WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Balaenoptera acutorostrata scammoni ATDI00000000.1 (ATDI01) 64 5 10 7 21 14 4 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Balaenoptera acutorostrata scammoni V84 trbv ATDI01035784.1 18365 VRAQTIRQWPLIRVQPAGSPLSLECTVKGASSPKLYWYRQAAGGTLQLLFYSVRVGQIDSEEPQNFEASRPQDDLFILSSKKLLLSDSGFYLCAWS
Balaenoptera acutorostrata scammoni V121 trgv ATDI01052808.1 1953 HLEQPQLSSTKKLSKTARLECVVSGVTISKMSVYWYQERPGQAMQHLLHILSNNTVKRESDVTLGKFEADKIPETSTSTLTIHNVREQDAAIYYCALWE
Balaenoptera acutorostrata scammoni V122 trgv ATDI01052810.1 511 GLGQLKWEQPEISVTGARDKSALISCKVSSEDFSQEHIHWYRHKPDQSIEHLAYVVTGPALNHLGGKKNKIEARKDIPTSTSTLKISFLEKEDEATYYCASWFK
Balaenoptera acutorostrata scammoni V123 trgv ATDI01052810.1 4495 TSGDIQIIQRITSITKKKGNTASLECHIKTDMLKKSVYIHWYRQKPEQPLNRILYISSNENVVHEQGIGEERYEARKWPSNSLLSLRIHGATEEDAALYYCACWD
Balaenoptera acutorostrata scammoni V124 trgv ATDI01052814.1 2987 TQVSSNLKRDKLSVTSKIGETASLTCELTQDASYIHWYKHQKGTAPRHLLYYDVYYSKTKFDSGINEAKYSVYKVTGRSYTFAILTVEDSDSGMYYCAVWE
Balaenoptera acutorostrata scammoni V195 ighv ATDI01094208.1 1886 LVKPSQTLSLTCAVSGGSVTSSYYWKWICPRPGKGLEWMEYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTTEDTPVYYCARDSERKSV
Balaenoptera acutorostrata scammoni V196 ighv ATDI01094211.1 1704 VLSQVQLQQRGPGLVKPSQTLTLTCAVSGFSITTSSYYWSWIRQPPGKGLEWIGYIGYDGSTYYSPSLRSRISISRDTSKNQFSPQLSSVTTEDTAVYYCAR
Balaenoptera acutorostrata scammoni V197 ighv ATDI01094214.1 11821 VLTQGQLQESGPSLVTPSQTLSLTCTVSGFSLTSSGVSWVRQPPGKGLEMVGVMDYSGITVYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAK
Balaenoptera acutorostrata scammoni V198 ighv ATDI01094222.1 6130 VLTQGQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQAPGKGLEYVGIISSGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAK
Balaenoptera acutorostrata scammoni V205 igkv ATDI01097346.1 10589 SSGDIVLTQTPLSLSVIPGDPASISCRSSQSLLHSDGETYLSWYLQNPGWSPQLLIYGASNRASGVPDRFTGNGSGTDFTLKISTVEAEDAAIYYCQQIIQRP
Balaenoptera acutorostrata scammoni V206 igkv ATDI01097347.1 4317 SNGDIVLTQTPLSLSVIPGDPASISCRSSQSLLDSDGDTYLSWYLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISKVEAEDVGVYYCQQAMEDP
Balaenoptera acutorostrata scammoni V207 igkv ATDI01097349.1 1188 SSGDIVMTQTPLSLSVVPGETASISCKSSQSLVHSDGNTYLNWFQHKPGQSPQRLIYQVSKRDSDVSDRFSGSGSGTDFTLKISRVEAEDAGVYYCCQG
Balaenoptera acutorostrata scammoni V208 igkv ATDI01097352.1 9725 CWGQIALTQSPETLAASQGSFVSITCKSSMEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFQGSGSGFDFSLAIHGVQAEDVGVYYCQ
Balaenoptera acutorostrata scammoni V250 ighv ATDI01117727.1 1883 LVKPSQTLSLTCAVSGGSVTSSYYWKWICPRPGKGLEWMEYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTTEDTAVYYCARDSERKSV
Balaenoptera acutorostrata scammoni V381 trav ATDI01182734.1 15452 TLSLAKTIQPIFIDSYEGQEVNISCNHTNIATEDYIFWYRQFPNQGPQFVIQGYKTNIANEVASLFIPTERKSSTLSLPCAALKDAAVYYCVVS
Balaenoptera acutorostrata scammoni V382 trav ATDI01182734.1 22248 GTGAQLVTQPDGRITVSEGARLELRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFKAEFRRSETSFHLEKQSALWSDSAKYFCALG
Balaenoptera acutorostrata scammoni V383 trav ATDI01182737.1 8328 PSIAQKVTQNQPVILVQEKEVVTLDCIYDTSDFSYSLFWYKQPSSGAMILLIRQDTYNQQNATEGRYSLNFQKANKSIKLAISASQLEDSAVYFCALSE
Balaenoptera acutorostrata scammoni V384 trav ATDI01182737.1 15771 QTREDSVTQMDGQMTLPEGAALTINCTYSATGYPITFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHRESKSFHLEKASVQDSDSAVYYCALS
Balaenoptera acutorostrata scammoni V385 trav ATDI01182737.1 25913 VSGKNQVEQNPPSLMVLEGQNCTFQCNYTVSPFGNLRWYKQDTGRGLVSLIIMSHSDSKKLNGRYTVTLDASAKHSSLHITAAQLSDPAFYLCVVG
Balaenoptera acutorostrata scammoni V386 trav ATDI01182737.1 36269 MRSQQKGVEQSPASLHVPEGAVASLNCTYTDSTFDYFSWYRQYPSKGPELLLYGSLNKDKEEGRYTAEVNKAKQYVSLLIRDSQPSDSATYLCAV
Balaenoptera acutorostrata scammoni V387 trav ATDI01182738.1 2861 MRSQQKGVEQSPASLHVPEGAVASLNCTYTDSNSQYFSWYRQYPSKGPVLLLDGYMNNDKEEGRYTAQVNKAKQYVSLLMRDSQPSDSATYLCAV
Balaenoptera acutorostrata scammoni V388 trav ATDI01182738.1 8398 GTGAQLVTQPDDLITVSEGARLELRCNYSSSLSTYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRRSETSFHLRKPSAHWSDSAEYFCALS
Balaenoptera acutorostrata scammoni V389 trav ATDI01182738.1 17883 GTRAQTVTQPEDHISIFEGSPVQVKCNYSYSGSLELFWYVQYPKQPLQLLLKHTSRESIRGFTADLNKGEASFHLKKPSAQEEDSAVYYCALR
Balaenoptera acutorostrata scammoni V390 trav ATDI01182739.1 1721 VNSQQGEENLQALSIQEGENATMNCSYKTTIETLHWYIQDSRRDFAHLILIRSNEREKRSGRLRVTLDNSIKSSSLSITASQAADTATYLCATE
Balaenoptera acutorostrata scammoni V391 trav ATDI01182741.1 1530 GTNGDSVTQTEGPVTVTEGAPRTLHCTYQTSDSDPYLFWYVQYLNKAPQFLLKGSKANQRAEHQGFQATLVTSDSSFHLQKPSVQTSDSAVYYCALS
Balaenoptera acutorostrata scammoni V392 trav ATDI01182741.1 10554 LRGEDQVDQSPQTLKIQEGGSLTLNCSYTVSNFRGLQWYRQDPGTGPELLFLLHSVGDEKQKERLKATLLKKGSSLHIAAPEPEDSATYLCAVE
Balaenoptera acutorostrata scammoni V393 trav ATDI01182743.1 9638 GTGAQSVAQPDGRITVSEGARLELRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGNNLVTGIKSFEAEFRRGETSFHLRKTSAHLKDSAKYFCALS
Balaenoptera acutorostrata scammoni V394 trdv ATDI01182746.1 3036 FGAAQKVTQAQTAISSQLGETVTLNCRYETSWRRYYIFWYKQLPSGEMTFLIDQSSSGQNAKKGRYSINFQERHKFISLTISALLMEDSANYFCALWE
Balaenoptera acutorostrata scammoni V395 trav ATDI01182746.1 14278 GTGAQSVTQPDGRITVSEGARLELRCKYSSSVQPTLFWYVQYPNQGLQLLLEYTSRNSLVSGIKGFEAEFRKSETSFHLRKTSAHWKDSAKYFCALS
Balaenoptera acutorostrata scammoni V396 trav ATDI01182749.1 2752 GMSGQQLNQSPRFMSIQEGEDVSMNCNSSSTLNLLLWYKQDAGGGPILLITLYKGGELTRNGKLTAQFSGTRKDSFLNISASEPKDAGTYFCAG
Balaenoptera acutorostrata scammoni V397 trav ATDI01182749.1 7873 ASSDDKVIQSPPSLVVHEGTRATLNCSYKVTNFQSLHWYKQEEKAFTFLFILISAGIEKRSGRLRGTLDRKELLSTLHITATKPGDSATYLCAVE
Balaenoptera acutorostrata scammoni V398 trav ATDI01182750.1 618 PGKADWIRPQETEVSGTEGKTVSLLCNYYTSSTSFVDLYWYRQYPNQAPEYILYRGWGYSGKGYASFATERFYSENTANTTNLYIKRVLRADTALYHCALR
Balaenoptera acutorostrata scammoni V399 trav ATDI01182752.1 6168 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESDYYLLWYKQPPSGEMIFIILQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYRG
Balaenoptera acutorostrata scammoni V400 trav ATDI01182752.1 9876 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESDYYLLWYKQPPSGEMIFIILQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYRG
Balaenoptera acutorostrata scammoni V401 trav ATDI01182754.1 15170 VSGKNGVEQGPRYLSALEGDFVTINCSYSGEMTTLQWLQQNPGGGVVSLLILSLEMKKKGRVSATINRKERHSSLHITASQPRDSATYFCAVE
Balaenoptera acutorostrata scammoni V402 trdv ATDI01182758.1 18656 VMSAAVLVPQDQARSVSVGEPVTLRCSMKGESISNYYTFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDSLNNQAVLNILEASERDEGSYYCAS
Balaenoptera acutorostrata scammoni V427 trav ATDI01007197.1 9450 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Balaenoptera acutorostrata scammoni V489 trbv ATDI01035785.1 73901 LKDAVVTQFPRHRVSKTGKELTLQCSQNMSHNSMYWYRQDPGFGLRLIYYSTSTRITEKGDVPEGYRVSRDELEYFPLTLESASTNQTSVYLCASSE
Balaenoptera acutorostrata scammoni V490 trbv ATDI01035785.1 62563 PLEADVTQSPRHQITETRKRVTLTCSQNMNHDAMYWYRQDPGLGLKLIYFSSNLELVEKGDVPDGYIVSRKKKPDFPLTLASASTNQTSLYLCASSL
Balaenoptera acutorostrata scammoni V491 trbv ATDI01035786.1 35235 TVDGGVTQTPKYLFKVEGRDVTLKCEQDFDYDVMYWYRQDPGQGLRLIYYSQIVKDVRKGDIAEGYSASREKKSLFPLTLTSTQKNQTALYLCAANI
Balaenoptera acutorostrata scammoni V492 trbv ATDI01035786.1 29795 GSGLSALVSQHPSRAICKSGASVTIQCRSVDFQATTVLWYHQFPKQGLVLIATSNEGSDATYEQGYTKAKYPVSHPNLTFSSLMVTNVHPADSSLYFCGAR
Balaenoptera acutorostrata scammoni V493 trbv ATDI01035786.1 14998 CMDTEVTQSPGHLVKGKEQKAKMHCVPRKGHTHVYWYRKKLEEGFEFLVYLQNEDIVDDTDVFKQRFSAHCPRSSPCSLEVKSTEAGDSALYFCASSQ
Balaenoptera acutorostrata scammoni V494 trbv ATDI01035786.1 9912 PMDAEIYQMRFVLAEAGRDVTLECKQALSYNAMYWYRQDAGQGLRLIYYSTVEKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCAGS
Balaenoptera acutorostrata scammoni V495 trbv ATDI01035786.1 707 SMDADITQTPRNRIANTGKNTVLECSQTKGHESMYWYRQDPGLGLRLIYYSHGVNDINKGDVSDGYNVSRKERAKFSLFLEPATPNQTALYFCASSI
Balaenoptera acutorostrata scammoni V590 trbv ATDI01085027.1 71697 ASVDTGITQIPKYLVMETRSKKSLRCEQHLGHNSMYWYKQSAQKPLELMFVYNYKELASNETVPSRFWPKCPDSSHLYLHVDTLKLGDSALYLCASSK
Balaenoptera acutorostrata scammoni V591 trbv ATDI01085027.1 52189 PGNAGVTQDPKFRVLRTGQSVTLKCAQDLDHYYMCWYRQDLGHGLRLIYYSSATGTANKGDVPDGYSVSRSNLEDFPLTLASATPSQTSVYLCASSY
Balaenoptera acutorostrata scammoni V592 trbv ATDI01085027.1 26334 LSITGPVEAGITQEPRYKITVTGETVTLECHQTDNHDYMYWYRQDLGHGLRLIHYSYGVGNIEKGEIPDGYNVSRSNTEDFPLTLASVIPSRTSVYFCASSD
Balaenoptera acutorostrata scammoni V593 trbv ATDI01085027.1 12734 PTDAGVTQTPRHEVTEVGHAVTLSCEPISDHTVLYWYRQTLVQGLEFLIYFLNQAPMDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Balaenoptera acutorostrata scammoni V594 trbv ATDI01085027.1 8525 HIGAMVIQNPGYLVTRMGKPVTLSCSQNLNHEVMFWYQQKLSPAPSLLFYYYDKEFNNEKDTSDNLQSSWPNTSFCSLGICSAGLGDSATYLCASSR
Balaenoptera acutorostrata scammoni V595 trbv ATDI01085027.1 4023 FLEAEVSQTPGHLVQGKGQKVKMYCVPRKGDVYVSWYRQILAKEFKFLISFQNNDVLDETEMPKERFSAECPPNSPCSLEIQPAELQDSAVYLCASSD
Balaenoptera acutorostrata scammoni V672 igkv ATDI01136043.1 19875 TTGEATLTQSPASLSLSPGESATLTCRASQSVSKYLAWYQQEPGQAPRLLIYDATTRASGIPAQFSGSGSGTDFTLTISSLEPEDVAVYYCY
Balaenoptera acutorostrata scammoni V673 igkv ATDI01136045.1 6504 TTGEATLTQSPASLSLSPGESATLTCRASQSVSKYLAWYQQEPGQAPRLLIYDATTRASGIPAQFSGSGSGTDFTLTISSLEPEDVAVYYCY
Balaenoptera acutorostrata scammoni V674 igkv ATDI01136045.1 2289 TTGEATLTQSPASLSLSPGESATLTCRASQSVSKYLAWYQQEPGQAPRLLIYDATTRASGIPAQFSGSGSGTDFTLTISSLEPEDVAVYYCY
Balaenoptera acutorostrata scammoni V676 iglv ATDI01136912.1 55495 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGKYNAVSWFQQLPGMAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSGSSS
Balaenoptera acutorostrata scammoni V677 iglv ATDI01136912.1 49359 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGKYNAVSWFQQLPGMAPKTLIYDVNKRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSGST
Balaenoptera acutorostrata scammoni V678 iglv ATDI01136912.1 28950 SVASYELTQPPSVSVALGQTSKITCSGDLLDKKYTSWHQQKPGQAPVLVIYQDSKRPSGIPDRFSGSSSGNTATLTISGARAEDEADYYCGSADSSDY
Balaenoptera acutorostrata scammoni V679 iglv ATDI01136912.1 22472 SVTSSELTQPPAVSVSLGQTARITCQGDSLGSYYVSWYQQKPGQAPVLVIYGGSNRPTGIPDRFSGSGSGNTATLTISGAWAEDEADYYCGSADRSGY
Balaenoptera acutorostrata scammoni V680 iglv ATDI01136912.1 15502 SVTSSELTQPPAVSVSLGQTARITCQGDSLGSYYVSWYQQKPGQAPVLVIYGGSNRPTGIPDRFSGSGSGNTATLTISGARAEDEADYYCGSADRSGY
Balaenoptera acutorostrata scammoni V681 iglv ATDI01136914.1 23696 SWAQSALTQPPSVSGNPGQTVTISCAGTSSDIGKYNYVSWYQQRPGTAPKTLIYQVNKRPSGIPDRFAGSKSGNTASLTISGLQAEDEADYYCSSGTSS
Balaenoptera acutorostrata scammoni V682 iglv ATDI01136914.1 6483 SWAQSALTQPPSVSGNPGQTVTITCAGTSSDIGKYNYVGWYQQRPGTAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSAGSG
Balaenoptera acutorostrata scammoni V683 iglv ATDI01136914.1 4477 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDVGGYNQVGWYQQRPGTAPKTLIYEVNKQHSGIPDRFSGSKCGNMASLTISGLQAEDEADYYCSSGTSS
Balaenoptera acutorostrata scammoni V685 iglv ATDI01136920.1 3509 SWAQSGLTQEGSVSGSVGQEVTLSCTRNGNNVGANTVNWYQQISHGAPKTAMLTGSLPSGIPDRFSGSTSVNTASLTISGLQPEDKADYYCSTWDDSISG
Balaenoptera acutorostrata scammoni V686 iglv ATDI01136921.1 5757 VVLTQPRSVLGSLEQKVTISCTRSSGNFGSYYVHWYQQRPGSALTTVIYKDDQRPSGVPNRFSGSIDTSSSAAYLTISGLQPEEEANYYCQSGYDSNK
Balaenoptera acutorostrata scammoni V771 trdv ATDI01182760.1 5550 KDVLCNQVTQISQEQTVASGSEVTLQCIFQTALSDPDLYWYQIRPDRSFQFVLYRDSTTSYDADFARGRFSVQYSLTHKTFHLVISSVRTEDSATYYCALS