSAVYYCAASK
Poecilia mexicana V9 trbv LMXC01009569.1 83 VSDSKHVGQTPPSIIKKTGESVDKEIRCSHSIPNHEVILWYKQDENRTLQLLGYLNFNSVTVERDVKKTISFEGDGRTHSDLTVSDLTADDSAVYFCAARY
Poecilia mexicana V8 trbv LMXC01008822.1 37152 HCQDVIQDPTISWRLKSESTEMKCSHKKDVSHTQMYWYRQRPGETMTLVVYTAFGGQLDYGENLQSKYSAVKDAIETGALTVKDLQPDDSGVYFCAVS
Poecilia mexicana V7 trbv LMXC01008822.1 35701 SSLSEKIVQIPDHAFKHRGETLAIRCSHRIQSYDQILWYRQTDDRELQLLGYMYGTASFPDKELNVTIDGDANKDKTCTITITGLSPDSSAVYFCAAR
Poecilia mexicana V6 trav LMXC01008822.1 20945 VSIGVIIDQPPSLLHEVGQQNVNLKCKQDDDQYLYMYWYRQISNGSMELVAYSLGKDISTIEAPFKDTKYSMSRPSTLSTTLQINQAEPGDSAVYYCA
Poecilia mexicana V5 ighv LMXC01008822.1 15306 LSLGLEVHQSHSDLIKKAGDEVHIFCTHERTNYRVILWYQQSPGDTAMKLIGHLYFKDATMEDGYKKDFGISGDLGGDTAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia mexicana V4 trav LMXC01008822.1 13437 LSLGLEVHQSHSDLITRNGDKVHIFCTHEKTDYRVMLWYQRLPGDTAMKLIGYLHYDKPSMEDGYKKDFGISGDLGGETAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia mexicana V3 trbv LMXC01008822.1 11470 SSLSDQVYQVPDHILGKPGESAIIQCSHTIPNYDRVLWYKQSTQLQFLGHMYKNMDNPEAGLGVKLGGNAEKDQNCTLTLEVLNPNSSGVYFCAAR
Poecilia mexicana V2 trbv LMXC01008822.1 9849 SSLSDQVHQTPSEKFCKTGDKPQISCRHEIQDYTRIFWYKQLTDHQMQLLGYMNVNDGYPETGANVKINGGATKGETCSLTIEGVNTGSSGVYFCAAS
Poecilia mexicana V1 trbv LMXC01008822.1 7836 ASLSDQVHQTPADMFYKPGEAAVINCSHTIDSYDRILWYKHSNGNQMQFLGYMNIKFGTPEPGVKVKINGSANKNDLCTLTVEDLSVSSSAVYFCAAR
Poecilia mexicana V0 igkv LMXC01004995.1 1595 SGSDIQASVDQPKHATVLPGASVTLNCTVQTGSCGGEHRVYWFRNSDGSPPGLVYEHGTKNEQCETNPYRQTHTCVYDLPVENLDASHAGTYYCAVASC
Poecilia mexicana V63 trav LMXC01029914.1 3416 VKCEQLTQPASVTLQPGQTLTISCQVTYDLGYWTAWIRQPAGKGLEWIGVKGTGYTSYKDSLKNKFSINLDTSSKTVTLYGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V62 trav LMXC01029914.1 1905 VKCEQLNQPASATVQPGQRLTISCQVSYDLGSYATHWIRQAAGKGLEWIGYTCRGCTSVYKDSLTNKFSFTLDDSSKTVTLNGQNLQPQDSAVYYCAGE
Poecilia mexicana V61 ighv LMXC01029913.1 4618 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSWWMAWIRQAPGKGLEWVATEAGFTQFYSQSVQGRFTVSRDNGKEQLFLQMNSLKTEDSAVYYCARD
Poecilia mexicana V59 trav LMXC01025258.1 1399 CKGDSVTQTEREVVAAAGETRTLGCTFEASGTNYALFWYKQEENSFPKYILKQYFKTRDKAPEFDSNRFNAEINDKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V58 ighv LMXC01023030.1 17650 LKGEQLNQPPSMTVQAGRSVSITCHVSYSIDSYYTHWIRQPAGKGLEWISRDTAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia mexicana V57 trbv LMXC01023030.1 13972 VDGQTLRESGSVVKRPGESHKLTCTASGFTFSDHWMSWIRQSPGKGPEWLADINDDGDDTYHSQSVQGRFSISRDNSKQQVYLQMNSLTTEDSAVYFCARE
Poecilia mexicana V56 ighv LMXC01023030.1 11848 IYCQTLTESEPAVKRPGESHKLTCTASGFTFSSYWMAWIRQAPGKGPEWIAFISSGSGSSKYYSQSVQGRFTISRDNGRDQLYLQMNNLRTEDSAVYYCAR
Poecilia mexicana V55 ighv LMXC01023030.1 8513 VCCQTLTESDPVVKRPGESHRLTCTASGFTFSSYYINWIRQAPGKGLEWLAAHYNDRNIYYSQSAQGRFTISRDNNKQQVYLQMNSLRTEDSAVYYCAR
Poecilia mexicana V54 ighv LMXC01023029.1 2817 IDGQTLTESESVVKRPGDSHRLTCTYSGFGGHSWNAWVRQAAGKGLEWVATISDTSRSIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Poecilia mexicana V53 ighv LMXC01023029.1 1595 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGSYYTAWIRQPAGKGLEWIGRDTYFKDSLKNKFGGSLDSSSKTVTLNGQNMQPEDSAVYYCARD
Poecilia mexicana V52 ighv LMXC01023027.1 4380 TDGQTLTESESVVKRPGESHRLTCTYSGFGGDPNIAWIRQATGKGLEWIAYIWWNSGGISYSDSVRGRFTISRDNSRSQVYLQMNSLTAADSAVYYCAQE
Poecilia mexicana V51 ighv LMXC01023027.1 1354 TDGQTLTQSESVVKRPGESHRLTCTYSGFSGDPSIAWIRQATGKGPEWIAYIWWNSGGISYSDSVRGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARRDTV
Poecilia mexicana V50 ighv LMXC01023025.1 634 TDGQTLTESESVVKRPGESHRLTCTYSGFSSDPDIAWIRQAAGKGLEWVAYINSASGIIYSDSVRGRFTVSRENRRSQVYLQMNSLTAGDSAVYYCAR
Poecilia mexicana V49 ighv LMXC01023022.1 4511 TDGQTLTQTESVVKRPGESHRLTCTYSGFSSTPYMGWIRQAAGKGLEWIAYIYDDSSYIYYSDSVRGRFTVSRDNSRSQVYLQMNSLTAGDSAVYYCARQ
Poecilia mexicana V48 ighv LMXC01023022.1 2882 VKCEQLTQPAALTVQPGQSLTISCQVSYSLDSYATFWIRQAAGKTLEWIGAARTGYTTSYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARA
Poecilia mexicana V47 ighv LMXC01023022.1 1629 VKCEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGTGASFYKDSLKNKFSIDAQSSSKTVTLNGQNVQPEDSAVYYCDRLDTV
Poecilia mexicana V46 ighv LMXC01023019.1 33 QRMESIPSSSLVKKPGETLNLSCRGSGFTFIDYVMAWIRQPAGKGLEWIGSGYSFLTNDYANSLRGRIEISREYSNSITHLRLFNLRPEDSAVYYCAAE
Poecilia mexicana V45 ighv LMXC01023017.1 370 QRMESIPSSSLVKKPGETLNLSCRGSGFTFTDYYMHWIKQPAGKGLEWLGFGSNNPSNNRYTSSLSGRIEVRKDSSNSMTHLTLSNLKPEDSAVYYCAAE
Poecilia mexicana V44 ighv LMXC01020798.1 9400 LDGQTLTESEPVVKRPGESHKLTCTGSGFTFSSYVMDWIRQAPGKGLEWIAYISNPSGSTQYYSPSVQGRFTISRDNSKQQLYLQMNNLKAEDSAVYYCARH
Poecilia mexicana V43 ighv LMXC01020798.1 333 VVGQTLTQSESVVKRPGESHKLTCPASEFSLTSYWMHWVRQAPGKGLEYIATDAGGNNFYSESVRGRFTASRDYDKQQLYLQMNGLKTEDSALYYCTR
Poecilia mexicana V42 ighv LMXC01020796.1 5952 AHSQTLTESDPVIKSPGASHRLTCTASGFTFGDYRMVWVRQAPGEGLEWIAYISTASTPIHYASSVQGRFTISRDDSRRQLFLQMNSLKAEDTAVYYCARC
Poecilia mexicana V41 ighv LMXC01020796.1 4567 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSSWMAWIRQAPGKGLEWIAIIEYDSDRKFYSQSVQGRFTASRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia mexicana V40 ighv LMXC01020795.1 3981 ESMESIPSSPLVKKPGETLSLSCRGSGFTFGSHGMNWVKQPAGKPLEWMGYIYTHGRNTDYSSSFQGRIEITRDNSNSMVSLRLSNLNPEDSAVYYCART
Poecilia mexicana V39 ighv LMXC01020795.1 3026 VGGQTLTESEPVLKRPGESHTLTCTASGFTFGDYWMHWIREAPGKGLEWVAAISFWAGSDKRYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYYCARG
Poecilia mexicana V38 ighv LMXC01020795.1 733 VRCEQLTQPSSVVLQHGQQLSIGCQVSYSVGTYHTHWIRQPPGKGLEWIGGARVGYATYQKESLKNKFSFSLESSSNTATLNGLNMQPDDTAVYYCARQ
Poecilia mexicana V37 trav LMXC01020793.1 681 SDGQTLTESEPATKEPGESHRLTCTYSGFGSDPHITWIRQPAGKGLEWILTIYSDSSINYAQSMKNRFSPSRDNSRNQVYLQINSLTSQDSAVYYCAQE
Poecilia mexicana V36 trav LMXC01020792.1 914 VLSIDLIQPDSKVVQPGQSLTIVCRPSGYSVTDSYATGWIRQREGKLLEWIFHMWGHTGNLYQNDALKNKFSYSRDISAGTVTITGQNLQPEDAAVYYCVR
Poecilia mexicana V35 trbv LMXC01020791.1 868 VFSEIKMDQTPSEGKRPGETVKMSCVISGFDMTRHYIHWIRQKPGRALEWVGMMNAGSNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARS
Poecilia mexicana V34 trbv LMXC01020790.1 2314 VLSEIKLDQSQTEGKRPGETVKMSCVMSGFDMTEYYIHWIRQKPGRALEWVGRMDAGKNVAIYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARR
Poecilia mexicana V33 trav LMXC01020789.1 996 VYCIDLIQPDSKVLQPGQSLTITCRPSGYSVTDSSYATGWIRHREGKPMEWIFHMWGGGSFYKNEALKNKFSYSRDTSAGTVTITGQNLQPEDAAVYYCVRRDTVIQ
Poecilia mexicana V32 trav LMXC01020788.1 3274 VYCIDLIQPDSKVVQAGQSLTITCQPSGYSMTDDDYATGWIRHREGKPMEWIFEQWGGGAFFKNDALKNKFSYSRDTSAGTVTITGQNLQPEDAAVYYCVRVD
Poecilia mexicana V31 ighv LMXC01020788.1 80 VWSQIKLEQSTSEVKRPGETVKMSCVISGYSMTNNYLHWIRQRPGRGLEWIGRMDNGRNAVIYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYYCARW
Poecilia mexicana V30 ighv LMXC01020786.1 1966 VWSEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTDNDMNWIRQKPGKGLEWIGWINTCSAVATYASSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAR
Poecilia mexicana V29 trav LMXC01019472.1 12038 CKGDSVTQIEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKEYAKMRDEAPEFSKDRFDAKVNNSAFNLTIQDLRPSDSAVYYCALR
Poecilia mexicana V28 ighv LMXC01017538.1 2639 VKCEQLTQQTSATVQPGQRLTIDCQVSYSVGGYLTHWIRQPTGKGLEWIGTSCDGCSPSFKDSLKNKFSITFISSSNTVTLNGENMQPEDSAVYYCARESQ
Poecilia mexicana V27 ighv LMXC01017537.1 13388 VKCEQLTQPASVTVQPGQRLTISCQVSYSLGYWTAWIRQPAGKGLEWIGMKGTGSSYYKDSLKNKFGIDLDTSSNTVTLNGQNMQPGDSAVYYCARE
Poecilia mexicana V26 trav LMXC01017537.1 11478 VKCEQLTQPASVTVQPGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKFTGNSHYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V102 trbv LMXC01040182.1 135 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSSYEMNWIRQAPGKGLEWLAYINSGGGYTYYSQSVRGRFTISRDNNKQQLYLQMNSLTTEDSAVYFCARE
Poecilia mexicana V100 trav LMXC01039940.1 117 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSSYEMNWIRQAPGKGLEWLAYINSGGGYTYYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYFCVRE
Poecilia mexicana V99 igkv LMXC01039912.1 206 QVTVTQHPTAVIADIGRPVSINCRTSQDVYVYSSKHCLAWYQQKDGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSYHSGGV
Poecilia mexicana V98 trgv LMXC01039672.1 1371 LAAMATQLVQDDLTLTRRKGESVSFSCGGTDQCDSGYPVVWYQKKDTETFRAILYIYIGDSPEKLYNHPQQDDFSAERNENSCSLTTENVREDHSASYYCGCWKSG
Poecilia mexicana V97 ighv LMXC01039452.1 2279 VGGQTLTESEPATKRPGESHTLTCTASGFTLSSYYMAWVRQAPGRGLEWIAYIGTYSSPIYYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia mexicana V96 ighv LMXC01038869.1 3996 SHAQTLTESEPVTKRPGESHTLTCTASGFTFTDYAMHWIRQAPGKGLEWVALVSQPTGRDQYYSASVRGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARR
Poecilia mexicana V95 trav LMXC01038869.1 1889 VDGQTLTESDSVVKRPGESHKLTCTASGFTFRSYEMNWIRQAPGKGLEWLAYVSESGGSTLYSQSVRGRFTISRDNIKQQVHLQMNSLKTEDSAVYFCVRE
Poecilia mexicana V94 ighv LMXC01038869.1 158 VGGQTLTESEPATKRPGESHTLTCTASGFRISSYAINWIRQAPGKGLQWITYIGTYSFPIHYSQSVEGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARR
Poecilia mexicana V93 ighv LMXC01037633.1 1302 VKCEQLTQPASLTVQSGQTLSISCQVSYSVTSYGTHWIRQPAGKALEWMGAIWYDGSNAYASNVQRRITITRDTSKNTVYLSLSTMKPEESAVYYCAR
Poecilia mexicana V92 ighv LMXC01037633.1 290 GVKCEQLTQPASVTVQPGQTLTIICQVSYSLSTWTHWIRQPAGKGLEWIGYMCSGCTGARKDSLKNKFTITVQESSNTVTLNGQNLQPEDSAVYYCARD
Poecilia mexicana V91 ighv LMXC01037482.1 1348 VKCEQLTQPASLTVQSGQTLSISCQVSYSVTSYGTSWIRQPAGKALEWMGVIWYHGGDAYATNVQGRITITRDTSKNIVYLSLSAMKPEESAVYYCARY
Poecilia mexicana V90 trav LMXC01037482.1 301 VKCEQLTQPASVTLQPGQTLTISCQVTYDLGYWTAWIRQPAGKGLEWIGVKGTGYTSYKDSLKNKFSINLDTSSKTVTLYGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V89 ighv LMXC01037472.1 2276 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSSWMAWIRQAPGKGLEWIAIIEYDSDRKFYSQSVQGRFTASRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia mexicana V88 ighv LMXC01036265.1 1678 VKCEQLTQPAALTVQPGQSLTISCQVSYSLDSYATFWIRQAAGKTLEWIGAARTGYTTSYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARA
Poecilia mexicana V87 ighv LMXC01036265.1 424 VKCEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGTGDSYYKESLKNKFSIDAQSSSKTVTLNGQNVQPEDSAVYYCARY
Poecilia mexicana V86 igkv LMXC01035315.1 225 KSVQLGQTVTIDCKASRALSTSECSYSSRVCLSWYHQKPGEAPKALIYGTSSRFSGISSRFSGSGAGNGLDFTLTISGVQAEDAAVYYCQSFHYINSQYL
Poecilia mexicana V85 igkv LMXC01035314.1 3526 SSGDIILTQTPGSQSVAPGQTVSIRCKTSSSVYSNLNWYLQKPAEAPKLLIYLATTRQSGVPARLSGSGSDPDFTLTISGVQAEDSGVYYCQQGYDTP
Poecilia mexicana V84 igkv LMXC01035314.1 1583 SDGQNVVVTQSAAKSVQLGQTVTIDCKASRQLTGCSTPCLSWYHHKPGEAPKALIYYTSSRFSGISSRFSGSGAGNGLDFTLTISGVQAEDAGVYYCQSYHSGPV
