WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Scleropages formosus JARO00000000.2 (JARO02) 49 3 2 1 15 17 7 4
Scleropages formosus LGSE00000000.1 (LGSE01) 78 10 0 9 13 23 10 13
Scleropages formosus LGSG00000000.1 (LGSG01) 29 8 0 3 6 2 4 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Scleropages formosus V11 trbv JARO02013150.1 2456 LTFSKEVHQTPSTHLVHSGDSVQFSCSHKISSYRTILWYQRSEEDSALKLIGYIVVSSSSIEDSYKDRFGINGDGAREAFLNVTKAKSEDTGVYFCAAS
Scleropages formosus V10 trgv JARO02011579.1 8742 LTEINGIIQPSLLLEVQLGNNATLECSFPEDPQYMYWFKFLIGQTPDLVATSHKYATEASFSKNFNSSRFMVKLGTGINHLIITKIEWSDSAMYYCV
Scleropages formosus V9 trdv JARO02010439.1 10910 KTVTEDIVQSNVVVTAQSGDSVTLTCDSTSFSYSSALWFRHVAGQKTQFILATYQHSTDYAFYNGFNDTQRFTLQRKHNMFNLRISGTSTSDSGFYYCAFYGNKLD
Scleropages formosus V8 ighv JARO02003430.1 47031 AESQSGVKVSQIPHRMMLRAGQTADINCTQSTSNANMYWYQQKTGGPLRFLFYTVNSDEATEKGDGIPDRFSVSRKSVEKTSLKITRVQAADTAVYYCASS
Scleropages formosus V7 trav JARO02003430.1 44292 AESQSDVKVSQSPSMMILRAGKTADINCTQSASNSYMYWYQQKTNGPLQFLLYTANSDKATEKGDGIPDRFSVSRKSVAKTELKITQVQAADTAVYYCAS
Scleropages formosus V6 trbv JARO02003430.1 41907 CIHGATVNQNPSNLIMKAEGSASISCSHDDNSLHYFYWYQQHPGKGIELIANIITSQKPEFEQSFKNQSERYDIQKPNTLTGSFVIKSLQTSDSAVYFCAAT
Scleropages formosus V5 trav JARO02003430.1 39768 CVWSTNVNQTPSEHVTHKGGELKISCSHNNNNLQYMYWYRQRVGQTLELIAYIITNGKAEFEKDFKKEEARCDIKKPETLSGSFKMSALRAEDTAVYFCAAS
Scleropages formosus V4 trdv JARO02003430.1 37148 SVTQEPMKLVKKVGDSASISCSHGDNSLQYFYWYWQLPGKGIELISRILTGQEPEFEGHFKNQTKRYDIKKTDVLFGSFMIKTVQATDSALYFCAAT
Scleropages formosus V3 trav JARO02003430.1 34907 RVWSTNVNQTPSEHITREGGELKISCSHNNNNFDYMYWYRQRLGKSLELIAYILTSSPPQFEKDFKKEEARCDIKKPETLSGSFKMSALRAEDTAVYFCATS
Scleropages formosus V2 trbv JARO02001887.1 16518 NVFQKIPVLFAQTGAESVTLNCEHDDSSYYYMFWYKHNIGKMDLLAYSGSSGSATTEPPFSESKYKMIRLAVLNSSLEIKNLDPGDSAVYFCASSMAH
Scleropages formosus V1 trav JARO02001887.1 4290 LSSDPGVLQTPHDLIVNVDAQVTLGCSMPPGVSMSSYTMQWYRQGHSGGMVEFLKNEYSQADERDRFKVSIATSENRFTLQIHNLISNDSATYYCATSHGVTED
Scleropages formosus V0 trbv JARO02001887.1 2959 LSHAVSISQTPRDALQKAGSPFEITCEHDSNNDYMFWYRQDQNWSLTLIAYSYGVGFEENEKDFEAEYKVKRHSITLFTLEIERPEERDTAVYFCATSL
Scleropages formosus V47 trav JARO02024614.1 296 KSLTKEIFQPNLMLMAQPGQNVTLTCGSPNAEFQSIAWFKQNVGQKPQFIVGSFRYSTEYTFYNGFNETKRFVLQKKGNIFNLYISKINPLDSATYYCAFVY
Scleropages formosus V46 igkv JARO02016808.1 3483 AAGEILMTQTPETLSVQLGQTVSISCTASSSISSYLAWYLQKPGEVPKLLIHSSNTRQPGVPDRFTGSGSGTQYTLKIGGVQIEDAGMYYCQEGYSS
Scleropages formosus V45 trgv JARO02012079.1 121 CAMSQITYPKELLLYKPGRSARVICEADASVPLNNNPLHWYQQKETIERILYFTPGQSKPVRDDNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V44 trgv JARO02012079.1 5320 VMGQQGVFQDQISLTRSSGKTVAIRCKVSGLNADDYIDWYQKKEGEPFKRILYIKNDGSALTRDPAHPQNRDFSADKTGGLQYLRMSAVKPEHSGTYYCTYWK
Scleropages formosus V43 trdv JARO02012079.1 6720 EAEDLQQDKLTVTKGEGKTAIIGCTETTRCRDYLHWYQRKDGEELKRILYTSLSGSNPVKEPGYEDFLIYKAESGAGKLNLQIPKLQKKHSATYFCACWV
Scleropages formosus V42 trgv JARO02012079.1 10305 CAMSQITYPKELLLYKPGRSARVICEADASVPLNNNPLHWYQQKETIERILYFTPGQSKPVRDDNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V41 trbv JARO02012018.1 7 NDVIQMPSIVTIAKGTKAEMNCTQKKGTSYSDMFWFRQRPGENIELIVFTSVGLEADFGKFDKIKFEAVKKETNHGSFIVNNVEAGDSGVYFCAVREHS
Scleropages formosus V40 trbv JARO02012018.1 2487 HGEGTGVIQTPEIHFTSAKSNAEMNCSHNKDITYNQMYWYRQRPGENMELIVFTSAVANPDFGKFSESKYAAAKKKAESGSFIVKNLESSDSGVYFCAVS
Scleropages formosus V39 trbv JARO02012018.1 3327 PSISSKVQQSPPDLVKLPGQSAEFNCSHSISGYERVFWYKQTESGVFIDLGYLNLNFPNIEAGLEKKINLQGDGRNNSTLTVLSISADDMAVYFCAAS
Scleropages formosus V38 trav JARO02012018.1 5700 HSDGTDVSQLPTTLSLHKGQNAEMNCTHNKGLDFRDMYWYRQRPGENIELIVYTSVGLDPDYGKFDKNKFGAVKKEATSGFFTVKNLEAEDSGVYFCAVSQHS
Scleropages formosus V37 trgv JARO02010718.1 121 CAMSQITYPKELLLYKPGRSARVICEADASVPLNNNPLHWYQQKETIERILYFTPGQSKPVRDDNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V36 trgv JARO02007525.1 22389 VAAQRKVLQDKLSLTKSKGKTVSIPCSASGLQSNEFVHWYQKKEGEPFKRILYINYGSKSFTLDNSHPQKDDFSSDVFNLKISVVKEEHAATYYCACWD
Scleropages formosus V35 trgv JARO02007525.1 25960 VQGERRLVQDLDYVRKKPDKTVYIPCKPSGLSSGDYVHWYQKKEGQPFKRILYISYGSKSLARDENHPQKDDFSAREFDLHISETKLDHTATYYCACWD
Scleropages formosus V34 trbv JARO02007525.1 27417 AVEAADLQQDKPTITKGEGKTAVLSCTGTDGCRDYLHWYQRKEEEFRRILYIKLTDGTQAKEPGYDDFVTSKDEPGKDKFTLKISKLQTKHSATYFCACWV
Scleropages formosus V33 ighv JARO02006362.1 33549 LEAIVLLTQEKSMSVSLGANLKISCTVSSGSWTISWYQQKPGGAPQFLLADSNRASGLPSRFTYSESGSNEYLHINGVTAEDTAVYYCSCENCES
Scleropages formosus V32 iglv JARO02006362.1 39182 FEAVVVLTQEKSMSVSLGQTVRISCISSKNNWHMSWYQKKPGKTPQFLIFSSTRATGLPSRFTYSRSDNNIYLHINGVTAEDEAVYYCACADCGA
Scleropages formosus V31 trbv JARO02003430.1 58908 LIINAAVLRQKPFVTAKDGGESELTCKQDGSDDWMYWYRRSADRASLGLLFFSRSEFVDTEKRVADERLSARRDGKQFFYLRAKGLKADDTAVYFCASSI
Scleropages formosus V30 trbv JARO02000180.1 2904 NDVTQAPRIIWKSQGENATMSCSHNKGSLYSQMYWYRQRPGESIELVVFTAVGSDPDFGTFNKEKFDVVKTVAESGSFTMKDLEPGDNGVYFCAVS
Scleropages formosus V29 trbv JARO02000180.1 4111 LSLTNRVDQFPPDLVKLPGETAQFSCSHSIASYYNMLWYQQTGNGVFVFLGYLYNKNPNTEAGFENKITMQGDGSKNGTLTVLNISASDTAMYFCAAS
Scleropages formosus V28 trav JARO02000180.1 5615 SDVMQSPEILWTQPGKNAEMTCNHKKGVDYLQMYWYRQRPGENIELMVFTASGMKADLGKLSEDKYAANKNTVEDGFFTVKNVEAGDSGEYFCAVS
Scleropages formosus V27 trav JARO02024663.1 276 VQSADEVTQSPASKEVTEGQSVIIDCSYKTSNFYAMQWYKQPINGGSPKYINKATGSSKHGDYSGKYQPEVVTSEKRGTLRITPTADDSAIYYCAIEATTV
Scleropages formosus V26 trav JARO02021483.1 2071 VQSADEVTQSPASKEVTEGQSVIIDCSYKTSNFYAMQWYKQPINGGSPKYINKATGSSKHGDYSGKYQPEVVTSEKRGTLRITPTADDSAIYYCAIEATTV
Scleropages formosus V25 trav JARO02020460.1 2397 IRAEDTVTQSTEGVFVHEGGSVTLSCNYTTSDTTAELFWYIQRQSDSPKYMMRENTYGKGHTAPEFKRRFTAVASKTKTEVPLTIEDVQLCDSAVYYCALK
Scleropages formosus V24 trav JARO02020460.1 276 VQSADEVTQSPASKEVTEGQSVIIDCSYKTSNFYAMQWYKQPINGGSPKYINKATGSSKHGDYSGKYQPEVVTSEKRGTLRITPTADDSAIYYCAIEATTV
Scleropages formosus V23 ighv JARO02019307.1 1048 TEGSITLTQTAAEMMLPGNSLQLKCDVSGFDVNSYWMGWIRQATGKGLEWLVWYYNTASGNQQYSSKIKGRFTASKRSGSFYLKMNNLQVEDTAVYYCARD
Scleropages formosus V22 trdv JARO02018841.1 1587 VVSDVTVSQPRGVMSVRLGETVTLECYSKSDKAKRWMWLRQRPGQAPETIITTYYEQQDLYGDLKGSGRITLEKDTRTMNVTMSRVEKSDTAMYFCALSDY
Scleropages formosus V21 trav JARO02017573.1 3388 VSLSYKVSQTPSAQLLLPGDSVQLNCNHRISGYYIISWYQQKGADGALELIGHVLIHSSIEDPFTEHFNISGNGASWASLHISSVRAEDSAVFFCAVS
Scleropages formosus V20 trbv JARO02017573.1 2273 LSLSNKVTQTPAAQLLSLTSSVEFKCSHRITDYDMILWYQQSKGENALKLIGYIYYSDNRTEDSFKERFGITARGANEAILRINNVKTEDNAVYFCAAS
Scleropages formosus V18 trbv JARO02013150.1 11733 SCASILISQTPSLIKKPGKSAKFDCSHDQSSYLYLYWYQKVSEDKAMQLIGYLYNTQDNPEKEFSEHFKLSGDAKSQGHLQISNLKAADTGVYFCAVS
Scleropages formosus V17 trav JARO02013150.1 10769 PSLSSSVVQSPLDLVKQLGESAQFNCSHSIQNYDRMFWYTMSKSGDTLQCLGNLFYTDPTLEPGIDSRFVMKGDGRNNGTLTISNLNLSDSGTYFCAAS
Scleropages formosus V16 trav JARO02013150.1 9898 SLDCVIAQQKPPELLRHSGQKEAQLQCHNGDSSYPYMFWYQQQGGKGSIELIGYLHYENAVLEEKFQMRFNISGHSKTDASLIIANIKSEDTAIYFCAVSK
Scleropages formosus V15 trbv JARO02013150.1 8914 SSFCLTVRQSPAELIKHRGNAVNLTCSHDDSSYDKLYWYQQEHGKGLELLGFLSFKKPMEQNRGFTISGDAEKEGFLVLSAARPEDSAVYFCAVNK
Scleropages formosus V14 trbv JARO02013150.1 5607 LGEGSDITQYPAILWAPRGSDAQMNCSHNKGPTFNQMYWYRQFPGQHLQLLVFTFPGGESKFGSGLEDKFAAIKTVAESGSLTVKNAEGEDSGVYFCAVR
Scleropages formosus V13 trbv JARO02013150.1 4474 LSRGKTVHQTPLAVFHHAGDPVKLDCSHSISSYNMILWYQQLKEESALKLIGYIYHTNTDMEASYEKRFNISGAGSKAASLHVRGVRTVDTAVYFCAAS
Scleropages formosus V12 trbv JARO02013150.1 3205 FSFCTEVSQAPFLHSAQAGHSVKFSCSHKISSFNTMLWYQQTENYGPFKLIGNLVYKGNTTEDSYKERFGMTGDGSSQGFLHISAVRREDTAVYFCAAS
Scleropages formosus V48 trav JARO02026005.1 196 VQSADEVTQSPASKEVTEGQSVIIDCSYKTSNFYAMQWYKQPINGGSPKYINKATGSSKHGDYSGKYQPEVVTSEKRGTLRITPTADDSAIYYCAIEATTV
Scleropages formosus V19 iglv JARO02014616.1 6253 QRLVTQEPSVLNVNKGETAILDCKKPQDDSYNIYWYKQVPGGVPQFVLYFNRALSSPAYGTGFSSSHFTSRAQSNTHYQLVINSVEAEDSAVYYCKKWFGHPDEIV
Scleropages formosus V0 trav LGSE01001863.1 105253 SDVMQIPEILWTQPGKNAEMTCSHKKGVDYTQMYWYRQRPGENIELMVFTASGMKADLGKLSEDKYAANKNKVEDGFFTVKNVEAGDSGEYFCAVS
Scleropages formosus V37 ighv LGSE01002163.1 10917 VQSQVVLTQPESEMVSPGGSLTLKCACSGFSVGSTNMHWIRQAPGKGLEWIIYYYSDTDKSTAQSVQGRFQASKDSSNLYLHMTQLKTEDTAVYYCAKDTVSG
Scleropages formosus V36 ighv LGSE01002163.1 10917 VQSQVVLTQPESEMVSPGGSLTLKCACSGFSVGSTNMHWIRQAPGKGLEWIIYYYSDTDKSTAQSVQGRFQASKDSSNLYLHMTQLKTEDTAVYYCAKDTVSG
Scleropages formosus V35 ighv LGSE01002161.1 15623 TEGSITLTQTAAEMMLPGNSLQLKCDVSGFDVNSYWMGWIRQATGKGLEWLVWYYNTASGNQQYSSKIKGRFTASKRSGSFYLKMNNLQVEDTAVYYCARD
Scleropages formosus V34 trav LGSE01000183.1 263 YSAGNSITPLSDVVHVLEGNNVTLSCSYSGSADSFLWYRQYSRSKPEYLLLILESTGKVQEASPPNPHLSAKVHKKNNTVDLKFSSTALTDSAMYYCALR
Scleropages formosus V33 ighv LGSE01000086.1 11478 VHCQSLTSSEAVVKRPGDSVKLSCKVSGLSLSYLHWIRQPPERGLQWIGRIGSGTDATFSESLKGQFSITKDSSTLYLEVKSLKPEDTAVYYCAKD
Scleropages formosus V32 trdv LGSE01024194.1 2178 VVSDITVSQPRGVMSVRLGETVTLECYSKSDKAKRWMWLRQRPGQAPETIITTYYEQQDLYGDLKGSGRITLEKDTRTMNVTMSRVEKSDTAMYFCALSDY
Scleropages formosus V31 igkv LGSE01024189.1 5309 QVTMTQSPAVKSAQPGDTVTLSCKSSTPVYADFDDDEAMFWYQQRPGEAPELRIKYATQRDSGVPDRFSGSGSGSDFTLTISGVQAEDAGDYYCQG
Scleropages formosus V30 ighv LGSE01021382.1 861 VTGQTLTQSEAAVKKPGESHRLTCTASGFTFSSYDMHWIRQAPGKPLEWVAYIYDSSYIYYGSSFKGRFTISRDNSQKQLYLQMNNLKDEDTAVYYCA
Scleropages formosus V29 ighv LGSE01021321.1 2682 IHCQSPTSSGAVVKRPGDSVKLSCTVSGFSMSSYYIYWIRQPPGKGLQWIGFIDTGTGTTFSESLKGQFSITKDSSTLYLEVKSLKPEDTAVYYCAR
Scleropages formosus V28 ighv LGSE01019907.1 220 VHCQSLTSSEAVVKRPGDSVKLSCKVSGLSLSYLHWIRQPPERGLQWIGRIGSGTDATFSESLKGQFSITKDSSTNTLYLEVKSLKPEDTAVYYCAKD
Scleropages formosus V27 igkv LGSE01017027.1 509 SSGQITVTQSPPVKSARPGDTVTLKCNPSTSSGLGSDLYWYQQKDGTAPKLLIYKISSRESGIPERFSGSGSGTDFSLTISGVQAEDAATYYCFGHFGVPN
Scleropages formosus V26 igkv LGSE01017025.1 4729 SSGQKTVTQSPPVKSARPGDTVTLKCNPSTSSGLGDDVNWYQFKTGVPPKLLIHDTSDRFSGIPERFSGSGSGTDFSLTISGVQAEDAATYYCLAYYGAPD
Scleropages formosus V25 igkv LGSE01017025.1 2163 SIGQKTVTQSPPVKSARPGDTVTLKCNPSTSSGLGSDLYWYQQKDGTAPKLLIYGISSRESGIPERFSGSGSGTDFSLTISGVQAEDAATYYCLAYYSAPD
Scleropages formosus V24 trbv LGSE01016953.1 34714 CIHGATVNQNPSDLIMKAGGSASISCSHDDNTLHYFYWYQQHPGKSIELIANIITSQKPEFEQSFKNQSEQYDIQKPNTLTGSFVIKSLQTSDSAVYFCAAT
Scleropages formosus V23 trbv LGSE01016953.1 32420 CVWSTNVNQTPSEHVTHKGGELKISCSHNNNNLQYMYWYRQRVGQTLELIAYIITNGKAEFEKDFKKEEARCDIKKPETLSGSFKMSALRAEDTAVYFCAAS
Scleropages formosus V22 trav LGSE01016953.1 31407 LGCVTVSQIPQESLEPNGSEITLTCQHNDATYSYMYWYQQQRGQGLQLMFYSIVFNAPVFETGIQKERYAFERLSAQRGVLKINSAALSDTALYFCAAR
Scleropages formosus V21 trdv LGSE01016953.1 29805 SVTQEPMKLVKKVGDSASISCSHGDNSLQYFYWYWQLPGKGIELISRILTGQEPEFEGHFKNQTKRYDIKKTDVLFGSFMIKTVQATDSALYFCAAT
Scleropages formosus V20 trdv LGSE01009592.1 7895 KTVTEDIAQSNVVVTAQSGDSVTLTCDSTSFSYSSAVWFRHVAGQKTQFILATYQHSTDYAFYNGFNDTQRFTLQRKHNMFNLRISGTSTSDSGFYYCAFYGNKLD
Scleropages formosus V19 trdv LGSE01009592.1 742 KSLTKEIFQPNLMLMAQPGQNVTLTCNSPNAEFRSIAWFKQNVGQKPQFIVGSFRYSTEYTFYNGFNETKRFVLQKKGNIFNLYISKINPLDSATYYCAFVY
Scleropages formosus V18 igkv LGSE01004287.1 338 QITVTQSPAVKAVLPGQTVSMSCKTSTAVYHNYLAWYLQKPGEAPKRLIYYATSRVSGIPDRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Scleropages formosus V17 trav LGSE01002908.1 266 QHTVTQSTGDVIGYEGGSVTLSCTYKTTSSVPDLFWYIQRPHESPRYILRGDTNEGHSTEPEFKLRFKSTLRKVNSSVPLTIEDVQLCDSAVYYCALR
Scleropages formosus V16 trav LGSE01001865.1 6538 SSLSSSVVQSPLDLVKQLGESAQFNCSHSIQNYDRMFWYTKSKSGDTLQCLGNLFYTDPTLEPGIDSRFVMKGDGRNNGTLTISNLNLSDSGTYFCAAS
Scleropages formosus V15 trav LGSE01001865.1 5667 SLDCVIAQQKPPELLRHSGQKEAQLQCHNGDSSYPYMFWYQQQGGKGSIELIGYLHYENAVLEEKFQMRFNISGHSKTDASLIIANIKSEDTAIYFCAVSK
Scleropages formosus V14 trbv LGSE01001865.1 4684 SSFCLTVRQSPAELIKHRGNAVNLTCSHDDSSYDKLYWYQQEHGKGLELLGFLSFKKPMEQNRGFTISGDAEKEGFLVLSAARPEDSAVYFCAVNK
Scleropages formosus V13 trbv LGSE01001865.1 1403 LGDGSDITQYPAILWAPRGSDAQMNCSHNKGPTFNQMYWYRQFPGQHLQLLVFTFPGGESKFGSGLEDKFAAIKTVAESGSLTVKNAEGEDSGVYFCAVR
Scleropages formosus V12 trbv LGSE01001865.1 270 LSRGKTVHQTPLAVFHHAGDPVKLDCSHSISSYNMILWYQQLKEESALKLIGYIYHTNTDMEASYEKRFNISGAGSKAASLHVRGVRTVDTAVYFCAAS
Scleropages formosus V10 trbv LGSE01001864.1 21620 LLFCNEVNQTPSALLVNSGDSLHLICSHEINDYKNILWYQQSESGGALKLIGNVYYTSNTTEDSYKDHFSTNGDGGHEAFLHITKVKSEDTAVYFCAAS
Scleropages formosus V9 trbv LGSE01001864.1 19262 LSLSKNVDQSPSAEVRRSNESVQFKCQHKITGYYMTLWYQQKENTGLNLIGYINYRNPDIEELYKERFSISGNGESEAFLDITRLRAEDTAVYFCAASQHSVSYL
Scleropages formosus V8 trbv LGSE01001864.1 18351 LSSCKEVNQTPALFAYSGNSVQLSCSHKIPNYETILWYQQSENNNALKLIGNLVYKGNTTEDSYKERFGMTGDGSSQGFLHISAVRREDTAVYFCAAS
Scleropages formosus V7 trbv LGSE01001864.1 17408 LSLCKEVTQTPPALFVRSGDSLQFSCSHKINSYDTILWYQQSESGGALKLIGYVYYTANTTEDSYKDHFSVTGNGESEVLLHITKVKSEDTAVYFCAAS
Scleropages formosus V6 trbv LGSE01001864.1 13224 LSLSNKVTQTPAAQLLSLTSSVEFKCSHRITDYDMILWYQQSKGENALKLIGYIYYSDNRTEDSFKERFGITARGANEAILRINNVKTEDNAVYFCAAS
Scleropages formosus V5 trbv LGSE01001864.1 10116 NDVIQMPSIVTIAKGTKAEMNCTQKKGTSYRDMFWFRQRPGENIELIVFTSVGLEADFGKFDKIKFEAVKKEANHGSFTVNNVEAGDSGVYFCAVREHS
Scleropages formosus V4 trbv LGSE01001864.1 6805 PSISSKVQQSPPDLVKLPGQSAEFNCSHSISGYNRVFWYKQTESGVFIDLGYLNLNFPNIEAGLEKKINLQGDGRNNSTLTVLSISADDMAVYFCAAS
Scleropages formosus V3 trav LGSE01001864.1 4416 HSDGTDVSQLPTTLSLHKGQNAEMNCTHNKGLAFSDMYWYRQRPGENIELIVYTSVGLDPDYGKFDKNKFGAIKKEATSGFFTVKNLEAEDSGVYFCAVSQHS
Scleropages formosus V2 trbv LGSE01001864.1 736 PTISTSVHQSPPALVKLPGESVQLSCSHSISTYDSMYWYQQTNNGVLLCLGYLNNKVPYPEAGFEKKFSMQGNARSNGTLTIMNILLSDTAIYFCAVSLHSAS
Scleropages formosus V1 trbv LGSE01001863.1 106743 LSLTNRVDQFPPDLVKLPGETAQFSCSHSIASYNNMLWYQQTGNGVFVFLGYLYNKNPNTEAGFENKITMQGDGSKNGTLTVLNISASDTAMYFCAAS
Scleropages formosus V75 trdv LGSE01024196.1 13513 SNSRTVVQQVVSDPVRPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V74 trdv LGSE01024196.1 55256 ITPKSRTVVQQVVSDPVRPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPRRNLSRSDAGIYYCAV
Scleropages formosus V73 trdv LGSE01024196.1 55256 ITPKSRTVVQQVVSDPVRPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPRRNLSRSDAGIYYCAV
Scleropages formosus V72 trgv LGSE01024196.1 68707 TETTNRYFTENLVLDAVNPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V71 trdv LGSE01024196.1 110210 ITPKSRTVVQQVVSDPVRPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECERSPEAGSHTHSCIYSLPKRNLSPSDAGIYYCAV
Scleropages formosus V70 igkv LGSE01022633.1 450 QITVTQTPAVKAVLQGDTVTVNCKTSSPVYNAGTSYPGMAWYLQKLGEAPKLLIYAGTYRQSGIPDRFRGSGSGSDFTLTISGVQAEDAGDYYCQS
Scleropages formosus V69 trbv LGSE01020627.1 20209 LCEGVNVIQKTPALFTGTGRASETLHCEHDDESYYRMYWYKQTTGAMDLLAYSPVEGSVTTEPPFNESKYEMSRPEVLKSSLEIKNLDPGDSAVYFCASSMAQ
Scleropages formosus V68 trbv LGSE01020627.1 21551 NVFQKIPVLFAQTGAESVTLNCEHDDSSYYYMFWYKHNIGKMDLLAYSGSSGSATTEPPFSESKYKMSRPQMLNSSLEIKNLDPGDSAVYFCASSMAH
Scleropages formosus V67 trbv LGSE01020627.1 23156 RTAGVTVIQEMRITFTKISTPSKVLHCEQDDSSYLYMYWYKQTTGAMDLLAYSLGKGSVTTEPPFNESKYEMGRPEVLKSSLEIKNLDPGDSAVYFCASSM
Scleropages formosus V66 trbv LGSE01020627.1 24689 LTDGVKIIQKNPIFFIYKGTSSTTLHCDHDDNTHLTMLWYKQTTGAMDLLAYSLGKDSVTTEPPFNESKYEMSRPAVLKSSLEIKNLDPGDSAVYFCASSMAQ
Scleropages formosus V65 trav LGSE01020627.1 26986 LTDGVNIVQNISRLYTTTGSLSVLLHCEHDDGSYTDIFWYKQSFRTMDLLAYSRAQRSANTEAPFSESKYTMSRPEVKKSSLEIKNLEPGDSAVYFCASRKAQ
Scleropages formosus V64 trbv LGSE01020627.1 28990 LTAGVTVNQNKPVIITEAGTLSEVLHCEHDDNNHFYMYWYKQNNQRMDLLAYSTAVNSANTEPPFNGSKYEMSRPVVLKSSLEIKNLDPGDSAVYFCASSMAQ
Scleropages formosus V63 trbv LGSE01020627.1 31176 NVVQDLTDLFIKSGSSSVTLRCEHDKNDYFNMYWYKQMAGAMDLLTYSTASESATTEPPFSESKYKMNRPVVLKSSLEIKNLDPGDSAVYFCASSMAH
Scleropages formosus V62 trav LGSE01020627.1 33744 LSSDPGVLQTPHDLIVNVDAQVTLGCSMPPGVSMSSYTMQWYRQGHSGGVVEFLKNEYSQADERDRFKVSIATSENRFTLQIHNLISNDSATYYCAT
Scleropages formosus V61 trbv LGSE01020627.1 35071 LSHAVSISQTPRDALQKAGSPFEITCEHDSNHDYMFWYRQDQNWSLTLIAYSYGVGFEENEKDFEAGYKVKRHSITLFTLEIERPEERDTAVYFCATSL
Scleropages formosus V60 trav LGSE01020627.1 37550 QSVDYKVQQSPPGIVKSLTQSAELTCSHSISNCYTILWYQQSGGMGLMKLIGYIYYAQPEKEKNFDRFNMTGDGSSKGSLIITDLRSEDSAVYYCAAS
Scleropages formosus V59 trav LGSE01020627.1 40036 QSVDYNVQQSPPGIVKSLTQSAELTCSHSIPNYNTILWYQQSGGMGALKLIGYIYYAQPEKEKNFDRFNMAGDGSSKGSLIITDLRSGDSAVYYCAAS
Scleropages formosus V58 trav LGSE01020627.1 46569 QSVDYNVQQSPPGIVKSLTQSAELTCSHSISSYDTILWYQQSGGMGPLKLIGYVFSNSEPVKEKNFDRFNMAGDGSSKGSLLITDLRSEDSAVYYCAAS
Scleropages formosus V57 ighv LGSE01019421.1 649 VTGQTLTQSEAAVKKPGESHRLTCTASGFTFSSYYMHWIRQPPGKPLEWIAYISSGSGSSTNYGSSFKGRFTISRDNSQNQLYLQMNNLKDEDTAVYYCMR
Scleropages formosus V56 trbv LGSE01016954.1 9779 SVGATLINQARSVMAKIGVEVQLKCEQDGNDQQMLWYKQQQYPGLELMFFSSMENTPVEKIVTEDRFEASRPDRKHFPLRITNVATKDTSVYFCASS
Scleropages formosus V55 igkv LGSE01015533.1 23138 SSGQKTVTQSPPVKSARPGDTVTLKCNPSTSSGLGSDLYWYQQKDGTAPKLLIYRVSSRESGIPERFSGSGSGTDFSLTISGVQAEDAATYYCFANFGRPD
Scleropages formosus V54 igkv LGSE01015533.1 24876 LSGLGSNGQITVTQGPPLKSTCPGDTVTLSCKTSTSSGLGSHLYWYQQKDGEGKLLIYGINNRFSGTPERFSSSGSGTDFSVTISGVQAEDGATYYCLALYGTPD
Scleropages formosus V53 trdv LGSE01010973.1 816 SKKQQSKSKTVVQQPVSDPVHPGDSVTLQCTVDSETCAREHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHSCVYSLPKRNLSPSDAGIYYCAV
Scleropages formosus V52 ighv LGSE01010865.1 1281 VTGQTLTQSEAAVKKPGESHRLTCTAPNIDFGTSDMSWIRQPPGKSLQWIGEISSLSTNYGSSFKGRFTISRDKSQKQVYLQMNNLKDEDTAVYYCAV
Scleropages formosus V51 trdv LGSE01009589.1 7955 RKSTSRTVVQQPVSDPVRPGDSVTLQCKVDRETCAGEHSVYWFRHGSGESLPGLIYTHGNSSDECEKSPEAGSPTHGCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V49 trgv LGSE01009587.1 4387 SKKQQSNSRTVVQQPVSDPVHPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V48 trdv LGSE01009586.1 13034 SNKQQPNSMTVVQQPVSDPVHPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHSCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V47 trgv LGSE01008736.1 2788 CALSQITHPKELLLYKPGRSARVICEADASVPLNNNHLHWYQQKKTFQRILYFTPGKNSPERDGNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V46 trdv LGSE01008736.1 9445 KAEAEDLQQDKLTVTKGEGKTAIMGCTETTRCRDYLHWYQRKDGEELKRILYTSLSGSNPVKEPGYEDFLIYKAESGAGKLNLQIPKLQKKHSATYFCACWV
Scleropages formosus V45 trgv LGSE01008736.1 13280 CAMSQITYPKELLLYKPGRSARVTCEVDASAPLNNNPLHWYQQKETIERILYFTPGQSKPVRDDNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V44 trgv LGSE01008735.1 2627 VAAQSKVSQDQISITKSKDKSIAISCETSSLGSSTYIHWYQKKEGEPFKRISYIKNDGTASTRDPAHPQNRDFNAYKNGDRQYLKISAVKPEHSGTYYCAYWK
Scleropages formosus V43 trgv LGSE01008735.1 3666 AVSQTLIQETSVTISQGSLASIPCRASGLTQYDYIHWYQQKEGRPLKRILYMKKDDSSAVLDTSHPQFADFAMNKKENNYNLRVSAVNTTHSATYYCACWN
Scleropages formosus V42 trgv LGSE01008735.1 6460 GAVVLIQDITLTKSEKKTAFISCEVRDLSTGYVHWYQKKEDVALRRILYMDTGGKVIKDVGFQDFNGDKRGSNYRLHIPAVKSHHSATYYCAAWE
Scleropages formosus V41 trgv LGSE01008734.1 14165 VAAQRKVLQDKLSLTKSKGKTVSIPCSASGLQSNEFVHWYQKKEGEPFKRILYINYGSKSFTLDNSHPQKDDFSSDVFNLKISVVKEEHAATYYCACWD
Scleropages formosus V40 trgv LGSE01008734.1 17853 VQGERRLVQDLDYVRKKPDKTVYIPCKPSGLSSGDYVHWYQKKEGQPFKRILYISYGSKSLARDENHPQKDDFSAREFDLHISETKLDHTATYYCACWD
Scleropages formosus V39 trgv LGSE01003802.1 448 SENQRSSSKTVVQQPVSVPVRPGDSVTLQCTVDSETCAGEHSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHGCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V77 igkv LGSE01025460.1 34207 HTDCLSRENTCKTSSVVENYCFSDADGDKQCLYWYLQKPGEAPKLLIGGTSYRESGIPDRFSSSGSGTDFTLSISGVQTEDAGHYYCQS
Scleropages formosus V76 trav LGSE01024197.1 6675 TALAHVVQPNVLMKVRLGDTVTFTCISKSSELFYVSWYKQPFGQKPRLMVQAYSRSPDSLFQEEFKNVARFSLQHSESSSNLTISKTELSDSAVYYCASMFLNE
Scleropages formosus V50 trdv LGSE01009589.1 8573 KTVTEDIAQSNVVVTAQSGDSVTLTCDSTSFSYSSAVWFRHVAGQKTQFILATYQHSTDYAFYNGFNDTQRFTLQRKHNMFNLRISGTSTSDSGFYYCAFYGNKLD
Scleropages formosus V38 ighv LGSE01003182.1 1009 IHCDDIRLDQSPPQVKRPGESVKLSCVISGFQMTNYFMHWIRQKAGGGLEWIGRVNSGSTDDPDYAASLKGQFTLTEDVSKSTQYLEAKSLKAEDTAVYYCARE
Scleropages formosus V11 trbv LGSE01001864.1 22487 LTFSKEVHQTPSTHLVHSGDSVQFSCSHKISSYKTILWYQRSEEDSALKLIGYIVVSSSSIEDSYKDRFGINGDGAREAFLNVTKAKSEDTGVYFCAAS
Scleropages formosus V3 igkv LGSG01018987.1 61488 TAVLPGQTVSMSCRTSTAVRNDCYYAGSGGKQCLHWYLQKPGEAPKLLIGGASYRESGIPDRFSGSGSGSDFTLTISGVQAEDAGHYYCLN
Scleropages formosus V2 igkv LGSG01015530.1 3096 SEGQITVTQTPAVKAVLQGDTVTVNCKTSSPVNGAGSSIPRMAWYLQKPGEPPKLVIYDATKRYHGIPDRFSGSGSSADFTLTIGGVQAEDAGDYYCQS
Scleropages formosus V1 trdv LGSG01009168.1 2488 KTVTEDIAQSNVVVTAQSGDSVTLTCDSTSFSYSSAVWFRHVAGQKTQFILATYQHSTDYAFYNGFNDTQRFTLQRKHNMFNLRISGTSTSDSGFYYCAFYGNKLD
Scleropages formosus V0 ighv LGSG01000375.1 11457 VAGQTLTQSEAAVKKPGESHRLTCTASGFTFSSSWMSWIRQPPGKPLEWTCEIKDDSSSIDYGSSFKGRFTISRDNNKNQLYLQMNNLKDEDTAVYYCAR
Scleropages formosus V27 trav LGSG01055498.1 23773 LGCVTVSQIPQESLEPNGSEITLTCQHNDATYSYMYWYQQQRGQGLQLMFYSIVFNAPVFETGIQKERYAFERLSAQRGVLKINSAALSDTALYFCAAR
Scleropages formosus V26 trdv LGSG01055498.1 22166 SVTQEPMKLVKKVGDSASISCSHGDNSLQYFYWYWQLPGKGIEQISRILTGQEPEFEGHFKNQTKRYDIKKTDVLFGSFMIKTVQATDSALYFCAAT
Scleropages formosus V25 trdv LGSG01053786.1 8292 KTVTEDIAQSNVVVTAQSGDSVTLTCDSTSFSYSSAVWFRHVAGQKTQFILATYQHSTDYAFYNGFNDTQRFTLQRKHNMFNLRISGTSTSDSGFYYCAFYGNKLD
Scleropages formosus V24 trdv LGSG01053786.1 1728 RKSTSRTVVQQPVSDPVHPGDSVTLQCAVVSETCAGEQSVYWFRHGSGESLPGLIYTHGNRSDECEKSPEAGSPTHSCVYSLPKRNLSRSDAGIYYCAV
Scleropages formosus V23 trav LGSG01053786.1 1058 KSFTKEIFQPNLMLMAQPGQNVTLTCSSPNAEFRSIAWFKQNVGQKPQFIVGSFRYSTEYTFYNGFNETKRFVLQKKGNIFNLYISKINPLDSATYYCAFVY
Scleropages formosus V22 trgv LGSG01048170.1 1569 VAAQRKVLQDKLSLTKSKGKTVSIPCSASGLQSNEFVHWYQKKEGQPFKRILYINYGSKSFTLDNSHPQKDDFSSDVFNLKISVVKEEHAATYYCACWD
Scleropages formosus V21 trav LGSG01048169.1 1363 AVEAADLQQDKPTITKGEGKTAVLSCTGTDGCRDYLHWYQRKEEEFRRILYIKLTDGTQAKEPGYDDFVTSKDEPGKDKFTLKISKLQTKHSATYFCACWVYHSDVDQ
Scleropages formosus V20 trgv LGSG01048168.1 12796 VAAQSKVSQDQISITKSKDKSIAISCETSSLGSSTYIHWYQKKEGEPFKRISYIKNDGTASTRDPAHPQNRDFNAYKNGDRQYLKISAVKPEHSGTYYCAYWK
Scleropages formosus V19 trgv LGSG01048167.1 6935 CALSQITHPKELLLYKPGRSARVICEADASVPLNSNPLHWYQQKETIERILYFTPGQSKPVRDDNFPPRFQASKRDQRSTLTISNAVPDDSGYYYCAYWQ
Scleropages formosus V18 trgv LGSG01048167.1 1738 VMGQQGVFQDQISLTRSSGKTVAIRCKVSGLNAGDYIHWYQKKEGEPFKRILYIKSDGSALTRDPAHPQNRDFSADETGGLQYLRMSAVKPEHSGTYYCAYWK
Scleropages formosus V16 trav LGSG01045957.1 1173 VSLSYKVSQTPSAQLLLPGDSVQLNCNHRISGYYIISWYQQKGADGALELIGHVLIHSSIEDPFTEHFNISGNGASWASLHISSVRAEDSAVFFCAVS
Scleropages formosus V15 trbv LGSG01045957.1 58 LSLSNKVTQTPAAQLLSLTSSVEFKCSHRITDYDMILWYQQSKGENALKLIGYIYYSDNRTEDSFKERFGITARGANEAILRINNVKTEDNAVYFCAAS
Scleropages formosus V14 ighv LGSG01042078.1 4536 IQCDNIRLDQSHPQVKRSGESGKLSCVISGFDMTNYYMHWIRQKAGGGLEWIGVVNSGSTDDPDYAASLKGQFTLTEDVSKSTQYLEAKSLKAEDTAVYYCARD
Scleropages formosus V13 trav LGSG01038307.1 507 IRAEDAVAQSTGDVIGYEGGSVTLNCSYTTSDINAYLFWYLQRPNQYPQYVLKRFALGGGENAVEFNRRFNASLDKATKTVPLTIEDVQLCDSAVYYCALR
Scleropages formosus V12 trav LGSG01030904.1 33282 TALAHVVQPNVLMKVRLGDTVTLRCISKSSELFYVSWYKQPFGQKPRLMVQAYSRSPDSLFQEEFKNVARFSLQHSESSSNLTISKTELSDSAVYYCASVFLNE
Scleropages formosus V11 trdv LGSG01030902.1 1532 VVSDITVSQPRGVMSVRLGETVTLECYSKSDKAKRWMWLRQRPGQAPETIITTYYEQQDLYGDLKGSGRITLEKDTRTMNVTMSRVEKSDTAMYFCALSDY
Scleropages formosus V10 igkv LGSG01030886.1 39004 SRAQVTVTQSPAVKSAQPGDTVTLSCKSSTPVYVDSDDDEAMFWYQQRPGEAPQLRIKYATERESGVPDRFSGSGSGSDFTLTISGVQAEDAGDYYCQG
Scleropages formosus V9 ighv LGSG01027247.1 18642 VTGQTLTQSEAAVKKPGESHRLTCTAPNIDFGTSDMSWIRQPPGKSLQWIGEISSLSTNYGSSFQGRFTISRDKSQKQVYLQMNNLKDEDTAVYYCAV
Scleropages formosus V8 ighv LGSG01027233.1 247 LTESGGQVVSPGGKLTLTCTGSGFTLKDSLMSWVRQAPQKGLEWISTITPQLTGEAFAAVSEMKTYSESVKGRFSISRDNNRGTVTLEMNDLKAEDTAVYYCARD
Scleropages formosus V7 ighv LGSG01027229.1 11864 VTGQTPTQSEAAVKKPGESHRLTCTFPDSLSGYAMSWIRQPPGKPLEWIGYISYGGSSTNYGSSFKGRFTISRDNNKNQVYLQMNNLKDEDTAVYYCAR
Scleropages formosus V6 ighv LGSG01027229.1 10180 AQGDVVLTESGGQVVSPGGKLTLTCTGSVFTFKDYYMSWVRQAPQNGLELISYISDLGNTKLYSESVKGRFSISRDNNRGTVTLEMNDLKAEDTAVYYCA
Scleropages formosus V5 ighv LGSG01019188.1 635 LEAIVLLTQEKSMSVSLGANVKISCTVSSGSWTISWYQQKPGGAPQFLLADSNRASGLPSRFTYSESGSNEYLHINGVTAEDTAVYYCSCENCES
Scleropages formosus V4 ighv LGSG01019187.1 6529 LEALVLTQEESMSVSLGENVKMSCTVSSGSWTISWYQQKPGGAPQFLLADSTRASGLPSRFTYSKSGNNKYLHINGVTAEDTAVYYCGCAGCGS
Scleropages formosus V28 trbv LGSG01055499.1 1451 CIHGATVNQNPSDLIMKAEGSASISCSHDDNSLHYFYWYQQHPGKGIELIANIITSQKPEFEQSFKNQSERYDIQKPNTLTGSFVIKSLQTSDSAVYFCAAT
Scleropages formosus V17 trdv LGSG01048167.1 341 KAEAEDLQQDKLTVTKGEGKTAIMGCTETTRCRDYLHWYQRKDGEELKRILYTSLSGSNPVKEPGYEDFLIYKAESGAGKLNLQIPKLQKKHSATYFCACWV