WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pseudopleuronectes yokohamae BBOV00000000.1 (BBOV01) 14 4 0 2 4 4 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pseudopleuronectes yokohamae V9 trav BBOV01287858.1 57 GISLGIQIDQSPSALFKRAGDDVQLVCTHDRSDFRVMLWYQQSPGEEALKIIARQLYDDSSIEEPFRKHFRVAGDPNGGTTNGSLSIIKLKALEHTATYFCAASK
Pseudopleuronectes yokohamae V8 trav BBOV01180975.1 276 HSLEDDVTSSSAEVFSASGRPVTLSCQYSVKAENLQWYRQDPGSAPNYLLLITDTQEPQVVRATPPNPRLTAELNQERNGVILQISSAAVTDSAVYYCALQ
Pseudopleuronectes yokohamae V7 igkv BBOV01141041.1 21 CSGQMTVTQPPVVTFTPGSTVTLTCKTNPGIYSDDLSWYQQKPGQTPKLLIYDISTLYSGTPSRFSGSGSNSGSSFTLTISGVQAEDVGDYYCVGQDGNYR
Pseudopleuronectes yokohamae V6 ighv BBOV01069077.1 177 VKCETLTQPASVTVQPGQPLTISCQVSYSISSYWTHWIRQPAGKGLEWIGMGRDGQSTYYKDSLKNKFSIELDTSSKTVTLKGQNMQPGDTAVYYCAR
Pseudopleuronectes yokohamae V5 ighv BBOV01068988.1 41 VCSQTLTESEPAVKRPGESHKLTCTYAGISDDSAFISWIRQAEGKGLEWVAHISAPSGSSKYYSASVKNRFTISRNNDMDQVYLHMSSLTTEDSAVYYCARE
Pseudopleuronectes yokohamae V4 ighv BBOV01068987.1 63 VCSQTLTESEPAVKRPGESHKLTCTYAGISDDSADISWIRQAEGKGLEWVAYISAPSGSSKYYSASVKNRFTISRNNDMDQVYLHMSSLTTEDSAVYYCARE
Pseudopleuronectes yokohamae V3 trbv BBOV01038138.1 440 VCLGLDVRQSPSDLVTNPGDNVQISCSHDKTDYRQMLWYQRSPGDTAMKLIGYLYYQDATMEASYEKEFEVTGDLKGSTAKNSSLLIKAVRKEHSAVYYCAARE
Pseudopleuronectes yokohamae V2 igkv BBOV01187102.1 155 CSGQMTVTQPPVVTFTPGSTVTLTCNTNPSIYSNYMSWYQQKPGQAPKLLIYYISTLHSGTPSRFSGSGSSSGSSFTLTISGVQAEDVGDYYCQSYHSGPV
Pseudopleuronectes yokohamae V1 trav BBOV01111932.1 275 VIQSAAVEQDTGVVSASVGDNVTLHCSYDSQVLMHFSWYRQTLGFRPELLSSVYKHDEPSKVFHWLEENPRFSVRREEGKNHLHISDVQLSDSASYFCGG
Pseudopleuronectes yokohamae V0 trav BBOV01075777.1 505 MGSMDSITPESTEEVVSEGRHINLTCKYDGSIYNIQWYRQHQRSRPEFLLYITKEGSIHPTLSDFSAHINQTEKRVKLQISSAAVTDSAVYYCALQ
Pseudopleuronectes yokohamae V13 ighv BBOV01487496.1 109 VKCETLTQPASVTVQPGQPLTISCQVSYSLGSYRTHWIRQPAGKGLEWIGCRGDGYTTYFKDSLKNKFSIELATSSKTVTLKGQNVQPGDTAVYYCAR
Pseudopleuronectes yokohamae V12 trbv BBOV01324415.1 683 AFDNKRIVQTPLSIIRRSGESVDSEIDCSHDTDNFENILWFKQEQHKAPEYLGHLNLNFPYTEAGVREKISLRGDGRKHSKLTVSNISLSDSGVYFCAAR
Pseudopleuronectes yokohamae V11 trbv BBOV01324415.1 1686 AYDTKDVVQKPPSIFKRTGESVDSEINCSHDIKDLDLILWYKQVQHNVQYLGYLNRKTPLLENDLPGQISFDGDAKKYSDLTVSNLSFSDSGVYFCAVR
Pseudopleuronectes yokohamae V10 trbv BBOV01289084.1 9 GISLGVQVHQSPSALIRKAGDAVQLVCTHGQTDYTVMLWYQQSPTDQALKLIGYVEYSQIYYEELYKEHFNIIGDLSGSKAKNGSLFIVDLRESEHSAVYYCAARY