Poecilia mexicana V83 ighv LMXC01034270.1 3261 VGGQTLTESEPATKRPGESHTLTCTASGFTLSSYAMSWVRQAPGKGLEWIAYIDTYSSPIYYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia mexicana V82 ighv LMXC01034270.1 2072 SHAQTLTESEPVTKRPGESHTLTCTASGFTFTDYAMHWIRQAPGKGLEWVALVSQPTGRDQYYSASVRGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARQ
Poecilia mexicana V81 trbv LMXC01034269.1 13912 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSNYYMNWIRQAPGKGLEWVARISSSGRSTYYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYFCARE
Poecilia mexicana V80 ighv LMXC01034269.1 12169 VGGQTLTESEPVTKRPGESHTLTCTASGFTLSNYYMAWVRQAPGRGLEWIAYIGTYSSPISYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia mexicana V79 ighv LMXC01034269.1 11039 SHAQTLTESEPVTKRPGESHTLTCTASGFTFTDYIMHWIRQAPGKGLEWVAGVSQRSGSSQWYSASVQGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARQ
Poecilia mexicana V78 ighv LMXC01034269.1 6383 LKGEQLNQPPSMTVQAGRSVSITCHVSYSIDSYYTHWIRQPAGKGLEWISRDTAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia mexicana V77 trbv LMXC01034269.1 2705 VDGQTLRESGSVVKRPGESHKLTCTASGFTFSDHWMSWIRQSPGKGPEWLADINDDGDDTYHSQSVQGRFSISRDNSKQQVYLQMNSLTTEDSAVYFCARE
Poecilia mexicana V76 ighv LMXC01034269.1 581 IYCQTLTESEPAVKRPGESHKLTCTASGFTFSSYWMAWIRQAPGKGPEWIAFISSGSGSSKYYSQSVQGRFTISRDNGRDQLYLQMNNLRTEDSAVYYCAR
Poecilia mexicana V75 ighv LMXC01031700.1 4484 VWSQIRLEQSTSEVKRPGETVKMSCVISGYSMTSYNIHWIRQRPGRGLEWIGYMYTGSNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARE
Poecilia mexicana V74 ighv LMXC01031700.1 3116 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSYWMAWIRQAPGKGLEWVATEAGFTQFYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Poecilia mexicana V73 ighv LMXC01031698.1 2907 VFSQTLTESEPATKQPGESHTLTCTYAGISDGNAEISWIRQAEGKGLEWVAYISAPKGSDKYYSPSVQNRFTISRDNNKDQVYLHMTSLRTEDSAVYYCARE
Poecilia mexicana V72 ighv LMXC01031698.1 1458 ARGQSLTSSEAVISKAGQSVILSCKVQGMPLTWLHWIRQKPLKALEWIGRIDSGTGTVFAQHLQGQFSITKDTSENTVSLSVKNLKPEDSAVYYCAKETQ
Poecilia mexicana V71 ighv LMXC01031697.1 352 VDGQTLTESEPVVKNPGNSHKLTCTGSGFTFSSSWMAWIRQAPGKGPEWVATIEYDSDSKFYSQSVQGRFTISRDNNKQQLYLQMINLKIEDSAVYYCSR
Poecilia mexicana V70 trbv LMXC01031696.1 332 VDGQTLTESDSVVKRPGESHKLTCTASGFTFSNYYMNWIRQAPGKGLEWVARISSSGRSTYYSQSVRGRFTISRDNNKQQLYLQMNSLKTEDSAVYLCARE
Poecilia mexicana V69 ighv LMXC01029918.1 2600 VWSEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTDNGMNWIRQKPGKGLEWIGWINTYTVVATYGSSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAR
Poecilia mexicana V68 ighv LMXC01029916.1 3887 VKCEQLTQPASSTVQSGQTLTISCQVSYSVTSSGTHWIRQPAGKALEWMGVIWSGGSNNYATIVQGRIEITRDTSKNMVTLRLSTMKPEESAVYYCAK
Poecilia mexicana V67 ighv LMXC01029916.1 1465 VKCEQLTQPASLTVQSGQTLTISCQVSYSVTSSGTHWIRQPAGKALEWMGVIWYHGGDAYATNVQGRITITRDTSKNIVYLSLSAMKPEESAVYYCARY
Poecilia mexicana V66 trav LMXC01029916.1 294 LKCEQLTQPASVTLQPGQTLTISCQVSYSVRSYYTAWIRQPAGKGLEWIGSAADGSTTYYKDSLRNKFSLSIDSSSNTVTLNGQNMQPGDSAVYYCARD
Poecilia mexicana V65 ighv LMXC01029915.1 296 VKCEQLTQPASLTVQSGQTLTISCQVSYSVTSYHTHWIRQPAGKAPEWMGVIWNNGRNAYASNVQGRIKITRDTNKNTMYLSLSAMKPEESAVYYCARE
Poecilia mexicana V141 igkv LMXC01038510.1 1058 VRGQYTLTQPAAVRADLGRSVTINCRTSQNVYVSGSSHCLAWYQQKDGQTPKLLIYYASTKESGTPSRFSARGSNSDFTLTISGVQAEDAGVYYCQSYHIINSQYL
Poecilia mexicana V140 trdv LMXC01037201.1 20 SSPSDKIVQIPADMFRNPGETAKISCSHSIPDYDRIFWYKQSEHHEMKLLGYMLGDDGYPEKELNVKIDGSANRDKNSTLTVAELSQDSSAIYYCAAC
Poecilia mexicana V139 trbv LMXC01037201.1 1891 SSLNNKVHQTPLNILAKRGGEARIRCSHDIQNYNIILWYKRLENKQLQLLGYRLIDNTTPEPGTGVKMELEGNANKGQNCTLVIKELNENSSAVYYCAASYHSAE
Poecilia mexicana V138 trbv LMXC01037201.1 3516 SSLSDQVHQTPADLFQEPGGTAVINCTHSIDSYDVILWYKHSTSSQMQLLGYNDVVNGYPEKDVKVKISGSASKDKICTLTVEDLSVSSSAVYFCAARYHSASY
Poecilia mexicana V137 igkv LMXC01036503.1 4087 QVTVTQPAAVRADIGGSATINCRTSQDVYNNNCLAWYQQKDGQTPHLLFYYVGSRVSGTPNRFNDGGSNSDFTLTISGVQAEDAAVYYCQSYHSGGV
Poecilia mexicana V136 igkv LMXC01036503.1 6796 SSGQVTVTQTPGSQSVVPGQTVSIQCKVSPSTSYCFSWYLQKPGEVPKLLIRCSSTRHTGIPDRFSGSKSSNTDFTLTISGVQAEDAGVYYCQS
Poecilia mexicana V135 ighv LMXC01036352.1 132 TDGQTLTQSESVVKRPGESHRLTCTYSGLGNPHIAWIRQATGKGLEWIAVIWSDSSGMYYSASVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCAR
Poecilia mexicana V134 trav LMXC01036350.1 452 IKCEQLTQPASVTLQPGQRLTIRCQVSYSMSSYATAWIRQPAGKGLEWIGWKYTGGSYYKDSLRNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V133 trav LMXC01036333.1 801 QVSVTQQPAAVRADLGGSVTITCRTGQNVFVYNSKHYLAWYQQKDGQSPKLLIDRTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCKGEFDVSKYEL
Poecilia mexicana V131 trav LMXC01036092.1 5684 CKGDSVTQIEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKEYAKMRDEAPEFSKDRFDAKVNNSAFNLTIQDLRPSDSAVYYCALR
Poecilia mexicana V130 trav LMXC01034605.1 72 MGSMNTVTQEQREHVASEGSHTGLSCGYDGSIYNVQWYRQQQGSRPEFLLYITETGSIHPTRSDFSADIDKTQKRGNLLISSAAVTDSAVYYCAVQ
Poecilia mexicana V129 trav LMXC01034604.1 4572 CKGDSVTQTEREVVAAAGSSVTLGCTYQTSYAATLFWYKLEVNSYPEYMLKRFSAGGDNAPGFKKDKFDAQHEKTSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V128 trav LMXC01033832.1 1247 IICQLVTPVKDERSGSVDSLVSLSCNYSKGAADYFFWYRQHPGKPPEFLTFNTEVEETQKESQSKFSGRVRKTETRMDLLISSAAVTDSAVYYCALQ
Poecilia mexicana V127 trav LMXC01033831.1 1530 CKGDSVTQTEREVVAAAGETWTLGCNYESISVTPTLFWYKLEENSFPQYMLKQQTSTTYKASEFNSSRFDADLNKTKKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V126 trav LMXC01033531.1 472 CKGDSVTQTEREVVAAAGETRILGCTFETSVGTDALFWYKQEENSFPKYMLKEYVKVPDKAPEFDSNRFNAEINDKSFNLKIQDLRLSDSAVYYCALQPTVTG
Poecilia mexicana V125 trav LMXC01033529.1 684 CKGDSVTQTEREVVAAAGSSVTLGCTFKVSATNYALFWYKQEENSFPKYMLKEYAKMRDEAPEFSKDRFDAKVNNSEFNLKIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V124 trbv LMXC01033361.1 603 LVCNSRIQQSLPQIVKENSQVQIQCSHEDKTRPFMLWYQQRDHGQPVIFIGYEYGTKAQIYGGPFEEQFKMKRENSLTGILTVLSANPSHSAVYFCAIT
Poecilia mexicana V123 igkv LMXC01033147.1 2039 TQQPAAVRADIGGSATINCRTSQDVYVYSSSYHCLAWYQQKDGQTPKRLIYYASTRDSGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSLHNIGSQW
Poecilia mexicana V122 igkv LMXC01033146.1 1311 QITVTQQPAAVRADIGGSVNINCRTSQNINSNYFSWYQQKDGQTPKLLIDRTSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCMGEFYIS
Poecilia mexicana V121 igkv LMXC01033145.1 2783 SSGDIILTQTPGSQSVAPGQTVSIRCKASSSAGGYLNWYLQKDKQSPKLLIYYASSRQSGIPDRFSGSGSGTDFTLTISGIQAEDGGDYYCQQCNSLP
Poecilia mexicana V120 trav LMXC01031893.1 10999 CKGDSVTQIEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKQLSSSKYKAPDFDNDRFDADLNKDDKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V119 trav LMXC01031890.1 1121 CKGDSVTQIEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKEYYQITDNAPEFSKDRFDAKINNSAFDLKIQDLRPSDSAVYYCALR
Poecilia mexicana V118 igkv LMXC01023406.1 701 QITVTQPAVETVTPGSTVTIRCTTNPAVHRWSDGNQGMFWYQQKPGQPPKLIIKYAKTLQSGTPSRFSGSGSGSDFTLTFSGVQTEDAAVYYCKSRHSGLE
Poecilia mexicana V117 igkv LMXC01023405.1 1728 SDGNPSVTQSPAVKSAALGETVSLSCSASAGVDEDLSWYQQKPGQPPKLLFYKITSRQSDTPSHFSSSGSEPQFTLTISGVQADDAGDYYCMGVHGGPV
Poecilia mexicana V116 trgv LMXC01008565.1 1601 LAAMATQLVQDDLTLTRRSGQSVSISCGTGQCGTNYVYWYQKKDTETFRAILYIYSGGSPSKLNHPQQDDFSAERNQNSCKLKINKVKLDHSASYYCGCYKSG
Poecilia mexicana V115 trav LMXC01007772.1 5390 PPSVLTSSPVHLKSSFISAPVGGEVTLRCSYEGDESAWICWYKQTLGQNPKLISSFFVYSPENIFYGEFENNSRFTLIRKNRTTNLIISNLKMSDSATYYCA
Poecilia mexicana V114 igkv LMXC01007236.1 779 VRGQYTLTQPAAVRADLGRSVTINCRTSQNVYVSGSTHYLAWYQQKDGQTPKLLIYYASTKESGTPSRFSARGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia mexicana V113 igkv LMXC01007236.1 6360 TQQPAAVRADIGGSATINCRTSQDVYYSSGCSCYRFAWYQQKDGQTPKLLIYNVNTRASGTPSRFSARGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia mexicana V112 igkv LMXC01007234.1 355 SSAVITLTQTPGSQSVTPGQTVSISCKASSAVDDDLHWYLQKPGEAPKLLIYEASSRWTGVSDRFTASGYDIDFTLTISRVQAEDAGVYYCQHDEEVP
Poecilia mexicana V111 igkv LMXC01007234.1 4840 QITVTQQPAAVRADIGGSATIRCRTSQNVYNNNYLAWYQQKDGQTPKLLIYTTSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Poecilia mexicana V110 igkv LMXC01007234.1 6251 SSADIILTQTPVSQSVAPGQTVSIRCKASSSAGGYLNWYLQKDKQSPKLLIYYASSRQSGIPDRFSGSGSGTDFTLTISGIQAEDGGDYYCQQCNSLP
Poecilia mexicana V109 trav LMXC01005726.1 31929 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia mexicana V108 trav LMXC01005726.1 31929 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia mexicana V107 igkv LMXC01000782.1 13221 QVTVTQPAAVRADIGGSATINCRTSQDVYVYSSSYHCLAWYQQKDGQTPKRLIYYASTRDSGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia mexicana V106 ighv LMXC01047503.1 61 MKCEQLTQPASETLQPGQRLTIRCQVSYSGYATHWIRQPAGKGLEWIGWKYTGGSYYKDSLRNKFSIDLDTSSKTVTLNGQNMQPGASAVYYCARD
Poecilia mexicana V105 igkv LMXC01040332.1 318 QVTVTQHPTAVIADIGRPVSINCRTSQDVYVYSSKHCLAWYQQKDGQTPKLLIYWSSSRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHYINSQAV
Poecilia mexicana V104 ighv LMXC01040272.1 31 QRMESIPSSSLVKNPGETLNLSCRGSGFTFNSYVMHWIRQPEGKGLEWLGFGSNNPSNNRYASSLSGRIEIRKDSSNSMTHLTLSNLRPEDSAVYYCAAE
Poecilia mexicana V147 igkv LMXC01041461.1 449 QVTVTQQPAAVRADLGGSVSINCRISQNVYNNNHLAWYQQKDGQTPKLLIYTTSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQHV
Poecilia mexicana V146 trav LMXC01039436.1 474 QITVTQQPAAVRADIGGSATIRCRTSQNIHGNYLAWYQQKDGQTPMLLIDRTSPRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCKGEFDVSKYEL
Poecilia mexicana V145 igkv LMXC01039436.1 2286 SSGQVTVTQTPGSQSVVPGQTVSIQCKVSPSTSYCFSWYLQKPGEVPKLLIRCSSTRHTGIPDRFSGSKSSNTDFTLTISGVQAEDAAVYYCQSYHYINSQAV
Poecilia mexicana V144 trav LMXC01039107.1 3161 CKGDSVTQTEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKQLSSSKYKAPDFDNDRFDADLNKDDKSFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia mexicana V143 trav LMXC01039063.1 236 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia mexicana V148 igkv LMXC01045845.1 35 TQQPAAVRADIGGSATINCRTSQDVYVYSSSYHCLAWYQQKDGQTPKRLIYYASTRDSGTPSRFTGSGSNSDFTLTISGVQAEDAGVYYCQSYHIINSQYL
Poecilia mexicana V142 trav LMXC01039063.1 236 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia mexicana V132 trav LMXC01036092.1 1656 CKGDSVTQTEREVVAAAGETRILGCTFETAYTTPTLFWYKQEENSFPKYMLKRYSKTVENSPEFSKDRFDADLNTEAKEKSFNLTISDLRPSDSAVYYCALRPTVTG
Poecilia mexicana V103 trav LMXC01040204.1 303 IKCEQLTQPASVTLQPGQRLTIRCQVSYSGYATHWIRQPAGKGLEWIGYRYTGGSYYKDSLRNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia mexicana V101 ighv LMXC01039962.1 575 VGGQTLTESEPATKRPGESHTLTCTASGFRISSYAINWIRQAPGKGLQWITYIGTYSFPIHYSQSVEGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARR
Poecilia mexicana V64 ighv LMXC01029914.1 4463 VKCEQLTQPASLTVQSGQTLSISCQVSYSVTSYGTSWIRQPAGKALEWMGVIWYHGGDAYATNVQGRITITRDTSKNIVYLSLSAMKPEESAVYYCARY
Poecilia mexicana V60 ighv LMXC01029912.1 590 VWSQIKLEQSTSEVKRPGETVKMSCVISGYSMTSYNIHWIRQRPGRGLEWIGYMYTGSNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARE