WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Poecilia reticulata AZHG00000000.1 (AZHG01) 97 46 0 9 27 11 3 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Poecilia reticulata V31 trbv AZHG01014539.1 1259 SSLSDQVIQLPANIIKNSGKDTVIKCSHQAPNFDKILWYKQTEDHQMQYLGYMNVNIGYPETGVKVKIDGEATEGKTCSLTIEGVDTSSSGVYFCAAS
Poecilia reticulata V30 trav AZHG01014537.1 197 LSLGLEVHQSHSDLIKKTGDKVHIFCTHEKTDYRVMLWYQRLPGDTAMKLIGYLHYDKPSMEDKNEKDFEISGDLGGDTAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia reticulata V29 trav AZHG01014532.1 2235 FSVSAVNFQQLPSVFVKVGDQSVTLWCDQDNNQNYYMFWYRHPAGSGKMELVAYSVGKDAAAIEAPFSKTKYTLTRPEVLRSSLQIHSPEAADSAVYYCASSL
Poecilia reticulata V28 trbv AZHG01014532.1 9235 ASLGDQVRQTPLNIVENRGEAARISCSHSIQMYNMILWYKRLEDKQLQLLGYRFFGETLLEPGVAVKVEGSADRDQTCTLMIKELNESSSGVYFCAASYHSAAQ
Poecilia reticulata V27 trav AZHG01001423.1 12570 LIHTVEDSHLISLTLVDIGDSITFDCSTSEKELKFLYWYKQSLGHMVEIVASVILGQQTISDKYKGSHFVTIKGSRYDLTIINISKEDEATYFCHIGTTY
Poecilia reticulata V26 igkv AZHG01038544.1 1525 QVTVTQPAAVRVNLGGSVTINCRTSQNIYVYSSNHHQCFAWYQQKDGQTPKRLIYFVSTRESGTPSRFTGRGSNSDFTLTISGVQAEDAAVYYCQSLHYISNKDV
Poecilia reticulata V25 igkv AZHG01038511.1 1451 SNSEITVTQPALVTYSPGSTVTVTCDTNPSVYKWSDGDFRTYWYQQKPGNSPKLVINLGKNPTSEFSSRFSGRGDGAKAEMTISGVEAQDAAVYYCKSJHVVNSAFV
Poecilia reticulata V24 ighv AZHG01037516.1 5242 TDGQTLTESESVVKRPGESHRLTCTYSGFSGTPDIAWIRQAAGKGPEWIAYISYHSRSIYYSDSVRGWFTISRDNSRSQVYLQMNSLTAEDSAVYYCARR
Poecilia reticulata V23 trav AZHG01037516.1 3298 VKCEQLTQPASLTVQSGQTLTITCQVSYSFSSYYAAWIRQPAGKGLEWIGVKSVYHTFYQESLKNKFSIVLDSSSKTATLNGQNMQPGDSAVYYCARE
Poecilia reticulata V22 ighv AZHG01035763.1 11865 IYCQTLTESGSVVKKPGESHKLTCTASGFSFSSYWMNWIRQAPGKGPEWVAQISSGGSGKYYSQSVQGRFTISRDNSRDELYLQMNSLRTEDSAVYHCVRE
Poecilia reticulata V21 ighv AZHG01035763.1 9120 ADGQTLTESESVVKTQGESHKLTCTASGFSISSRWMHWIRQAPGKGLEWVAAHYDNRNIIYSQSVQGRFTISRDDGRNQLYLQMNSLRTEDSAVYYCARD
Poecilia reticulata V20 ighv AZHG01035763.1 2273 IDGQTLTESESVVKRPGESHRLTCTYSGFGGNSWNAWIRQAAGKGLEWVATISDTSSYIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Poecilia reticulata V19 ighv AZHG01035763.1 1061 VNCEQLTQPASVTLQPGQSLIINCQVSYDLNSYYTAWIRQPAGKGLEWIGRDTDFKDSLKNKFGGSLDTSSKTATLNGQNLQPEDSAVYYCARQR
Poecilia reticulata V18 ighv AZHG01035762.1 13343 TNGQTLTESESVVKRPGDSHRLTCTYSGLGNPHMHWVRQAAGKGPEWIAYIWYDSGGIYYSDSVRGRFTISRDNSRNQVYLQMNSLTAGDSAVYYCARQ
Poecilia reticulata V17 trav AZHG01035762.1 6245 IKCEQLTQPASVTVQPGQRLTISCQVSYSLSSYTAWIRQPAGKGLEWIGLKNTGYSYYKDSLQNKFSIDLDTSSKTVTLNGQNMQLGDSAVYYCARETQ
Poecilia reticulata V16 ighv AZHG01035762.1 3380 TDGQTLTESESVVKRIGESHRLTCTYSGFSSTPYIAWIRQAAGKGLEWIAYIYSDSSGIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Poecilia reticulata V15 ighv AZHG01035761.1 11810 VKCEQLTQPAAQTVQPGQSLTISCQVSYSLGSYSTFWIRQAAGKTLEWIGAARTGYTTNYNNMMKNKFSITLQDSSKTVTLNGQNMQPEDSAVYYCARA
Poecilia reticulata V14 ighv AZHG01035761.1 8430 VKCEQLTQPASVTLQPGQRLTISCQVSYSTGSYWTAWIRQPAGKGLEWIGMKHGTGPSYYKESLKNKFSIDAQSSSNTVTLNGQNVQPEDSAVYYCARQ
Poecilia reticulata V13 ighv AZHG01035761.1 6990 VKCEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGGGSSYYKESLKNKFSIDAQSFSSTVTLTGQNVQPEDSAVYYCARY
Poecilia reticulata V12 trav AZHG01035761.1 4002 VKCEQLTQPTSVTLQPGQRLTISCQVSYSLGDRYTSWIRQPAGKGLEWIGMRYTGESYYKDSLKNKFSIDLDTSSKTVTLNGQNVQPGDSAVYYCAAV
Poecilia reticulata V11 ighv AZHG01035760.1 21787 VNCEQLTQPDSVTVQPGQRLTISCQVSYSISTYWTAFIRQAAGKGLEWIGDNDSYGNENYKESLKNKFSIDVDTNSNTVTLNGQNMQPEDSAVYYCARR
Poecilia reticulata V10 ighv AZHG01035760.1 18615 QRMESIPSSSVVKKPGETLSLSCRGSGFTFTDYVMAWIRQPAGKGLEWIGYGYSSQSSNIYASSVRGRIEISREDSNSMTHLRLSNLKPEDSAVYYCAV
Poecilia reticulata V9 ighv AZHG01035760.1 15159 QRMESIPSSSVVKNPGETLSLSCRGSGFTFTSYAMAWIRQPAGKGLEWIGSGFNNPSSNDYASSLSGRIEIRKDSSNSITHLTLSSLRPEDSAVYYCA
Poecilia reticulata V8 ighv AZHG01035760.1 11852 VKCEQLTQPASVTVQPGQRLTISCQVSYSLGYYTAWIRQPAGKGLEWIGMKDTGSSYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARV
Poecilia reticulata V7 trav AZHG01035760.1 10192 VKCQQLTQPASVTVQPGQSLTISCQVSYSLSIYTAWIRQPAGKGLEWIGMKFTGNSLYKDSLKNKFSIDLDTYSKTVTLNGQNMQPDDSAVYYCGRC
Poecilia reticulata V6 trav AZHG01035760.1 4549 VKCEQLTQPASLTVQSGQTLTITCQVSYSFSSYYAAWIRQPAGKGLEWIGVKSVYHTFYQESLKNKFSIVLDSSSKTATLNGQNMQPGDSAVYYCARWNDY
Poecilia reticulata V5 trav AZHG01035759.1 11177 VLGQIKLEQPPSVVKKPGEAAKISCSVNGFDIANEFVHWTRQKTGRALEWIGRQSRSRQEYSSSFQSRFALSYDASSSSAHLSIRSLTEEDSALYFCAHTAQ
Poecilia reticulata V4 trav AZHG01030595.1 60 SIIQVSVTQQPAAVRADLEGSVSIRCRTSQNVYVYNSNHRLAWYQQKDGQTPKLLIYRSSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCKGEFDASKYDL
Poecilia reticulata V3 igkv AZHG01030594.1 3748 SSGDIIMTQTPGSLSVDAGQRVSIKCKASESVSDEVDWYLQKPGEAPKLLIYHVSNRQPGVPDRFSGTKSGTDFTLTISRVQAEDAGVYYCQQDWSFP
Poecilia reticulata V2 igkv AZHG01028860.1 1382 SVAEIILTQTPGSQSVTLGQTVSIRCKASSSISNDLQWYIQKPGEAPKILIYDANSRWSGVPDRFSGSQSGTDFTLTISRVQAEDAGVYYCQQDWSFP
Poecilia reticulata V1 igkv AZHG01028857.1 58 TQQPAAVRAEVGGTVNINCRMSQNVHLHISSFHCLAWYQQKDGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQS
Poecilia reticulata V68 ighv AZHG01030704.1 5543 VFGQTLTQSESVNKRPGESHKLTCTTSGFTLSSYWMGWVRQATGRGLEWIAADTGGSTNYYSQSVQGRFTVSRDNSRQQLYLQMNSLKAEDSAVYYCAR
Poecilia reticulata V67 ighv AZHG01030704.1 6896 LKVIRESEPAVKNPGESHRLTCTTSGFSFSSSVWVWIRQPPGKRLEWIALVHTASTPIYHSDSVRGRFSISRDDSSSKVYLQMNSLKTEDSAVYYCARR
Poecilia reticulata V66 ighv AZHG01030704.1 8408 VVGQTLTQSESVVKRPGESHKLTCTASEFSLTGYWMHWIRQAPGKGLEYIATDAGGNNFYSDPVRGRFTASRDYDKQQLYLQMNGLKTEDSALYYCAR
Poecilia reticulata V65 ighv AZHG01030704.1 9671 VFCVELIQPDSKIVQPGGSLSITCRVSGYSLTDSSYATSWIRQRDGKTLDWILTMWYDGSLSQNNALKNKFSSNRDTSAGTITITGQTLQPEDTAVYYCVR
Poecilia reticulata V64 trbv AZHG01030704.1 11477 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIEYDSDGKFYSQSVQGRFTASRDNSREQLYLQMNSLKAEDSAVYFCARR
Poecilia reticulata V63 ighv AZHG01030704.1 13393 VRCDQLTQPASVTLQSGQTLTISCQVTYSLDQRHTHWIRQWEGKGWEWIGVDRVGYNSYYKDSLKNQFSISLYSSSKTVTLNGQNMQPDDTAVYYCAR
Poecilia reticulata V62 ighv AZHG01030704.1 14842 VRCEQLMQPASLTVQPGGHLSISCQVSYLLTSARTHWIRQPAGKGLEWICSAHVGHGTFYKESVKNKFRLDLDQASKIVTLKGQNMQPEDTAVYHCAREP
Poecilia reticulata V61 ighv AZHG01030704.1 23154 CRGESMESIPSSPVVKKPGETLSLSCRGSGFTFGSHGMNWVKQSAGKPLEWMGYIYTHGSDTSYSSSFQGRIEITRDNSNSMVSLRLSNLNPEDSAVYYCARR
Poecilia reticulata V60 ighv AZHG01030704.1 24092 VGGQTLTESEPVVKRPGESHKLTCTASGFTFGDYWMNWVRQAPGKGLEWVAAISYWAGSDKGYSQSARDRFTISRDNNKKQVFLQMNSLKTEDSAVYYCARG
Poecilia reticulata V59 ighv AZHG01030704.1 25282 LTGQSMESIPSSHVVKKPGETLNLSCRGSGFSFDCCSMHWIRQPARKGLQWMGRVYSHGRTTEYSSSFQNRIEITRDNSNSLVYLTFPNLKPEDCAVYYCAKQ
Poecilia reticulata V58 ighv AZHG01030704.1 26429 VRCEQLTQPSSVVLQQGQQLSIGCQVSYSVGSHHTHWIRQRPGKGLEWIGGARVGYATYQKESLKNKFSFSLESSSNTVTLSGLNMQPDDTAVYYCARQ
Poecilia reticulata V57 ighv AZHG01030704.1 27728 CSGQNMESIPSSPVVQRPGESLSLSCRGSGFTFSCCVMIWVKETAGKPLELLGSGFSDPSRNSYASSVRGRVEISREDSNSLVYLHLSNLKPEDSAVYYCAKES
Poecilia reticulata V56 ighv AZHG01030704.1 29227 VAGQTLTESEPVTKRPGESHRLTCTGSGFRFSSYPMNWVRQAPGKGLEWIAFVHTGSSSRYYSQSVQGRFTISRDDSSSKVYLQMNNLRTEDTAVYYCARR
Poecilia reticulata V55 ighv AZHG01030704.1 33118 TDGQTLTQSESVARRPGESHTLTCTFSGFSSKPYIHWIRQAAGKRPEWLGWISDDGSRSGYFESVKNRFTISRDNNRQQVDLQLTGLKAEDSSVYYCARA
Poecilia reticulata V54 trbv AZHG01030704.1 34734 CKCQSMESIPSSAVVKTPGETLSLSCRGSGFTFSCCWMHWIRQPAGKPLEWMGLIYTDGSGTPYSSSLQGRIEITRDNSKNMVYLTLSNLRPEDSAVYFCAKD
Poecilia reticulata V53 ighv AZHG01030703.1 52100 ADGQTLTQSESVIKRPGESHKLTCTGSGFALSSHWMDWVRQVPGKGPEWVATETQSSQYYSPSVRGRFHVSRDNNRQQVYLQINSLKTEDSAVYYCTRN
Poecilia reticulata V52 trav AZHG01030703.1 53622 VICEQLTQPDSVNVHPGQPLTVTCQVSYSVTSYWTCWIRQAAGKGMEWFGCRVGSTTSYKDSLKNKFSIDIDSSRNTVTLKGQNMQPEDTAVYFCARD
Poecilia reticulata V51 trav AZHG01030703.1 55111 ADGQTLTQSGSVSKVPGESHTLTCTGSGFTFSSYCMNWIRQAAGKGLEWVAADCGGSSKYYSQSVQGRFTISRDNGKQQLYLQMNSLRTEDSAVYYCARE
Poecilia reticulata V50 ighv AZHG01023579.1 1149 KSVQLGQTVTVDCKASRALSTSHCNINSQVCLSWYHQKPGEAPKALIYVTSTRFSGISSRFSGSGSGNGLDFTLTISGVQAEDAGVYYCMS
Poecilia reticulata V49 igkv AZHG01023577.1 10764 SSGDIILTQTPGSQSVAPGQTVSIRCETSSSVYDNLHWYLQKPAEAPKLLIYVATTLQSGVPARFSGSGSGSDFTLTISGVQAEDSGVYYCQQFYS
Poecilia reticulata V48 trav AZHG01021392.1 15530 QTVHQVSSSVQQGSRFFSVKAGENVTVQCFHDPNSSSKFNWYKLTLGQKPQLISTVYKLGSNGAFYDEFKDNPRFMVNTKGNQKNLRITNLQPSDSAIYYC
Poecilia reticulata V47 trav AZHG01021392.1 21018 PQVSSSVQQDTRFVSVKAGESVTLQCFRDPDTPARAYWYKVTLRQKPQLISTVFKYDPEGTFQREFKNNPRFTLDTKGNLNNLRITNLQPSDSATYYC
Poecilia reticulata V45 trgv AZHG01018327.1 2298 QETHLTMSSSLNQETGFLLAHVGEKVTMRCTYEGNEPAWICWYMQTLGQKPKLMSSMFVYGTEITFYEEFKNSSHYVIGKEEHMHYLTIIDLKMSDSATYYC
Poecilia reticulata V44 trgv AZHG01018327.1 2298 QETHLTMSSSLNQETGFLLAHVGEKVTMRCTYEGNEPAWICWYMQTLGQKPKLMSSMFVYGTEITFYEEFKNSSHYVIGKEEHMHYLTIIDLKMSDSATYYC
Poecilia reticulata V43 trav AZHG01018326.1 12773 SGSDSQALVEQPKHATVPPGGSVTLNCTVQTGSCGEAHRVYWFRNSDGSPPGLVYGHGTKNEQCETNPYRQTDTCVYDLPVENLDASHAGTYYCAVASC
Poecilia reticulata V42 igkv AZHG01016238.1 38891 SDGNPSVTQTPAVKSAALGETVSLSCSASAGVDDDLSWYQQKPGQPPKLLFYKITSRQSDTPSHFSSSGSEPQFTLTISGVQADDVGDYYCMGVYLIND
Poecilia reticulata V41 igkv AZHG01016238.1 38891 SDGNPSVTQTPAVKSAALGETVSLSCSASAGVDDDLSWYQQKPGQPPKLLFYKITSRQSDTPSHFSSSGSEPQFTLTISGVQADDVGDYYCMGVYLIND
Poecilia reticulata V40 trbv AZHG01014557.1 107 FAGGSDVTQPAVLWKNKSDDATIDCSHKKGELYFQMYWFRQLPGKTMELVVFTTAGSSKHDFGSFSQEKFSATKAKAESGALTVKSLEPADEGLYFCAVSS
Poecilia reticulata V39 trbv AZHG01014553.1 179 APSAYEVLQTPRFAAPKPGGTITIHCSHSVSIFDCILWYKREKHGALRFLGYMNRNFPNPEGDVKDKMNFGGDGSKHATLNISTVSENDSAVYFCAAS
Poecilia reticulata V38 trbv AZHG01014551.1 1819 SSLSDKVQQSPPDIYKSSEKEAKIECFHNIDNYNRILWYKQTSRDMQLLGYRFAGSSTVEEGAKVEIGGGANKEETCTLTIKEHSESSSGVYFCAAS
Poecilia reticulata V37 trav AZHG01014550.1 1164 VAFGLEVHQSRSDLIVKRGEKVHIFCTHEKTDFWTMLWYRQPPADTALELIGHLYTSSIKMEDEDDQNVRIVGDLSGSTAKNSSLVINIVEQKHTAVYYCAARE
Poecilia reticulata V36 trav AZHG01014550.1 1805 VCLSVEVHQTPPAALRKPGQVFQMVCSHGKTDYTLMQWYQKSPGDKALKRIGHLNYGNKELEKPFEGHFKFTGDLSGEMAKNASMIITDLKPEHTAVYYCAASY
Poecilia reticulata V35 trbv AZHG01014548.1 1732 KNVQFQPTDPKIVNMEDKVDFHCHHDDSSLNVMLWYQQTDTGAIELIGYSYVGSEAVHEKDYESRFKITRKDTQTGGLNIDGAIASDSAVYFCAGS
Poecilia reticulata V34 trbv AZHG01014548.1 4077 VCECVLITQWPRGIISNLSAEMHCYQNDTDYEYLYWYRQLSGGQIQLIVYLLAGNPNFEPDFKSGFKAERSHTKQWSLTVSSVQQKDEAVYLCAA
Poecilia reticulata V33 trbv AZHG01014542.1 1542 LTNGIVVTQTPLLWVHQSQSTTMTCSHTDISSFQMYWYQQLPGQNMKLIVFTTTSPPFQYEEGFSEEKFPADRKDAMSGSLTVKQLQPEDSGVYFCSVS
Poecilia reticulata V32 trbv AZHG01014540.1 900 SSLSDQVHQTPFNIVAKRGGEARIRCSHDIQNYDVILWYKKLKNKQLQLLGYRYMDNTTPEPGTDVKLEMDGSGDKGENCTLTIKELNEKSSAVYFCAARYHSAE
Poecilia reticulata V95 trav AZHG01035322.1 32 QSLEADISAIRSEVFPSEGGKVTLSCNYSVKAENLQWYRQDPGSAPRFLLLITDTKDPTVVEAEPPNPRLTAGLNKERNRLDLLISSAAVTDSAVYYCAVQ
Poecilia reticulata V94 trav AZHG01035320.1 2053 VNCQQLTAGKIEEFSSEGSSAALTCSYTNKISAGDDFFWYRQNPGKPPEFIFYISGLNSSRSAESLKSSTRFSTYLRGEKHLDLLISSAAVTDSAVYYCALQ
Poecilia reticulata V93 trav AZHG01034368.1 1436 QTDGVQQPERDVIAAEGGNATLNCLYNTSASNHYLYWYRLEGGSSPTFILSRFKVGEGKTAEKRFSSSLDATARSVPLTIQDLRPSDSAVYYCALQPTVTG
Poecilia reticulata V92 trav AZHG01034367.1 2733 DSVKQTEGEVVAAAGETQILGCTYETISVTPTLFWYKLEENSFPQYMLKQQTSTIYKAPDFNSSRFDADLKKTIKTFNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia reticulata V91 trav AZHG01034364.1 1080 VNCQQLTAGKIEEFSSEGSSAALTCSYTNKISAGDDFFWYLQNPGKPPEFIFHISGFNSSRSAESLKSSTRFFTYLRGEKHLHLLISSAVVTDSAVYYCAVR
Poecilia reticulata V90 trdv AZHG01033247.1 47307 QNTLLRQERTFNSTEVGSNITLPCFYHPKNAVIIYWFKQTVGQKPNMFSSHYRLKNKGTFHDEFKDNPRFELAAGNGKNHLRISDLQPSDSATYYCVAIDS
Poecilia reticulata V88 ighv AZHG01030713.1 5908 VFSQTLTESQPVVKRLGESHTLTCTYAGISDSSAEISWIKQAEGKGLEWVAHITGPNGDGKYFSPSVQNRFTISRDNNKDQVYLQMSSLRTEDSAVYYCARE
Poecilia reticulata V87 ighv AZHG01030713.1 7369 AQGQSLTSSEAVISKAGQSVTLSCKVQGLSLAWLHWIRQEQLKVLEWIGRIDSGTGTIFAQHLQGQFSITKDTSKNTVSLTVKSLKPEDSAVYYCARE
Poecilia reticulata V86 ighv AZHG01030713.1 10249 VTCDQLNQPPSVSVQAGEGLTITCQVSYAISSYWTLWIRQPAGKGLEWISRDKNIKESLKNKFSVNIDSSNSRVTLHGQNMQPEDTAVYYCARE
Poecilia reticulata V85 trav AZHG01030712.1 6161 VWSQIKLEQSTSEVKRPGETVKMSCVISGYRMASNDISWIRQRPGRGLEWIGYMNTGNNDPTYASSFQSRFIMTENVPSSTQYLEISSLRAEDSAVYFCARE
Poecilia reticulata V84 ighv AZHG01030712.1 7521 VDGQTMTQSESVLKRPGESHKLTCTTSGLSFSSYWMSWIRQAPGKGLQWVATEARGTQYYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Poecilia reticulata V83 ighv AZHG01030712.1 8586 LNGQTLTESESVVKTPGESHTLTCTHSGFSGNPWIAWIRQVSGRGLEWISTISSGGSKYYSQSVRGRFTISRDDSRSQVYLQMNSLSAEDSAVYYCTRD
Poecilia reticulata V82 ighv AZHG01030712.1 14252 QSITESEPAIKKPGESHRLTCTTSGFDFEYSVWVWVRQASGKGPEWIALVHTASTPITYSDSVRGRFSISRDDSSSKVYLQMDSLKTEDSAVYYCARR
Poecilia reticulata V81 ighv AZHG01030710.1 1335 VDGQTLTQSESVLKRPGESHKLTCTTSRLSFSSWSWSWIRQAPGKGLEWVASDTGNQYYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Poecilia reticulata V80 trav AZHG01030707.1 3189 VKCEQLTQPPSVTLQPGQTLTISCQVSYSVRSYYTHWIRQPAGKGLEWIGAAADGSTTYYKESLRNKFSLSTDFSSNTVTLNGQNMQPGDSAVYHCARETQ
Poecilia reticulata V79 ighv AZHG01030707.1 4553 VKCQQLTQPASLTVQPGQTLSITCQVSYSLTSYHTNWIRQPAGKAPEWMGVIWHDGRNAYASNVQGRIEITRDTNKNTVYLRLSTMKPEESAVYYCARE
Poecilia reticulata V78 ighv AZHG01030707.1 5559 VKCEQLTQPASVSLQPGQRLTISCQVTYDLSYWTAWIRQAAGKGLEWIGVKGTGHAYYKDSLKNKFSISLDTYSKTVTLNGQNMQPGDSAVYYCARE
Poecilia reticulata V77 ighv AZHG01030706.1 2718 TECQTLTESESVVKRPAESHRLTCTYSGFSGTPWFAWVRQPSGKGLEWVSGISDTGGSTYYPQSLRGRVTISRDNSRSQVYLQMNSLSAEDSAVYYCA
Poecilia reticulata V76 ighv AZHG01030706.1 24336 VKCQQLTQPASLTVQSGQTLSISCQVSYSVTGSGTHWIRQPAGKALEWMGVIWNGGNDNYATNVQGRIEITRDTSKNILYLRLSTMKPDESAVYYCAKS
Poecilia reticulata V75 ighv AZHG01030705.1 113 SNSQSMESIPSTSVVKRPQEVLSLSCRGSGFDFSRYGMNWIRKPEGKTLEWMGAIWYDSSKTVYARSVEGRIEITRDNSISMTYLKLSNLKPEDSAVYYCAGE
Poecilia reticulata V74 trav AZHG01030705.1 12122 VLSIDLIQPDSKVVQPGQSLTIVCRPSGYSVTDNSYATGWIRQREGKPMEWIFHQWGGGSFYQNDALKNKFTYSRDTSAGTVTITGQNLQPEDAAVYYCVRRDTVTQ
Poecilia reticulata V73 trav AZHG01030705.1 15936 VYCIDLIQSDSKVVQPGQSLTITCQPSGYFLTDGSYATGWIRHRQGQTMEWIFHQWGASSGSFYQNDALKNKFSYRRDTSAGTVTITGQNLQPEDAAVYYCVRR
Poecilia reticulata V72 ighv AZHG01030705.1 19072 FRCEQLTQPASVTVQPGQSLTVSCQVSYSVSSYWTAWIRQPAGKALEWIGEAYRSSTNYKGSLKNKFSISTDSSSNTVTLNGQNIQPEDSAVYYCARD
Poecilia reticulata V71 ighv AZHG01030705.1 21316 VYCIDLIQPDSEVVQPGQSLTIICRPSGYSLTDNSYATGWIRHREGKPMEWIFHMWGGGSLTKNDALENKFSYSRDTSAGTVTITGQNLQPEDAAVYYCVR
Poecilia reticulata V70 ighv AZHG01030704.1 1642 VVGQTLTQSESVLKRPGENHKLTCTGSGYTFSRYSMDWVRQAQGKGLEWVAYISYNSELILYSQSVQGRFTISRDDNRQQVYLQMNSLKTEDSAVYYCA
Poecilia reticulata V96 trgv AZHG01035854.1 2481 LAAMATHLVQDDLTLTRRSGQSVSISCGGIDQCGSNYIYWYQKKETETFKPILRFDTSNSNIYKGYNHPQQDDFSAENIQNSCSLKINKVKLDHSASYYCGCWKSG
Poecilia reticulata V89 ighv AZHG01030713.1 4546 VFSQNLTESEPATKLPGESHTLTCTYAGIEDNDAAISWIRQAEGKGLEWVALISAPKGSGKYYSPSVQNRFTISRDNNKDQVYLQMSSLRTEDSAVYYCARE
Poecilia reticulata V69 ighv AZHG01030704.1 3387 ARGQSLTSSEPVVQRPGQSVTLSCKVQGLSLAWLHWISQKPGKGLEWIGRIDGGTGTIFSQSFQGQFSITKDTSQSTVSLTVKSLKPEDSAVYYCARE
Poecilia reticulata V46 trav AZHG01018330.1 17861 PPSVLTSSPLHLKSSFITAAPGGEVTLRCSYEGDESAWICWYKQTLGQNPKLISSFFVYSLENVFYGEFENNSRFTLIRKKQTTNLIISNLKMSDSATYYCAFAY
Poecilia reticulata V0 igkv AZHG01028852.1 2410 QYTLTQPAAVRADLGGSATINCRTSQNVYRNNCLAWYQQKVGQTIKLLIYYASTRESGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINRQWV