WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Scartelaos histophorus JACN00000000.1 (JACN01) 17 2 0 2 6 4 0 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Scartelaos histophorus V16 igkv JACN01150171.1 517 CSGQATVTQPPVQTVTPGSTVTLTCKTNRDVHVSTYMFWYQQKPGQTPKNLINYATQRVSETPSRFSGSGSHSDFSMTITGAQAEDAAVYYCQSLHNAPWS
Scartelaos histophorus V15 trbv JACN01145912.1 364 QSKYAVNQTPKDIITAPVKDIEMNCSHSNSDFDMILWYRRTIGLTDLTLVAYARFTSLVVEKTFESLYKVSGSGSSRSSLQVLNVKTASDSAVYFCAAS
Scartelaos histophorus V14 trdv JACN01135011.1 1362 KSIYDQISQTPPDLIKFSNESNNNELKCSHTISGYDRTFWYKQEKNGAMTLLGYVYSDIPNTEDAVKDKISLNGDGRSDTSLSISILTVEDSGVYYCAAS
Scartelaos histophorus V13 trdv JACN01135011.1 1362 KSIYDQISQTPPDLIKFSNESNNNELKCSHTISGYDRTFWYKQEKNGAMTLLGYVYSDIPNTEDAVKDKISLNGDGRSDTSLSISILTVEDSGVYYCAAS
Scartelaos histophorus V12 trbv JACN01101946.1 1890 GQTDEVVKKSPYLVTAVGDNVIENCDHSVGLNTDWIYFFRQRPGQRNLVLVAQTSLISRRYVEESRRFSINRELDIEVIGLELWNVSREDEAVYFCAVSLLS
Scartelaos histophorus V11 trav JACN01101945.1 88 AANADDVTQMPTIWKNEGDKVTMDCSHKKGPTYYQMYWYQQRPGENMRQIVLTIPRTDPDFEPDFKNKGFNVEKLNAESGALIVENVQPGDSGVYFCAVS
Scartelaos histophorus V10 trav JACN01097697.1 830 VCFSSVIQEDILWESEEGDVTLNCSHTKGASYFQMYWYRQRPGENMRQIVFMTTTKPEFEPDFRNVRFEAHKPNIESGTLTVKKLQPGDSGVYFCAVS
Scartelaos histophorus V9 trav JACN01092151.1 4344 CKGEDTVTQTTGDTSDTQGETVTILCTFETSYNSVTLFWYKQDGRKGPRYMMQKTRSLSKWSKTIPSAEFSEDRFEVEAEGNSFPLKIQDVDVTDSAVYYCALQ
Scartelaos histophorus V8 trav JACN01087766.1 1155 QAEGSDVTQDGLIWAEEGKEATMTCTHTKGVGFIQIYWYKQLPGETMTLLVYTVHTKDDHNFQDKYLASQDNAESGTFTVKDVTAEDKAMYFCAVS
Scartelaos histophorus V7 igkv JACN01078242.1 478 CSGQVTVTQPPVQTVTPGSTVTLTCKTNTDVVKGSSYGWSVHWYQQKPGQSPKLFIEWAIRAMPGIPSRFSGSGSHSDFSLTITGAQAEDAAVYYCQSYHSGNV
Scartelaos histophorus V6 ighv JACN01065486.1 358 DSVELLQPGSVLLQPAHTLTISCQVSGYSLTDNSYATGWIRQREGKLEWIFHQWGTSGLRQNDALKNKFSLSRDTSAGTVTIQGQRLQPEDSAVYYCVRV
Scartelaos histophorus V5 trav JACN01028153.1 107 VKCETLTQPASVTVQPGHTLTIPCTVSYGLGYYTHWIRQPAGKSLEWIGYHCDGCTLILKDSLKNKFSINVDSSSKTVTLRGQNLQPGDSAVYYCAR
Scartelaos histophorus V4 ighv JACN01007572.1 173 ADGQALVQSEAAVTSPGGSHRLTCTYSGFSSDYGTAWIRQAAGKGLEWISYISDGSVTKLYSDSVRNRFTVSRDNSKKEVYLDMSGLRAEDTALYYCA
Scartelaos histophorus V3 trdv JACN01113462.1 996 LFITVIQSVRHIFTDPGSSIRIDCSLEGYAMENVYMYWYRQRDYAQIEYVCYESEKKRDNFECLLDGSKNNFSVVISDLATDDTGTYYCAA
Scartelaos histophorus V2 trbv JACN01096943.1 112 CCLGLKVHQSPSDLVKRPNEKVHIYCTHEKTDYRLMLWYQQPLGDTAMKLIGYLYFNTVTMEKQYETLFNISGDLSGTTAKNGSLLVQIEGPGQSGVYFCAASQ
Scartelaos histophorus V1 trbv JACN01093430.1 345 AAVKFQQSPSMIVNSSVSVTIECSHDDSSLSVMLWYQHHPDTQSMMLIGYYYGGDSYEKEFAKQFKIERPSVQKGSLTVLTTSPSHSAVYFCAASITVMKYR
Scartelaos histophorus V0 trav JACN01067799.1 1086 VKCETLTQPASVTVQPGHTLTIPCTVSYDVSSYYTHWIRQPAGKGLEWIGGHCDGCTGAEGSTKDSLKQKFTINLDTSTKTATLTGQNLQPGDSAVYYCARR