WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Myotis lucifugus AAPE00000000.2 (AAPE02) 551 269 121 0 67 80 9 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Myotis lucifugus V1 ighv AAPE02053206.1 23515 VLSQVQLQESGPGLVKPSQTLTVTCTVSGFSLTSYHMHWIRQPLWKGLEWMGRINNNGDTYYSPSLKSRTSISRDTSKNQVSMQLSSVITEDTAVYYCAR
Myotis lucifugus V2 ighv AAPE02053206.1 56072 AAAGVGLLSGAALADPVADPVPHLCHLWGQCFWVRQPPGKGLQWLGRTYFSSKWYREYAPSLQSRLVIDPNTSKNQFSLQLRSMTTEDTAVYYCVR
Myotis lucifugus V3 ighv AAPE02053206.1 60057 VQCEVQLVESGGGLVQPGRFLRLSCAASGYTFSSYWMGWVCQAPCKGLEWVSLITGNGGRTYYANTAKVRFTISRDNTKNMLYLQMNSLTAEDMAVYYCA
Myotis lucifugus V4 ighv AAPE02053208.1 10918 VQCEMQLVESGGGLVPPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWLGEINPDGSTTNYANAVKGRFTISRDNAKNTLFLQMKSLRAEDMAVYYCAR
Myotis lucifugus V5 ighv AAPE02053208.1 15720 VQCEVQLVESGGGLVPPGGSLRLPCAASGFTFSGYWISWARQAPGKKLEWVSDISGDSSITYYAASVKGRFTISRDNAKNTLYLQMNSLRAEDTALYYCARET
Myotis lucifugus V6 ighv AAPE02053208.1 26094 ALSEVKLQESGPGLVKPSQTLSLTCTVTGYSITSGYCWSWVRQPPGKGLEWMGCVNNDGNLYYTPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAMYYCTR
Myotis lucifugus V7 ighv AAPE02053208.1 36144 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVSFVTDYGGSIYYADSVKGRFSISRDNAKNTLYLQMTSLRATDTAVYYCA
Myotis lucifugus V8 ighv AAPE02053208.1 39925 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSHWMGWFRQAPGKGLEWLSEITPDGSTTHYAKSMKGRFTISRDNAKNMLYLQMNSMRATDTAHYYCA
Myotis lucifugus V9 ighv AAPE02053210.1 5883 VLSEVQLQESGPGLVTPSQTLSLTCTVTGYSITSGYCWSWIRQPPGKGLEWMGCINNVGNLYYTPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCTR
Myotis lucifugus V10 ighv AAPE02053210.1 9204 VLSQVQLQESGSSVVQPSQTLSLTCAITGDSVSSNSATWDWFRQPPGKGLQWLGRTYFRSKWYRQYAPSLQSRLVIDPDTSKNQLSLQLRSVTTEDTAVYYCAR
Myotis lucifugus V11 ighv AAPE02053210.1 12757 VQCEVQLVESGGGLVLPGGSRRLSCAASGFTFSSYWMHWVRQAPGKGLEWLCEINPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLSTQDTAMYYCTT
Myotis lucifugus V12 ighv AAPE02053211.1 1814 AQCEVQLVESGGGLVPPGRSLRLSCAASGFTFSNYWMGWVRQSPGKGLEWVSFITDYGGSIYYADSVKGRFSISRDNAKNTLYLQMNSLTAEDMAVYYCA
Myotis lucifugus V13 ighv AAPE02053212.1 752 VQCEVQLVESGGGLVPPGGSRRLSCAASGFTLNSHWIGWVRQAPGKGLEWLCRMNPDGSTTNYANAVKGQFTISRDNAKNTLYLQMNSLSTQDTAMYYCTT
Myotis lucifugus V14 ighv AAPE02053215.1 709 VQCEVQLVESGGGLLPPGGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVSFITDYGGSIYYANAVKGRFSISRDNVKNTLYLQMNSLKAEDTAVYYCA
Myotis lucifugus V15 ighv AAPE02053216.1 400 VQCEVQLVESGGGLVPPGGSLRLSCTASGFTFSNYWMGWVRQAPGKGLEWVSFITDYGGSIYYANAVKGRFSISRDNAKNTLYLQMNSLTAEDMAVYYCG
Myotis lucifugus V16 ighv AAPE02054363.1 2051 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGEGLEWVSYINPDGSTTSYAQSVKGRFTISRDNAKNTLYLQMNSLSAEDMALYYCVR
Myotis lucifugus V17 ighv AAPE02054368.1 828 VLSQVQLQESDPALVKPSQTLSVSCADHGVSVTTSGYCSSWIRQSPGKGLEWMGCICYDGNTYYSPSLKSRISVSRDTSKNQVSLQLSSVTTDDTAVYYCAR
Myotis lucifugus V18 ighv AAPE02054369.1 2925 GLCQVQLVESGGGVVPPGGSLSLSCKASGFNFTNYEMNWVRQAPGKGLQWVAKVSKPTGKNQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDTAVYYCT
Myotis lucifugus V19 ighv AAPE02054371.1 3532 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYAMHWVRQAPEKGLKYMGWINTNTGKPTYAQGFSERFIFSMDTSVSTAYLQINGLKSEDTAMYYCAR
Myotis lucifugus V20 ighv AAPE02054373.1 5686 VQCEVQLVELEGSLVQPGRSWKLSCAASGFTFSDHWMSWVRRAPGKKLEWVSDINGDSSTTYYAASVKGRFTISRDNAKNTLFLQMNSLRAEDTALYYCVRE
Myotis lucifugus V21 ighv AAPE02054373.1 12572 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYSMFWVRQALGKGLQYMGFINTETGKPTYAQGFSERCVFSMDTSVSTAYLQINGLKSEDTAMYYCA
Myotis lucifugus V23 ighv AAPE02054379.1 35153 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFNDYEMNWVRQAPGKAFEWVSYINGGGGTAYYASSVKGRFITSRDNAKNMLYLQMNSLRAEDTAVYYCTTDK
Myotis lucifugus V24 ighv AAPE02054379.1 37185 VQCEVQLVESGGGLVPPGGSLRLSCATSGFTFSGYWISWARQAPGKKLEWVSDINGDSSTTYYAASVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCARET
Myotis lucifugus V25 ighv AAPE02054379.1 45862 VQCEVQLVESGGGLVPPGGSLRLPCAASGFTFNDYEMNWVRQAPGKGLEWVSRITNTGGSTHYAASVKGPFTISRDNAKNTLFLQMNSLRAEDQAMYYCTA
Myotis lucifugus V26 ighv AAPE02054379.1 49475 VLSQVQLQQWGTGLVKPSETLSLTCAVSGHSITSASCWHWIRQALGKGLEWMGCICSDGSTNYSPSLKSRTSISRVTSKNQFSLQLSSVTTEDTAMYYCAR
Myotis lucifugus V27 ighv AAPE02054379.1 63003 VQCDVQLVESGAGLVPPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWLGDISPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLKAQDTAVYYCA
Myotis lucifugus V28 ighv AAPE02057263.1 1871 VLSEVQLQESGPGLVTPSQTLSLTCTVTGYSITSGYCWSWIRQPPGKGLEWMGCINNVGNLYYTPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCTR
Myotis lucifugus V29 ighv AAPE02057263.1 14655 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSSWMDWVRQAPGKGLEWLGEINPDGSTTNYANAVKGRFTISRDNAKNMLYLQMNSLSAQDTAVYYCVR
Myotis lucifugus V30 ighv AAPE02057266.1 9030 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYWNTWVRQAPGKGLEWLGEINPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLSAQDTAVYYCVR
Myotis lucifugus V31 ighv AAPE02057266.1 15645 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYWNTWVRQAPGKGLEWVSYINGDGSTTSYADSVKGRFTISRDNAKNTLYLQMNSLRAQDTAVYYCTR
Myotis lucifugus V32 ighv AAPE02057268.1 9480 VQCEVQLVESEGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVARITNSGGSSYYAEYVKGRFTISRDNAKNTLYLQMNSLKVEDTAMYYCAT
Myotis lucifugus V33 ighv AAPE02058195.1 21106 VQCEVQLVESGGGLGKPEGSLRLSCAASGYASSSYYMNWVRQTPGKGLEWICAITGNGDSTYYADSVKGRFTISRDNTKNMIYLQMSSLKSEDTAVYYCAT
Myotis lucifugus V34 trgv AAPE02059294.1 6568 GLGLSTLKQSQLSITTEVGEIIDIDCKITSTNFEKDIIHWYRQKPNQALERLIYVSSTKSPAISHVDGKRNKVEARKNSQLLTSTLRIYFIGKEDTGTYYCAGW
Myotis lucifugus V35 trgv AAPE02059294.1 12119 GLGQLKLEQPELSISWAKGESAQIPCKVSSSTFSRDYIHWYRQKPDQSIEYLIYVASTATVFGKNNKLMASKYSQTSTSTLTINFLEKEDEAVYFCACWTG
Myotis lucifugus V36 trgv AAPE02059298.1 1302 GLGLSTLEQSQLSITTEVGESIDIDCKITSTNFEMDIIHWYRQKPNQALEHLIYVSSTLGPVRSHVDGKRNKVEAGKNSQLLTSTLRIYFIGKEDMGTYYCAGWY
Myotis lucifugus V37 trbv AAPE02060111.1 2251 LMDTGITQMPRHLVMGMRNKKSLKCKQHLGHNNMYWYKQSAQKPPELMFIYNYKELVENNTVPSRFSPECPDSSQLYLHMDAPEPEDSAVYLCASSK
Myotis lucifugus V38 trbv AAPE02060112.1 465 PVDSGVTQSPKHLVKARKQQVTLSCSYISGHRSVYWYQQAQDQGPQFLIEYYNGKQSTKGNIPDRFSVQHFSDYRSELTMSSLELSDSALYLCASSE
Myotis lucifugus V39 trbv AAPE02060112.1 9046 SLDTAVFQIPKYLITRVGNKKSLSCEQKLNHDAMYWYKQDSKQLLKIMFYYNNKELILNETVPSRFLPESQDKAHLNLHINSLEMGDSAVYLCASSQ
Myotis lucifugus V40 trbv AAPE02060112.1 13136 LMDTGITQMPRHLVMGMRNKKSLKCKQHLGHNSMYWYKQSAQKPPELMFSYNYQKLIENNTVPSRFSPECPDSSQLYLHVDALEPEDSAVYLCASSK
Myotis lucifugus V41 trbv AAPE02060112.1 18158 PVDSGVTQTPKHLVRARKQQVTLKCSYISGHLSVFWYQQAQDQGLQFLTEYYNREERTKGNIPDRFSVQQFSDHRSELNMSSLELSDSALYLCASSK
Myotis lucifugus V42 trbv AAPE02060112.1 26465 SLDTAVLQTPKYLITQVGNKKSLSCEQKLNHDYMYWYKQDSKQLLKIMFSYSTKELILNETVSSRFLPEPLDKAHLKLHISSLEPGDSAVYLCASSQ
Myotis lucifugus V43 iglv AAPE02060471.1 8198 SRSQAVVTQEPSESVSPGGTVTLTCGSSTGAVTDGHYPHWIQQKPGQVPMGLIYDTNKKYSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCVLWYSGR
Myotis lucifugus V44 iglv AAPE02060471.1 14051 SLSQPVLTQPPSLSASPGATARLTCTLSSGSNVGDYWIRWFQQKPGSPPQYLLYFSSSTNLGPGVPSRFSGSTDTSANAGLLTISGLQPEDEADYYCATWYGSS
Myotis lucifugus V45 iglv AAPE02060471.1 25267 SRSQAVVTQEPSATVSPGVTVTLTCGSSTGAVTDGLYPQWIQQKPGQVLTTLIQNTNNKHSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSSR
Myotis lucifugus V46 iglv AAPE02060471.1 28216 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGGGSYVYWYQQLPGKAPKLLIYEDSKRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSYSRSGV
Myotis lucifugus V47 trbv AAPE02062124.1 4058 SVAAGVIQSPRHVFKVQRGKAVLKCHPISGHNTVYWYQQALSQSPEFLISFYEKEEGHKGNIPDRFSGKQFNNYSSELALSALQLGDSAVYLCASSL
Myotis lucifugus V48 trbv AAPE02062124.1 8727 NLDAQITQSPRYKVAGTEKNVTLSCHQANNHGVMYWYRQDMGHELTLIYYSVSAGITAKGDGADGYSVLRQNKENFVLTLKSATPSQTSVYFCASSEV
Myotis lucifugus V49 trbv AAPE02062124.1 10338 HTKAGVSQSPTHIVTEREQDVTFRCDPISGHTVFYWYQQTLEQSLDFWLYFQNMVTLDTSGMPKEQFSAERPDGSFSILKIQRAEQEDSAMYLCASSL
Myotis lucifugus V50 trbv AAPE02062127.1 646 NLDARITHSPRYKVVGTEKNVTVSCHQTNNHNVMYWYRQDLSHELTLIYYSVSAGITAKGDGADGYSVSRSNTENFALTLESETPSQTSVYFCSSSE
Myotis lucifugus V51 trbv AAPE02062127.1 1837 HTDAGVSQSPRHIVTERGQNVTLRCDPISGHSFLYWYRQMLGQGPEFLLYFQNKNPLDTSGIPNKRFFAERPDGSNSTLTIQRAEQGDSAVYLCASSL
Myotis lucifugus V52 iglv AAPE02062173.1 10999 SRSQAVVTQEPSESVVPGVTVTLTCSTNTGEVTSGHYPYWIQQKPGQVPRTLIYDTSNKLSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALGYSGR
Myotis lucifugus V53 iglv AAPE02062173.1 14046 SWAQSVLTQPSSVSGAPGERVTISCTGSSSNIGGGNYVHWYQQLPGKAPKLLIDGDNIRPSGVPDRFSGSTSGSSGTLTITGLQAEDEADYYCQSFDDDLGT
Myotis lucifugus V54 ighv AAPE02062386.1 523 VHSQMQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQPPGQGLEWVGRIYPGSGNTKYAQKFQGRVSITVDKSTSTAYMELSSLRAEDTAVYYCAR
Myotis lucifugus V55 ighv AAPE02062386.1 3284 VLSQVQLQGSGPGLVKPSQILSLTCSVSGYSITSGYYWSWTRQPPGKGLEWIGMIIYDGRTYYSPSLKSRATISRDMSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V56 ighv AAPE02062386.1 7159 VLSQVQLQELGPGLVKPSQTLSLTCSVSGYSISSGYCWDWIRQPPGKGLEWIAEICSSGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V57 ighv AAPE02062387.1 4846 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTTDYAWSWIRQSPGKGLEWMGNIWYDGSTYYNPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Myotis lucifugus V58 ighv AAPE02062634.1 2097 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSFWSYPMNWVRQASGKGLEWVALISSGRDGNTYYATSVKGRFTISRDNAKNSLYLQMSSLRSDDTALYYCA
Myotis lucifugus V59 ighv AAPE02062634.1 5852 VLSQVQLQESGPGMVKPSQTLSLTCTISALSPRSYGVFWIRQAPGKGREWVGVLWSSGNTAYNAALKSRLSITRDTSKSQVYLTMSSLRAEDTALYYCA
Myotis lucifugus V60 ighv AAPE02062634.1 10683 VHSQVQLVQSGAEVRKPGASVKVSCKASGFTFTTYYMHWVRQAPGQGLEWVGRVDPLPGITNYAQKFQGRVSITGDTSTSTAYMELSSLRADDTAVYYCA
Myotis lucifugus V61 ighv AAPE02062634.1 13484 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSGYWSWICQPPGKGLEWIGITYDGRTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTENMAMYYCAR
Myotis lucifugus V62 ighv AAPE02062634.1 19025 VLSQVQLQESGPGLVTPSQTLSLTCSVSGFSLTSYGVHWIRQAPGKGLEWVGIMWGGGSTDYNPTLKSRLSITRDTSKSQVYLTLNSLKADDTAVYYCA
Myotis lucifugus V63 iglv AAPE02063071.1 1803 SWAQSVLTQPSSVSGAPGERVTISCTGSSTNIGNGYYVHWYQQLPGKVPKLIIYEYSKRPSGIPDRFSGSRSGSSASLTITGLQAEDEADYYCQSYDSSISG
Myotis lucifugus V64 iglv AAPE02063071.1 11091 SRSQAVVTQEPSESVVPGVTVTLTCSTNTGEVTSGHYPYWIQQKPGQVPRTLIYDTSNKLSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSSR
Myotis lucifugus V65 iglv AAPE02063072.1 1616 SWAQSVLTQPSSVSGAPGERVSISCTGSSSNVGYGYNVHWYQQLPGKAPKLLIYDNSNRPSGVPDRFSGSKSGSSGTLSITGLQAEDEGIYHCQSYDSSLSA
Myotis lucifugus V66 trbv AAPE02064736.1 2686 LMDAEVTQVPRYLIKRKGEKVLMECLQDMDHERMFWYRQDSALGLQLLHFSYGVENYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSR
Myotis lucifugus V67 trbv AAPE02064736.1 6532 SVFGALLSQKPLRDICQRGTSVTIQCHVDSQLALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFPIHRPNLTYSILTVNSVNPEDSSFYFCSAG
Myotis lucifugus V68 iglv AAPE02064890.1 3478 SWAQSVLTQPSSVSGSLGQRVTISCTGSSSNVGRGDYGSWLQQLPGKAPKLLIYESSKRPSGVPDRFSGSRSGNSASLTITGLQAEDEADYYCESWDNSLSA
Myotis lucifugus V69 iglv AAPE02064931.1 1096 SWAQSVLTQPSSVSGSPGERVTISCTGSSTNVGYGDYGSWYQQLPGTAPILLIYHSSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEAVYYCVSFESSPYG
Myotis lucifugus V70 iglv AAPE02064931.1 4204 SWAQSVLTQPSSVSGSPGQKVTISCTGSSSNIGGNNVNWYQQLPGKAPKLIIYGSSGRPTGVPDRFSGSRSGSSASLTITGLQAEDEADYYCSAWDSSLSG
Myotis lucifugus V71 iglv AAPE02064932.1 4661 SWAQSVVTQPSSVSGSPGQRVTISCTGSGNNIGLGDYVSWYQQLPGKAPKLLIYESSKRPTGIPDRFSGSRSGNTASLTITGLQAADEADYYCL
Myotis lucifugus V72 iglv AAPE02065465.1 10654 SRSQAVVTQEPSATVSPGGTVTLTCGSSTGAVTDGIYPHWIQQKPGQVPMALIYDTNKKLSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCVLWYSSR
Myotis lucifugus V73 trav AAPE02065616.1 10539 VNGKNGVEQSPQHLSAQEGEVITINCSYSIGMTSLHWMRQNPGGGIVSLFTLSLEMKKKGRISATINTKESRSALHISAAQPRDSAVYLCAVE
Myotis lucifugus V74 trbv AAPE02066174.1 1171 LLDAGVTQTPRHKVTKIGQEVTLSCKPISGHGSLYWYRQTSLQGLKFLTYFRNQAPIDETGMPKDRFSAKMPNGSFSTLKIQPTEAEDSAMYLCASSL
Myotis lucifugus V75 trbv AAPE02066174.1 5446 YMGAIVTQNPRFQVTRMGKPVTLSCFQDLNHDAMYWYQQKLSQAPKLLFYYYDQQFNNETDTSVNFQPSRPNTSFCSLGIRSPGLGDSAVYLCASSK
Myotis lucifugus V76 iglv AAPE02066911.1 118 SWAEPVLTQPSSVSGSPGERVTISCTGSSSNIGGGNYVHWYQQLPGKSPKLLIYDDSNRPSGVPDRFSGSTSGSSASLTITGLQAEDEADYYCQSFDDDLGT
Myotis lucifugus V77 trav AAPE02067902.1 285 LSSQKMEQNPQSLSIQESEKAVLTCSYANYSPVFIQWYRQDPGRGPIFLLLIRENERTKLVGRLRATFDTTIKQSSFYITASQPADSATYLCAA
Myotis lucifugus V78 iglv AAPE02068188.1 164 CADSAALLSASPGGTARLTCTLSGASYPFSDYWILWFQQKPGSRPRFLLEYKSDSSKNQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCMGGENNI
Myotis lucifugus V79 iglv AAPE02068188.1 4361 SRSQAVVTQEPSATVSPGVTVTLTCGSSTGAVTDGLYPQWIQQKPGQVLTTLIQNTNKKYSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSSR
Myotis lucifugus V80 iglv AAPE02069277.1 3537 SVASYELTQPPSVSVNLGQTARLTCGGNNIGSKYTNWYQQKPGQAPVLVIYSDSYRPSGIPDRFSGTNSGNTATLTISGVQAQDEADYYCAVADGSG
Myotis lucifugus V81 ighv AAPE02069555.1 1919 VLSQVQLQESGPGLVKPSQTLSLTCTASGFSLTSSSVHWIRQAPGKRLEGVGVMFGGGSTAYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYFCAR
Myotis lucifugus V82 trbv AAPE02071224.1 4158 SLDTAVFQTPRYLITRVGNKKSLSCEQKLNHNAMYWYKQDFKQLLKIMFSYRNKELIQNETVPSRFLPEPLDKAHLKLHINSLELGDSAVYLCASSQ
Myotis lucifugus V83 iglv AAPE02072029.1 2203 SLSQPVLTQPPSLSASLGSTARLTCTVSSGLSVGGYYISWYQQNPGNPPQYLLEYKSDSEKHQGSGVPNRFSGSKDALANAGLLTISGLQPEDEADYYCT
Myotis lucifugus V84 iglv AAPE02072029.1 4564 SWAEVVFTQPPSVSGSPGQKAVISCTRSSGNIGNNYVHWYQQRPGRAPTRMIYEYDKRPSGVPDRFSGSVDRSSNIAHLTISGLQPEDEADYYCLSSYDSY
Myotis lucifugus V85 trgv AAPE02009757.1 283 GLGLSTLKQSQLSITTEVGEIIDIDCKITSTNFEKDIIHWYRQKPNQALERLIYVSSTKSPAISHVDGKRNKVEARKNSQLLTSTLRIYFIGKEDTGTYYCAGW
Myotis lucifugus V86 trgv AAPE02009757.1 5012 GLGQLKLEQPEISISSARDESAQIPCKVSSGTFSKDYIHWYRQKPDQGIEHLIYVASTATVFGKNSKFKASKYPQTSTSTLTINFLEKEDEAVYFCACWTG
Myotis lucifugus V87 trgv AAPE02009757.1 10557 GLGQLKLEQPEISISRAIYKSAQIPCKVSSGTFSSDYIHWYRQKPDRSIEHLIYVVSTTLAGGKNNKFKASKYPQTSTSTLTINFLAKEDEAVYFCACWTG
Myotis lucifugus V88 trgv AAPE02009757.1 13726 GLGQFKLEQPVISISRTRGESAQIPCKVSSGTFSSDSIHWYRQKPDQSMEHLIYVVSTTLAGGKNNKLEASKEFYTSTSTLRINFLEKEDEAVYFCACWTG
Myotis lucifugus V89 trgv AAPE02009757.1 19924 TSGDIQITQALTSITKRKGSTAFLECQIRDILTKDSYIHWYRQKPDQALKRILSISSDDNVIHEQGVSGERYEARKHHGNLLVSLRIHGVEEADAGLYYCACWI
Myotis lucifugus V90 trgv AAPE02009757.1 21683 GDTKMRISQDQLSFIRRPNRTVHISCKLSGVPLENAIVHWYQQKKGEPLRRILYGSTKNSKDNKLNPRLEAYRKDGTFNLIINNVVKSDEAIYYCACWD
Myotis lucifugus V92 trbv AAPE02029188.1 33252 SLDTAVLQTPKYLITRVGNKKSLSCEQKLNHSAMYWYKQDSKQLLKIMFSYSTKELILNETVPSRFLPEPLYKAHLKLHINSLETGDSAVYLCASSQ
Myotis lucifugus V93 trbv AAPE02029188.1 42691 PVDSGVTQTPKHLIKARKQQVTLKCSYISGHLYVYWYQQAQDQGPQFLTEYFNGKQSTKGNIPDRFSVQHFSDYRSELTMSSLELSDSALYLCASSE
Myotis lucifugus V94 trbv AAPE02029188.1 51254 SLDTAVFQTPKYLITRVGNKKSLSCEQKLNHNAMYWYKQDFKQLLKIMFSYSNKELILNETVPSRFLPEPLDKAHLKLHINSLEPGDSAVYLCASSQ
Myotis lucifugus V95 trbv AAPE02029188.1 55624 LMDTGITQMPRHLVMGMRNKKSLKCKQHLGHNNMYWYKQSAQKPPELMFVYNYKELIENNTVPSRFSPECPDSSQVYLHVDALEPEDSAVYLCASSK
Myotis lucifugus V96 trbv AAPE02029188.1 59781 PVDSEVTQTPRHLTKARGQTVTLGCSPLSGHFAVSWYQQAQGQGLQFLIGYYSGEESAKGNISDRFSGQQSDDYSSKLTMSSLERKDSALYLCASSL
Myotis lucifugus V97 trbv AAPE02029189.1 1936 PVDSGVTQTPKYLIKARKQQVTLKCSYISGHLSVYWYQQAQDQGPQFLTEYYRRQERTKGNIPDRFSVQQFNDHRSELTMSSLELSDSALYLCASSK
Myotis lucifugus V98 trbv AAPE02029189.1 11455 SLDTAVFQTPKYLITRVGNKKSLSCEQKLNHNAMYWYKQDSKQLLKIMFSYSNKELILNETVPSRFLPEPLDKAHLKLHINSLETGDSAVYLCASSQ
Myotis lucifugus V99 trbv AAPE02029189.1 15850 LMDTGITQMPRHLVMGMRNKKSLKCKQHLGHNSMYWYKQSAQKPPELMFVYNYQELVENNTVPSRFSPECLDSSQLYLHVDALEPEDSAVYLCASSK
Myotis lucifugus V100 trbv AAPE02029189.1 19694 PVDSEVTQTPRHLTKARGQTVTLGCSPISGHLAVSWYQQPQGQGLQFLIGYYNGEERAKGNISDRFSGQQFDDYSSKLTMSSLERKDSALYLCASSL
Myotis lucifugus V101 trbv AAPE02029190.1 1663 PVDSGVTQTPKHLVRARKQQVTLKCSYISGHLSVFWYQQAQDQGLQFLTEYYNREERTKGNIPDRFSVQQFSDHRSELNMSSLELSDSALYLCASSK
Myotis lucifugus V102 trbv AAPE02029190.1 6057 LVNAAITQTPKFQIWKTGQKGTLRCSQDMSHNYMCWYRQDLGHGMRLIHYSVGAGVTEKGDVPEGYSVTRSKTENFPLILESATPSQTSVYFCASSV
Myotis lucifugus V103 trbv AAPE02029190.1 11031 HTDAGVSQSPRHLVTERGQDVSLRCDPISGHAVLYWYQQTLGQGPEFLLYFQSKEPVDKSGMPKERFSAERPDGSYSTLKIQRAEQGDSAVYLCASSL
Myotis lucifugus V104 trbv AAPE02029190.1 16430 SVAAGVTQFPRHIIKVQGGEAVLKCHPITGHNTVYWYQQALSQSPEFLISFYEKQEEQKGNIPDRFSGKQFNNYSSELAMSTLQLGDSAVYLCASSL
Myotis lucifugus V105 trbv AAPE02029190.1 20916 NLDAQITQSPRYTVVGTEKNVSLNCHQTNNHGAMYWYRQDMGHELTLIYYSVGAGITAKGDGADGYSVLRQNKENFVLTLKSATPSQTSVYFCASSEG
Myotis lucifugus V106 trbv AAPE02029190.1 28878 SVAAGVTQSPRHIIKVQGGKAVLKCHPISGHSYVYWYQQALGHSPQFLISFYEKEDREKGNIPDRFSGKQFSDYSSELTLSTLQLGDSAVYLCASSL
Myotis lucifugus V107 trbv AAPE02029190.1 33540 NLDAEITQSPRYTVVGTEKNVSLSCHQTNHHGFMYWYRQDMGHELTLIYYSVSAGITAKGDGADGYSVLRQNKENFVLTLKSATPSQTSVYFCASSEV
Myotis lucifugus V108 trbv AAPE02029190.1 35150 HTKAGVSQSPRHIVTERGQDVTLRCDPISGHTRLYWYQQTLEQSLNFLLYFQNMETLDTSGMPKERFSAERPDGSYSILKIQRAEQGDSAVYLCASSL
Myotis lucifugus V109 trbv AAPE02029190.1 41371 SVAAGVTQSPRHIIKVQGGKAVLKCHPISGHSYVYWYQQALGHSPQFLISFYEKEDREKGNIPDRFSGKQFNNYSSELTLSTLQLGDSAVYLCASSL
Myotis lucifugus V110 trbv AAPE02029190.1 50435 SVAAGVTQSPRHVIKGQGGMAILKCHPISGHRSVYWYQQTLGHGPQFLIEYLEKKEREKGSIPDRFSGKQFNNYSSELTLSALQLGDSAVYLCASSL
Myotis lucifugus V111 trbv AAPE02029190.1 57374 HLDARITQSPTYKVTGREKKVTLRCHQTDNHNNMYWYRQDLGHGLRLIHYSVGAGITDKGDVADGYSVARSNRENFALTLDSATPSQTSVYFCASSE
Myotis lucifugus V112 trbv AAPE02029190.1 58956 HTNTGVSQFPRIIVTERGQNVSLQCDPISGHVGLYWYQQRLGQGPEFLIYFQNQEPVDKSGMPKERFYAERPGGSYSTLKIQRVEQEDSAVYLCASSL
Myotis lucifugus V113 trbv AAPE02029190.1 65639 SVAAGVTQSPRHLIKSREGKTVLKCHPISGHDTVYWYQQALGQNPQFLISFYEKEDREKGNIPDRFSGKQFSNYSSELTLSTLQLGDSAVYLCASSL
Myotis lucifugus V114 trbv AAPE02029190.1 70206 NLDARITQSPRYKVAGTEKNLTLSCHQTDNHDYMYWYRQDLNHELTLIYYSVGAGLTTKGDGADGYSVSRSNTENFALTLESATPSQTSVYFCASSE
Myotis lucifugus V115 trbv AAPE02029190.1 71011 HLDARITQSPRYKVTQTEKKVTLRCHQTDNHDYMYWYRQDLGHGLSLIQYSYGVGSIEKGDVPDGYNVTRSNTKDFLLTLESATTSQTSVYFCASSD
Myotis lucifugus V116 trbv AAPE02029190.1 73792 LTAGGVTQSPRHKVLEKSQAMALWCDPISGHQTLCWYQQTPGQGLELLVRFENEDAVDDSQLPKNPFSAERPKRADSTLKIQRAELGDSAVYFCASSL
Myotis lucifugus V117 trbv AAPE02029190.1 78244 PTDAGVTQTPRHKVTKMGQLVTLNCEPISGHTYLYWYRQTLEQGPKLLIYFSNQMPVDDSGMPKERFSAKMPNGSFSTLKIQPTEPGDSAMYLCASSL
Myotis lucifugus V118 trbv AAPE02029190.1 81072 PTDAGVTQTPRHKVTKMGQSVTLSCEPISGHTQLFWYRQTLKQGPKFLIYFNNQMPVDNSGMPKERFLAKMPNGSFSTLNIQPTEPGDSAVYLCASSL
Myotis lucifugus V119 trbv AAPE02029190.1 83800 PTDAGVTQTPRHKVTKKGQGITLSCEPISGHTYLYWYRQTSVQGLEFLISFSGLSPLDDTGMPKERFSAKMLNGSFSTLEIQPTEPGDSAMYLCASSL
Myotis lucifugus V120 trbv AAPE02029190.1 91847 HADAGVAQTPRHKVTKMGQAVTLNCEPISGHNDLYWYRQTSQQELKLLIYFSNRAPIDNSGMPKDRFSAKMPNGSFSTLEIQPTEPGDSAMYLCASSL
Myotis lucifugus V121 trbv AAPE02029190.1 93463 LLDAGVTQTPRHKVTKIGQEVTLSCKPISGHDSLYWYRQTSLQALKFLTYFRNQAPIDETGMPKGRFSAKMPNGSFSTLKIQPTEAGDSAMYLCASSL
Myotis lucifugus V122 trbv AAPE02029190.1 97630 YMGAIVTQNPRYQVTRMGKPVTLSCSQDLNHDVMYWYQQKLSQAPKLLFYYYDQDFNNETDTSDNFQPSRPNTSFSSLGIHSPGLGDSAVYLCASSK
Myotis lucifugus V123 trbv AAPE02029190.1 102493 PTEAEVTQTPRHLITETKKKLTVTCSQNMNHDAMYWYRQDPGLGLKLIYYSINVDHFEKGEVSEGYTVSRTEKGNFPLTLESANISQTSLYLCASR
Myotis lucifugus V124 trbv AAPE02029190.1 105018 LMDAEVTQVPRYLIKRKGEKVLMECLQDMDHENMFWYRQDPALGLQLLHFSYGVDIYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSI
Myotis lucifugus V125 trbv AAPE02029190.1 109322 SVFGALLSQKPLRDICQRGTSVTIQCQVYSQVALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFSIRRPNLTFSILTVNSVNPEDSSFYFCSAG
Myotis lucifugus V126 trbv AAPE02029190.1 128587 PTDAGVTQTPRHKVTKMGQTVALNCEPISGHTYLYWYRQTLEQGPKFLIYFSSQMPVDDSGMPKDRFSAKMPNGSFSTLEIQPTEPGDSAVYLCASSL
Myotis lucifugus V127 trbv AAPE02029190.1 131443 PTDAGVTQTPRHKVTKMGQSVTLSCEPISGHTHLYWYRQTLEQGPKFLIYFSNQMPVDDSGMPKERFSAKMPNGSFFTLKIQPTEPGDSAVYLCASSL
Myotis lucifugus V128 trbv AAPE02029190.1 134160 PTDAGVTQTPRHKVTKKGQGITLSCEPISGHTYLYWYRQTSVQGLEFLISFSGLSPLDDTGMPKERFSAKMLNGSFSTLEIQPTEPGDSAMYLCASSL
Myotis lucifugus V129 trbv AAPE02029190.1 140038 HADAGVAQTPRHKVTKMGQAVTLNCEPISGHYGLYWYRQTSLQELKFLIYFNNGAPTDNSGMPKDRFSAKMPNGSFSTLKIQPTEPGDSAVYLCASSL
Myotis lucifugus V130 trbv AAPE02029190.1 142976 LLDAGVTQTPRHKVTKIEQEVTLSCKPISGHNSLYWYRQTSLQGLKFLTYFRNQAPIDETGMPKDRFSAKMPNGSFSTLKIQPTEAGDSAMYLCASSL
Myotis lucifugus V131 trbv AAPE02029190.1 147342 YMGAIVTQNPRYQVTRMGKPVTLSCSQGLNHELMYWYQQKLSQAPKLLFYYYDQDFNNETDTSDNFQPSRPNTSFCSLGIRSPGLGDSAVYLCASSK
Myotis lucifugus V132 trbv AAPE02029190.1 149446 FIVAEVTQTPGHLIKGKGRNVKMYCVPKKGHDYVFWYQQILKKEFKFLVSFQYKNVLEAEMPKERFSAECPQNSACILEIYGTELQDSAMYLCASS
Myotis lucifugus V133 trbv AAPE02029190.1 156577 PTSASSVTQNPRRLVLGRGQEANLSCNPVKGHIYIYWYRQLLQEGLKFMIYLRRGEILDESGMPTKRFLAEFPKEGPSLFNIQLAELGDSAVYFCASSL
Myotis lucifugus V134 trbv AAPE02029190.1 159309 TVRSGVTQTPKYLLREEGRDVTLDCEQNLSHDSMYWYRQDPGQGLRLIYFSTVVKDVQQGDLAEGYRASREKKPFFPLTVTSTRKSQTAVYLCASSA
Myotis lucifugus V135 trbv AAPE02029190.1 161899 GSGLGALVSQHPRRAIHISGASVKIQCLPVDLQASTVFWYRQFPKQGLILMATSNVGSSVTYEQGFTEAKFPIIHPNLTFSTLTVTSAHPADSSFYLCGAS
Myotis lucifugus V136 trbv AAPE02029190.1 168128 SVDTEVTQSPGHLVKGKGQNAKMGCVPIKGHSYVYWYRQKLGEELKFLVYLQNEEILEKTDMINERYSPKCPQNSPCSLEIESTEPGDAALYFCASSQ
Myotis lucifugus V137 trbv AAPE02029190.1 170974 PTRAEIYQVPPFRLARAGRDVTLECEQNLRYNAMYWYRQDPGEGLKLIYYSTVEKDVQRGDIPEGYNVSREQKGLFPLTVRLAHTNQTAVYLCSGS
Myotis lucifugus V138 trbv AAPE02029190.1 173691 TVRSGVTQTPKYLLREEGRDVTLDCEQNFNHNSMYWYRQDPGQGLRLIYFSTVVKDVQQGDLAEGYRASREKKPFFPLTVTSTRKSQTAVYLCASSV
Myotis lucifugus V139 trbv AAPE02029190.1 176539 GSGLGALVSQHPRRAIPISGASVTIQCRTVDLQALTMFWYRQFPKQGLILMATSNMGSPVTYEQGFTEAKFPIIHPNLTFSTLTVTSAHPADSSFYLCGAS
Myotis lucifugus V140 trbv AAPE02029192.1 7926 SSDVQVTQTPGHLVKGKGQRARMDCIPPKEHPVVYWYQLTQNKEFKFLISFQNEDVFDQIELVKERFLAQCPKNVGCSLEIQASEPGDSVLYFCASS
Myotis lucifugus V141 trbv AAPE02029192.1 14028 YIDAGVSQTPRNKIAETGNSIILECSQNEDHDYMYWYRQDPGLGLRLIYYSYSDKIYKGDVHNGYSASRKEHKKFPLFLKAASPNQTAVYFCTSR
Myotis lucifugus V142 trbv AAPE02029192.1 22942 HQDAVVTQFPRHKILGTKKELTLECSQNMNHISMYWYRQDPGYGLQLIYYSNGIRTIAKGDVPEGYRVSRSELKYFPLTLESASTNQTSVYFCASSD
Myotis lucifugus V143 trbv AAPE02029192.1 31364 PTEAEVTQTPRHLITETKKKLTVTCSQNMDHELMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYKVSRTEKGNFPLTLESANISQTSLYLCASR
Myotis lucifugus V144 trbv AAPE02029192.1 37150 LMNAEVTQVPRYLIKRKGEKVFMECLQDMDHERMFWYRQDPVLGLQLLHFSYGVDIYEKGDFPYGYSVSRKKKEGFSLILVSASTNQTSVYLCASSI
Myotis lucifugus V145 trbv AAPE02029192.1 41146 SVFGALLSQKPLRDICQRGTSVTIQCHVDSQLALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFPIHRPNLTYSILTVNSVNPEDSSFYFCSAG
Myotis lucifugus V146 trdv AAPE02039937.1 79707 KGMLCNKVTQNSLDQTVATGSEVTLLCTYDTQYLNPDLYWYRKRPDHSFQFILHRDNTLAHDADFTQGRFSVQHSHTHRTFHLMISSVRTEDRATYYCAMS
Myotis lucifugus V147 iglv AAPE02048156.1 19082 SVSAGSLSQPVLTQPPSLSASPGATVRLTCTLNSGSNVGSYYISWYQQKPGSPPRYLLYYHTDSIKGQGSGVPSRFSGSKDASANAGLLTITGLQPEDEAVYYCA
Myotis lucifugus V148 iglv AAPE02048156.1 27112 SWAQFVLTQPPSVSGSPGQKAVISCTRSSGNIGGYYVSWYQQRPGRAPTLVIYEDDDRPSGVPDRFSGSIDSSSNAAHLTISGLQPEDEADYYCQSYGGGY
Myotis lucifugus V149 iglv AAPE02048156.1 32065 FVSAGSLSQFAVTQPPSLSASLGATARLTCTLSGVSDISGYWISWYQQKPGSPPRFLLNFKSDSDKYQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCA
Myotis lucifugus V150 iglv AAPE02048156.1 34130 FVSAGSLSQFAVTQPPSLSASLGATARLTCTLSGVSDISGYWISWYQQKPGSPPRFLLNFKSDSDKYQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCA
Myotis lucifugus V151 iglv AAPE02048156.1 36201 SVSAGSLSQPVLTQPPSLSASPGATARLTCTLSGVSDISGYWISWYQQKPGSSPRFLLNFKSDSDKNQGSGVPSRFSGSKDASANAGILLISGLQPEDEADYYCA
Myotis lucifugus V152 iglv AAPE02048156.1 40324 SLSQPVLTQPPSLSASLGATARLPCTLKSDVSAVNKTIFWFQQEPGSPPRYLLTYSSSPSLGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLI
Myotis lucifugus V153 iglv AAPE02048156.1 44825 SWAEPVLTQPSSVLGAPGERVTISCTDSSSKIGSNYVYWYQQLPGKAPKCIIYDNSNRLSGVPDRFSGSRSGSSATLTITALQVEDDAEYYCSGWDSSISG
Myotis lucifugus V154 iglv AAPE02048156.1 54912 SWAQSVLTQPSSVSGSPGERVSISCTGSSTNIGSHVVSWYQQLPGKAPKYIICKDSSRFSGVPDRFSGSKSGTSASLTITGLQAEDEADYYCLAWDKTLNG
Myotis lucifugus V155 iglv AAPE02048156.1 69646 SWAEPVLTQPSSVSGSPGQRVTISCTGSSTNIGVGDYVSWFQQLPGKAPKLLIYQSSNRPSGIPDRFSGSRSGSSASLTITGLQAEDEAVYYCL
Myotis lucifugus V156 iglv AAPE02048156.1 73236 SWAQSVLTQPSSVSGSPGQRVTISCTGSSTNIGVGDYVHWYQQLPGKAPKLLIYQSSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEADYYCLSIETSPAG
Myotis lucifugus V157 iglv AAPE02048156.1 76992 SLSQQPVLTQPPSLSASPGATARLTCTLRSDISVGSYTIYWYQQKPGSRPRYLLYFSSSTSLGSGVPSRFSGSKDASANAGLLTISGLQPEDEADYYCVI
Myotis lucifugus V158 iglv AAPE02048156.1 80461 SWAQSVLTQPSSVSGSPGQKVTISCQGSSSNIGGGNYVNWYQQLPGKAPKLIIYDDSDRESGVPDRFSGSKSANSGTLTITGLQAEDEADYYCESWDDSISG
Myotis lucifugus V159 iglv AAPE02048156.1 84486 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGSYHVSWHQQLPGKAPKLLIYGTSNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCSAWDNSISG
Myotis lucifugus V160 iglv AAPE02048156.1 87810 SWAQSVLTQPSSVSGSPGQKVTISCTGSSTNIGSYHVYWYQQLPGKVPKCIIYYSSSRPSGVPDRFSGSRSGNSCTLTITGLQAEDEADYYCLAWDESLKA
Myotis lucifugus V161 iglv AAPE02048156.1 90790 SWAQSVLTQPSSVSGSLGERVTISCTGSSTNVGRGDYVSWYQQLPGKAPKLLIYDSSKRPTGIPDRFSGSRSGSSASLTVTGLQAEDEADYYCQSYDSSIDG
Myotis lucifugus V162 iglv AAPE02048156.1 93721 SVSAGSLSQPVLTQPPSLSASPGATARLTCTLSSDISVGGKYIYWYQQKPGSPPRFLLYFSSSTNLGSGVPNRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Myotis lucifugus V163 iglv AAPE02048158.1 3741 SLSQPVVTQPPSLSASPGATATLTCTLSSDINVGSYDLRWYQQKPGSPPRYLLYFFSSTRLGPGVPSRFSGSKDVSTNSGLLHISGLQPEDEAEYYCATWDGSYK
Myotis lucifugus V164 iglv AAPE02048158.1 6986 SLSQFVVTQPPSLSASLGATARLTCTLSSDVSIGNKYIYWFQQKPGSPPRYLLRYSSDSYKDQGLGVPSRFSGSKDTSANAGHLLISGLQPEDETDYYCLI
Myotis lucifugus V165 iglv AAPE02048158.1 18423 VDSQTVVTQEASKSVSLGGTVTLTCGLSSGAVSSSNYPSWYQQTPGKPPRTLIYSTNNRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCALDNVGAR
Myotis lucifugus V166 iglv AAPE02048158.1 21899 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAVSTGNYPGWFQQTPGKPPRTVIYETNTRPSGVPDRFSGSISGNKAALTISGAQPEDEAEYYCALHLDGATY
Myotis lucifugus V167 iglv AAPE02048158.1 24850 VDSQTVVTQEPSVSVSAGGTVTLTCGLSSGAVSTGNYPGWFQQTPGKPPRLLIHNTNSRPSGVPARFSGSISGNKAALTISGAQPEDEAHYHCL
Myotis lucifugus V168 iglv AAPE02048159.1 3078 SGVRAGLTQEASLSGSLGQKVTLSCKGNSNNVGARTVGWYQQVTGSAPKTVMLGSSRPSGIPERFSGSKSGNTASLVITGLQPEDEADYYCSTW
Myotis lucifugus V169 iglv AAPE02048159.1 6664 VDSQTVVTQEPSMSVSPGGTVTLTCGLSTGAVSTSNYAGWFQQTRGKPPRQLIYETNKRLSGVPDRFSGSISGNKAALTISGAQPEDEDDYYCG
Myotis lucifugus V170 iglv AAPE02048159.1 9878 VDSQTVVTQEASKSVSPGGTVTLTCGLSSGAVSTSNYAGWFQKTPGKPPRQLMYSTSSRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCALNNVGAV
Myotis lucifugus V171 iglv AAPE02048159.1 12480 SGVRAGLTQEASLSGSPGQKVTLSCKGNSNNVGAYTVGWYQQVTGSAPKTVMLGSSRPSGIPERFSGSKSGNTASLVITGLQPEDEADYYCSTW
Myotis lucifugus V172 iglv AAPE02048159.1 15561 VDSQTVVTQDPSLSVSPGGTVTLTCGLSSGAVSSGNYPSWYQQTPGKPPRPLIYQTNSRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCILYNVGDV
Myotis lucifugus V173 iglv AAPE02048159.1 18836 SGVRAGLTQEASLSGSPGQKVTLSCKGNSNNVGARTVGWYQQVTGSAPKTVMFGSSWPSGIPERFSGSQSGNTASLVITGLQPEDEADYYCSTW
Myotis lucifugus V174 iglv AAPE02048159.1 25973 VDSQTVVTQEPSMSISAGGTVTLTCGLSSGSVSSGNRPCWYQQTPGKPPRTLIYSTNTRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCVL
Myotis lucifugus V175 iglv AAPE02048160.1 3853 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVSSSNYPSWYQQTPGKPPRMLIYQTNNRPSGVPARFSGSISGNKAALTITGAQPEDEADYYCALYNVGAR
Myotis lucifugus V176 iglv AAPE02048160.1 8691 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAISSGNYPSWYQQTPGKPPRQLIYQTNNRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCGLDLGSYV
Myotis lucifugus V177 iglv AAPE02048160.1 13407 VDSQTVVTQEPSMSISAGGTVTLTCGLSSGAVSSGIYPGWYQQTPGKPPRMLIYQTNNRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCVLWMSSSNT
Myotis lucifugus V178 iglv AAPE02048160.1 17059 VDSQTVVTQEPSMSVSVGGTVTLTCGLSSGAVSSGNYPGWYQQTPGKPPRTLIYGTNSRPSGVPDRFSGSISGNKAALTISGAQPEDEADYHCNLYMGSDV
Myotis lucifugus V179 iglv AAPE02048160.1 24824 VDSQTVVTQEPSMSVSAGGTVTLTCGLSSGSVSGKYPAWYQQTPGKPPRTLIYSTNSRPSGVPDRFSGSISGNKATLTISGAQPEDEADYYCGLYMGSYV
Myotis lucifugus V180 iglv AAPE02048160.1 29363 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGTVSSGNYPSWYQQTPGKPPRTLIYGTNTRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCDLWMSSSN
Myotis lucifugus V181 iglv AAPE02048160.1 33027 VDSQTVVTQEPLLSVSAGGTVTLTCGLSSGAVSTGNYPSWYQQTPGKPPRMLIYEANKRPSGVPDRFSGSISGNKATLTISGAQPEDEDDYYCN
Myotis lucifugus V182 iglv AAPE02048160.1 37884 VDSQTVVTQEPSSLSVSAGGTVTLTCGLSSGAISSGNYPSWYQQTPGKPPRMLIYETNKRPSGVPDRFSGSISGNKAALTISGAQPEDEDDYYCALYVGSG
Myotis lucifugus V183 iglv AAPE02048160.1 41718 SRSQAVVTQEPSATVSPGGTVTLTCGSSTGAVTDGHYPYWIQQKPGQVPRTLIYNTDKKHSWTPARFSGSIQGGKAALTLSGAQPEDEAEYFCWLYFSGA
Myotis lucifugus V184 iglv AAPE02048160.1 45143 SRSQAVVTQEPEMTVSPGGTVTLTCGSSTGAVTDGHYPYWFQQKPGQAPRTLIYNTNNRHSWTPARFSGSIQGGKAALTLAGAQPEDEAEYHCWLVYSGA
Myotis lucifugus V185 iglv AAPE02048160.1 47247 ATSQSVIQQSSLITNPGGTVILTCGASTGAAVSTSNYASWIQQKPYQVPKGIIGGTTNRVPGVPVRFSGALAGGKATLTITGAQPEDEAEYYCALWFSNH
Myotis lucifugus V186 iglv AAPE02048161.1 12019 SWAQAPLTQPPTVSGTPGSSVTISCAGSSNDIGKYNYVSWYQHRTGTAPKLLIYDVSSRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYRYISS
Myotis lucifugus V187 iglv AAPE02048163.1 2160 SWAQAPLTQPPSVSGTPGTSVTISCAGSSNDIGYYNYVSWYQQRPGTAPKLLIYYVSSRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYAGS
Myotis lucifugus V188 iglv AAPE02048163.1 6293 SWAQAPLTQPPSVSGTPGTSVTISCAGSSSDVGGYNRVSWYQQHPGTAPKLLIYDVSTRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYTSS
Myotis lucifugus V189 iglv AAPE02048163.1 9061 SWAQAPLTQPPSVSGTPGSSVTISCAGSSNDIGSYSYVSWYQHRPGTAPKLLIYDVSTRPTGIPERFSGSKSGNTATLTITGLQAEDETDYYCCSYTTS
Myotis lucifugus V190 iglv AAPE02048164.1 193 SWAQAPLTQPPAVSGTPGTSVTISCAGSSNDIGRYNLVSWYQQRPGRAPKLLIYDVSTRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYAGS
Myotis lucifugus V191 iglv AAPE02048164.1 2965 SWAQAPLTQPPSVSGTPGRSVTISCAGSSNDIGSYSYVSWYQHRPGTAPKLLIYDVSTRPTGIPERFSGSKSGNTATLTITGLQAEDETDYYCCSYTTS
Myotis lucifugus V192 iglv AAPE02048164.1 6709 SWAQAPLTQPPSVSGNPGTSVTISCAGSSNDIGRYNYVSWYQHRMGTAPKLLIYYDSSRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYTSS
Myotis lucifugus V193 iglv AAPE02048165.1 1703 SWAQAALTQLPSVSGNMGQSVTLSCVGSSNDIGRYNYVSWYQQRPGTAPKLLISYVNARHSGVPERFSGFKSSNTAFLLISGLRAEDEADYHCFSYVGS
Myotis lucifugus V194 iglv AAPE02048166.1 425 SWAQAPLTQPPSVSGTPGTSVTISCAGSSNDIGRYNLVSWYQQRPGRAPKLLIYDVTKRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYRSG
Myotis lucifugus V195 iglv AAPE02048166.1 6574 SWAQAPLTQPPSVSGTPGSSVTISCAGSSNDIGRTSGVSWYQQRPGTAPKLLIYSVSSRPSGIPERFSGSKSGNTATLTISGLQAEDEADYHCCSYAGS
Myotis lucifugus V196 iglv AAPE02048168.1 6191 PAASSEVTQPPAVSVGLGQTTTITCQGDLVKKYYPMWLQQKPGQAPMLVIYDDENRTSTIPERFSCSDSGDTSTLTITGAQAQEDADYYCSVWDKNAK
Myotis lucifugus V197 iglv AAPE02048168.1 9209 LCAAPVLTQPPSASASPGASAKLTCTLSQEHSKYIIDWYQQRPGQAPRFIMQLKSDGSHTKGDGIPNRFSGSSSGADRYLTISNLQSEDEAEYICGVDY
Myotis lucifugus V198 iglv AAPE02048168.1 13167 SVASYELTQSGPLSVAPGGTVSITCSGDLLDKKYTSWHQQKPGQAPVAVIYKDSERPSGIPDRFSGSSSGKTNTLTISGVLAEDEADYYCQSWDSSNS
Myotis lucifugus V199 iglv AAPE02048168.1 22107 SLASQELTQSGPLSVAPGGTASITCTGDFLDKRYTYWYQQKPGQAPVQVIYKDSERPSGIPDRFSGSSSGKTVTLTISGARAEDEADYYCQSSTSDDN
Myotis lucifugus V200 iglv AAPE02048168.1 25376 PVASSGVTQPPAVSVAPGQTARITCQGNPLTKYYPMWLQQKPGQAPVLVIYGNNNRPSGIPERFSSSYSGDTNTLTISGAQAQDEADYYCVVWAYSAN
Myotis lucifugus V201 iglv AAPE02048168.1 28124 LCADPVLTQPPSASAALGASAKLTCTLSAEHSNYFIHWYQQRPGQALRYLMKVNSDGSHTKGDGIPDRFSGSSSGADRYLTISNLQSEDEADYYCGVPYGSG
Myotis lucifugus V202 iglv AAPE02048169.1 1888 PVASSEVTQPPAVSVALAQTARITCQGELVKKAYPVWLQQKPGQAPVLVVYNDKNRTSTIPERFASSFSGDTETLTISGAQAQDEADYYCSVWDGSAN
Myotis lucifugus V203 iglv AAPE02048169.1 4651 LCADPVLTQPPSASASPGASAKLTCTLSAEHSTWYINWYQQSPGQAPRYLMKVNSDGSHTKGVGIPDRFSGSSSGADRYLTISNLQSEDEADYYCGVPYGSY
Myotis lucifugus V204 iglv AAPE02048169.1 8587 PVASSDLTQPPAVSVALGQSARITCQGDLVTKVYPRWFQQKPGQAPVLLIHGDENRTSTIPERFSSSMSGDTDTLTISGAQAQDEADYYCSAWDDSAK
Myotis lucifugus V205 iglv AAPE02048169.1 12080 LCADPVLTQPPSASAALGASAKLTCTLSAEHSGYYIHWYQQRPGQAPRYLMKVTSGGSHTKGDGIPDRFSGSSSGADRYLTISNLQSEDEAEYYCGVPYGGGNY
Myotis lucifugus V206 iglv AAPE02048169.1 15512 PVASSGVTQPPAVSVAPGQMARITCQGNPITQYYPSWLQQKPGQAPVVVIYGNNERPSGIPERFSDSYSGDTNTMTISGVQAQDEAEYYCVVWDNSAE
Myotis lucifugus V207 iglv AAPE02048169.1 18256 LCALPVLTQPPSASAALGASAKLTCTLRAEHSNYFIRWFQQRPGQAPRNLMRVNSDGSHTKGDGIPDRFSGSSSGADRYLTISNLQAEDEGEYYCG
Myotis lucifugus V208 ighv AAPE02052254.1 32837 VQCEVQLVESGGGLVQPGGSLRLSCAASGLTFSSTWMVWVRQAPGKGLEWLCRVNPDGSTTNYANSVKGRFTISRDNTKNMLHLQMNSLRAEETAIYYCSR
Myotis lucifugus V209 ighv AAPE02052254.1 29284 VLSQVQLREWGPGQVKSSQTLSVTCADHGVSITTSGYFWSWIRQPPGKGLEWMGCICHDGSTYYNPFLKIRTSISRDTSKNQVSLQLSSVTTDDTAVYYCAR
Myotis lucifugus V210 ighv AAPE02052254.1 4574 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMYWVHQVPGKGLEFVAVIWNDGSQKYYADSLKGRFTISRDNNKNTLYLQMNSLKAQDTAMYYCA
Myotis lucifugus V211 ighv AAPE02052255.1 61071 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWLNWVRQAPGQGLEWMGRVNPNNGDTNYAQKFQGRVSITRDTSINTAYMELSSLRVEDTAVYYCTT
Myotis lucifugus V212 ighv AAPE02052255.1 44897 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYAVQWTRQAPGKGLEWVGGIWGNGDTYYSPTVKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V213 ighv AAPE02052255.1 39757 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGEVNPNNGNTKYAQKFQGRVSMTRDTSTSTAYMELSSLRAEDTAMYYCAR
Myotis lucifugus V214 ighv AAPE02052255.1 16631 GLCQVQLVDSWGSVVPPGGYMSLSCKASGFTFTDYTMNWVRQAPGKGLQWVARVSQPTGKDQWYAPAVQGRFTISRDNPTSTVSLNMTKLTSEDTAVYYCT
Myotis lucifugus V215 ighv AAPE02052255.1 5445 VHSQVQLVQSGAEVRKPGASMKVSCKASGYTFTSYWMQWVRQAPGEGLEWMGEANPNNGNTNYAQKFQGRVSMTRDTSTSTAYMELSSLRAEDTAMYYCAR
Myotis lucifugus V216 ighv AAPE02052259.1 12248 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYHMTWVRQAPGKGLEWVAIIWNDGSQKYYADSVKGRFTISRDNAKNTLYLQMSSLRAQDTAVYYCAR
Myotis lucifugus V217 ighv AAPE02052262.1 2560 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITTSDYRWNWIRQPPGKGLEWIGGIRYDGDIKYSPSLKSRTSISRDTSKNQFSMQLSSVTTEDTALYYCG
Myotis lucifugus V218 ighv AAPE02052273.1 9126 VQCDVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGEGLEWVSLINPAGSSTYYANSVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCSR
Myotis lucifugus V219 ighv AAPE02052273.1 1249 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSNWMHWVRQAPGKGLEWLCRINPDGSTTNYANSVKGRFTISRDNAKNMLYLQMNSLRAEETAMYYCA
Myotis lucifugus V220 ighv AAPE02053033.1 20736 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYPVNWIRQAPGKGLEWDGAMGISGGTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V221 ighv AAPE02053033.1 13302 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTRYLMHWVRQAPGQGLEWVGSVLPLLGSTNYAQKFQGRVSITGDKSTSTAYMELSSLRADDTAVYYCAR
Myotis lucifugus V222 ighv AAPE02053033.1 10557 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYYWSWIRQPPGKGLEWMGRISSGGSTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V223 ighv AAPE02053033.1 5872 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVAYQYISSDGRNYINYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V224 ighv AAPE02053033.1 2769 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTTYSYWNWIRQPPGKELEWIGRIDYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTAEDMAMYYCAR
Myotis lucifugus V225 ighv AAPE02053036.1 5293 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITTSGYSWNWIRQPPGKRLEWIGEIYNDGSTYYSPSLKSRTSISRDMSKNQFSLQLTSMTTEDTATYYCAR
Myotis lucifugus V226 ighv AAPE02053037.1 42803 VLSQVQLQESGPGLVKPTQTLSLTCSVSGYSITSGYDWSWIRQPQGKGLEWIGYITYDGRTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V227 ighv AAPE02053037.1 38688 VLSQVQLQESGPGLVKPSQTLSLTCTASGFSLTSYGVHWIRQAPGKGLEWVGVMFGGGSTDYNPTLKSRLSITRDTSKSQVYLTLNNLRAEDTAVYFCAR
Myotis lucifugus V228 ighv AAPE02053037.1 31236 VLSQVQLQELGPGLVTPSQTLSLTCSVSGFSITTSGYRWSWIRQPSGKGLEWIGYISYDGNIYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCER
Myotis lucifugus V229 ighv AAPE02053037.1 23069 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSDYRMNWVRQAPGKGLEWVAYTSYGDGNPIHYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V230 ighv AAPE02053037.1 16424 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWIRQAPGKGLEWVGGVWYDGSTHYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYFCAR
Myotis lucifugus V231 ighv AAPE02053037.1 11060 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRVDPEDGETKYAQKFQGRVSITGDTSTSTAYMELSSLSADDTAMYYCAS
Myotis lucifugus V232 ighv AAPE02053037.1 7273 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSAISGNGGSTYYAASVKGRFTISRDNTKNSLYLQMSSLRAEDTAVYYCA
Myotis lucifugus V233 ighv AAPE02053038.1 15547 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQTPGQGLEWVGWVDPSDGEANYAQKFQGRVSITRDMSRSTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V234 ighv AAPE02053038.1 12154 VLSQVQPQLQESGPGLVKPSQTLSLTCSVSGGSVTSSKYWNWIRQPPGKGLQWMGWWSGSTSYKPAFQGRISITADTARNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V235 ighv AAPE02053038.1 3498 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYWWSWIRQPPGKRLEWIGEIYNDGSTYYIPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAMYYCA
Myotis lucifugus V236 ighv AAPE02053042.1 18453 VQSQVQLQESGPGLVKPSQTLSLTCTVSEFSITTTYYYWSWFRQPPGKGLEWIGYIRYEGNAYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDSAVYYCT
Myotis lucifugus V237 ighv AAPE02053042.1 3352 VHSQVQLVQSGAEVRKPGASVKISCKASGYTFTSYWMYWVRQAPGQGLEWVGTFDPGDGNTKYAQKFQGRVSITGDKSTSTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V238 ighv AAPE02053043.1 9346 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSNYYWSWIRQAPGKGLEWMGSISYDGYTYYSPSIKSRTSISRDMSKNHFSLQLSSLTTKDMALYYCA
Myotis lucifugus V239 ighv AAPE02053043.1 5799 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYHVHWIRQAPGKGLEWVGVMWNGGGTDYNLTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYFCAR
Myotis lucifugus V240 ighv AAPE02053044.1 17692 VQCEEQLVESGGGVVHPGGSLRLSCAASGFTFSSYEMSWVRQAPGKGLEWVSAISSGGSNTYYAAAVKGRFTISRDNAKNSLHLQMNSLRAEDSAVYYCAR
Myotis lucifugus V241 ighv AAPE02053044.1 2313 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVALISNGGSTYYANSVKGRFTISKDNGKNSLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V242 ighv AAPE02053045.1 10486 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFRSYGMNWVRQAPGKGLEWVSPISTGGGSTYYADSVKGRFTISRDNGKNMLYLQMSSLRAEDTAMYYCAR
Myotis lucifugus V243 ighv AAPE02053045.1 2242 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVAYISTGGSTYYANAVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCA
Myotis lucifugus V244 ighv AAPE02053050.1 3986 VLSQVQLQESGPGLVKPSQTLSLTCSVSGSSITTNGYCWGWIRQPPEKGLEWMGRICSSGDTAYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V245 ighv AAPE02053052.1 11944 VQCEEQLVESGGGLVQPGGSLRLSCAATGFSFSSYWMGWVCQAPGKGLEWVALISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCV
Myotis lucifugus V246 ighv AAPE02053052.1 6412 VHSQVQLVQSGAEVRKAGASVKVSCKASGYTFIDYLMHWVRQAPGQGLEWMGWVDPEDGETNYAQKFQGRVSITGDTSTSTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V247 ighv AAPE02053052.1 3442 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWKGRIYPGNGDTKYAQKFQGRVSMTRNTSTSTAYMELSSLRAEDMAVYFCAR
Myotis lucifugus V248 ighv AAPE02053056.1 34606 VQCEEQLVESGGGLVQPGGSLRLSCAATGFTFSSYWMHWVRQAPGKGLEWVSLISSDGSSYIYYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V249 ighv AAPE02053056.1 30946 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYPVHWMRQAPGKGLEWVGVVWGGGSIYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V250 ighv AAPE02053056.1 26269 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGWVYPGSGNTNYAQKFQGRVSMTRDTSTSTAYMELSSLRAEDTAMYYCAR
Myotis lucifugus V251 ighv AAPE02053056.1 23353 ALSQVQLQESGPGLVKPSQTLSLTCSVSGYSISSGYYWSWIRQPPGKGLEWIVSKHSSGTTYYSPSLKSRTSISIDTSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V252 ighv AAPE02053056.1 9692 VLSQVQLRESGPGLVKPSQTLSLTCTVSGFSITTSGYRWSWIRQPPGKGLEWMGDIRSGRDTYHSPSLESRTSISRDTSKNQFSLQLSSMTTEDTAMYYCAR
Myotis lucifugus V253 ighv AAPE02053056.1 2550 VHSQVQLVQSGAEVRKPGASMKISCKASGYTFTDYWMHWVRQAPGQGLEWVGRVNPSNGDTNYAQKFQGRVSITRDTSTSTAYMELSSLIAEDMAVYYCAR
Myotis lucifugus V254 ighv AAPE02053286.1 13108 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITTGYYWSWIRQPPGKGLEWIGYISSSGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAMYYCAR
Myotis lucifugus V255 ighv AAPE02053286.1 7210 VQCEEQLVESGGGLLQPGGSLRLSCAASGFTFSDYRMNWVRQAPGKGLEWVSYISSPSGSSYIYYAASVKGRFTISRDNAKNTLYLQMSSLRPEDTAVYYCAR
Myotis lucifugus V256 ighv AAPE02053286.1 2461 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQATAQGLEWIGRVDPSDGETNYAQKFQSRVSITVDKSTSTAYMELSSLRAEDTAVYYCAR
Myotis lucifugus V257 ighv AAPE02053714.1 4810 GLCQVQLVESGGGVVPPGGSLSLSCKASGFTFTNYNMHWVRQAPGKGLQWVARVSYPTGDTQWYAPEVQGRFTISRDNPTSTVSLKMTKLTSEDTAVYYCT
Myotis lucifugus V258 ighv AAPE02053714.1 1227 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYSMNWVRQSPGKGLQYMGWINTETGKPTYAQGFSERFVFSMDTSVSTAYMQINGLKSEDTAVYYCA
Myotis lucifugus V259 ighv AAPE02053715.1 1168 VLSQVQLQESGPEPVKPSQTLSLTCTVSGFSLTSDGVHWTLQAPGKGLEWVGAVWTDGSTSYNTTLKSRLSMTRDTSKSQVYLTLNSMRADDTAMYYCAR
Myotis lucifugus V260 ighv AAPE02053716.1 71091 VQCEVHLVESGGGLVQPGGSLRLSCAASGFNFSSYWMSWVRQAPGKGFEWLGIISTDAGTTNYADSVKGRFTISRDNAKNTLYLQMKSLTAKDTSMYYCA
Myotis lucifugus V261 ighv AAPE02053716.1 34512 AAGGVWGGLVQPGGSLRLSCAASKFTFSSSGMNWVHQVPGKGLEWVAGVSSIGGTTYYADSVKGRFTVSRDNTKNTLYLQMNSLRTEDVAVYYCAR
Myotis lucifugus V262 ighv AAPE02053716.1 27747 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWTHWALQAPGKGLEWVSIINPDESSTYYANSVKGRFTISRDNAKNMLYLQMNSLRAEDTAMYYCAR
Myotis lucifugus V263 ighv AAPE02053716.1 20747 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSNSMNWVRQAPGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNAKNMLYLQMNSLRAEDTAMYYCAR
Myotis lucifugus V264 ighv AAPE02053716.1 14307 VLSQVQLQESGPGLVKPSQTCSLTCTVSGFTGPARLQERGWSGSGLYGLMEAQTITFPLKSRLSLTRDTSKSQVYLTLNSLSAEDTAMYYCV
Myotis lucifugus V265 ighv AAPE02053718.1 43202 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFRSYGMSWIRQAPGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNDKNTLYLQMNSLGSQDMAIYYCVR
Myotis lucifugus V266 ighv AAPE02053718.1 4107 GLCQVQLVESGGGVVPPGGSLSLSCKASGFNFTDYQMHWVRQAPGKGLQWMAGVSYPTGKDQWYAPAVQGRFTISRDNPKSTVSLKMTKLTSEDTAVYYCT
Myotis lucifugus V267 ighv AAPE02053720.1 2444 VQCEVQLVESGGGLVHPGGSLRLSCAASGFTFSSSGMNWVRQAPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNAKNMAYLHMNSLRAEDTAMYYCTA
Myotis lucifugus V268 ighv AAPE02055530.1 42165 ALSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYYWDWISKPPGKGLEWIAEICYEGSTYYSPSLKSRTSISRDTSKNQFFLQLSSTTTEDMAVYYCA
Myotis lucifugus V269 ighv AAPE02055530.1 39817 VQCEEQLVESGGGLVLPGGSLRLSCAATGFTFSSYYMNWVRQAPGKGLEWVARISEGSSYIYYADAVKGHFTISRENAKNMLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V270 ighv AAPE02055530.1 27210 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTTYSNWNWIRQAPGKGLEWMGHIDYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTAEDTAVYYCAR
Myotis lucifugus V271 ighv AAPE02055530.1 21883 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVALISSGSGGSTYYADSVKGRFTISRDNTKNSLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V272 ighv AAPE02055530.1 17835 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGWVDPGNGNTNYAQKFQGRVSMTRDTSKSTAYMEVSSLRAEDTAMYYCA
Myotis lucifugus V273 ighv AAPE02055530.1 13334 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVHQAPGKGLEWVAYHYISSDGSSYIYYAASVKGRFTISRDNAKNMLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V274 ighv AAPE02055530.1 9404 VLSQVQLQKSSPGMVKPLQTLSLTCSVSGFSIKTSGYRWSWIRQFPRKGLESIGEIYNDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAMYYCAR
Myotis lucifugus V275 ighv AAPE02055530.1 646 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSEYGMNWVRQAPGKGLEWVSYISGDSSSDIYYAASVKGRFTISRDNAKNMVYLQMNSLRAEDTALYYCVR
Myotis lucifugus V276 ighv AAPE02055620.1 46916 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVQQAPGEGLEWVGRINPSNGNTNYAQKFQGRVSITGDTSTSTAYMDLSSLRAEDMAVYYCA
Myotis lucifugus V277 ighv AAPE02055620.1 42344 VQCEEQLVESGGGLVQPGGSLRLSCAASGFSFRSYPMNWVRQAPGKGLEWVALISSGRDGNTYYATSVKGHFTISRDNAKNSLYLQMGSLRSDDTALYYCA
Myotis lucifugus V278 ighv AAPE02055620.1 38591 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVNWIRQAPGKGLEWVGIMWGGGSTDYNPTLKSRLSITRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V279 ighv AAPE02055620.1 30652 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVARISSGSGRSTYYANSVKGRFTISRDNTKNALYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V280 ighv AAPE02055620.1 27557 VQCEVQLVESGGGLVQPGGSLRLSCAGSGFTFSSYSMDWVRQAPGKGLEWVAYISSASSTIYYANSVKGRFTISIDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V281 ighv AAPE02055620.1 13802 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMHWVRQAPEKGLEWVALISGGSTYYADSVKGRFTISRENAKNSLYLQMSSLRAEDTAVYFCAR
Myotis lucifugus V282 ighv AAPE02055620.1 8937 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGMVFALLEITNYAQKFQGRVSITEDMSRSTAYMEISSLKAEDTAVYYCAR
Myotis lucifugus V283 ighv AAPE02055620.1 3032 VQCEVQLVESGGGLVPPGGSLRLSCSGSGFTFSSYSMDWVRQAPGKGLEWVAYISSASNTIYYANSVKGRFTISIDNAKDTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V284 ighv AAPE02055621.1 44249 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSITTSGYAWDWDCQTPGKGLEWMGHICYEGNTSYSPSLKSRTSISRDISKNQFSLQLSSMTAEDTALYYCV
Myotis lucifugus V285 ighv AAPE02055621.1 39934 VLSQVQLQELGPGLVQPSQTLSLTCSVSGFSITTSGYRWSWIRQPPGKGLEWIGEIYNDGSTYYSPSIKSRTSISRDTSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V286 ighv AAPE02055621.1 25190 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYDWNWIRQPPGKGLEWIGYISYSGGTYYSPSLKSRTSISRDTSKNQFSLQLNSVTTEDSAVYYCA
Myotis lucifugus V287 ighv AAPE02055621.1 16590 RGEETTAQAHSPYPLPHLHCLWLLHHQWLLELDLAAPGKGLEWMGYICYEVSTSYSPSLKSRTSISRDTSKNKFSLQLSPVTTEDMAVYYCA
Myotis lucifugus V288 ighv AAPE02055621.1 11626 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMDWVRQAPGKGLEWVAYISSASSTIYYANSVKGRFTISRDNAKNMLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V289 ighv AAPE02055621.1 8601 VQCEEQLVESGGGLVLPGGSLRLSCAATGFTFSSYWMHWVRQVPGKGLEWVSLISSDGSSYIYYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V290 ighv AAPE02055621.1 4951 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYPVHWMRQAPGKGLEWVGAMWSGGSTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCA
Myotis lucifugus V291 ighv AAPE02055893.1 4197 VQSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSGYYWSWIRQPPGKGLEWIGYITYGGRTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V292 ighv AAPE02055894.1 3438 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSGYYWNWIRQPPGKGLEWIGYIGSGGSTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAVYYCA
Myotis lucifugus V293 ighv AAPE02055896.1 23584 VLSQLQLQESGPGLVKPSQTLSLTCTVSGGSVTSSDYWSWIRQPPGKGLQWMGYWTGSTRYNPAFQGRISITADTARNQFSLQLSSVITEDTAMYYCA
Myotis lucifugus V294 ighv AAPE02055896.1 20623 AAGGVCGRPGAAWGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVALISSTGITIYYAASVKGRFNISRDNAKNTLYLQRSSLRADDMALYYCAR
Myotis lucifugus V295 ighv AAPE02055896.1 6258 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSNYRMNWVRQAPGKGLEWVAYTSYGDGNPISYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V296 ighv AAPE02055896.1 1491 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGRVDPSDGETNYAQKFQSRVSITVDKSTNTAYMELSSLRAEDTAVYYCAR
Myotis lucifugus V297 ighv AAPE02055898.1 11204 VLSQVQLQELGPGLVKPSQTLSLTCSVSGFSITTSGYAWSWIRQPPGKGLEWMGNIWDNGNTYYSPSLKSRTSISRDTSKNQFSLQLSSISTEDTAVYYCA
Myotis lucifugus V298 ighv AAPE02055898.1 6597 VQCEVQLVESGGGFVQPGGSLRLSCAASGFTFDDYYMHWIRWAPGKGLEWVSANSGGGSSKYTNSVKDHITISRDNAKNTLYLQMNSLRAEDTSVYYCA
Myotis lucifugus V299 ighv AAPE02055898.1 3761 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYWWSWIRQPPGKGLEWIGFITYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTDVYYCAR
Myotis lucifugus V300 ighv AAPE02055899.1 4157 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWDWIRQPPGKGLEWIAVICYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTAEDMAMYYCAR
Myotis lucifugus V301 ighv AAPE02055900.1 10115 ALSQVQLQESGPGLVQPSQTLSLTCSVSGYSITSGYCWYWIRQPPGKGLESMGRIPYDGYTDYSPSLKSRTTISRDTSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V302 ighv AAPE02055900.1 4990 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWVRQAPGKGLEWVSLISPSGGSTYYADSVKGRFTISRDNAKNMVYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V303 ighv AAPE02055901.1 552 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGSYTMHWVRQAPGKGLEWISRISSSGGTISYAESVKGRFTISRDNTKNTLSLQMSSLRAEDSAVYYCA
Myotis lucifugus V304 ighv AAPE02055904.1 3576 VHSQVQLVQSGAELRKPEASVKISCKASGYTFTSYNMDWVRQAPGQGLEWMGWVYPGDGDTNYAQKFQDRVSMTRDTSTSTAYMELSSLRAEDTAVYYCT
Myotis lucifugus V305 ighv AAPE02055905.1 25552 VQCEEQLVESGGGLVLPGGSLRLSCAASGFTFSSYDMNWVRQAPGKGLEWVASISSGSSYIYYGDAVKGRFTISRDNTKNTLYLQMSSLRTEDTAVYYCAR
Myotis lucifugus V306 ighv AAPE02055905.1 21163 VLSQVQLQESGPELVKPSQTLSLTCSVSGFPITTSGYCWNWIRQPPGKGLQWMGCIRYDGNTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTEDMAVYYCAR
Myotis lucifugus V307 ighv AAPE02055905.1 17029 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWIRQAPGKGLEWVGGVWYEGSTHYNPALKSRLSITRDTSKSQVYLTLNSLRAEDTAVYFCAR
Myotis lucifugus V308 ighv AAPE02055905.1 12036 VHSQVQLVQSGAEVRKPGASVKVSCMVLDTPSPVTTHWVRQAPGQGLEWMGRVDPGDGNTNYAQKIQGRVSMTRDTSTSTVSMELSSLRAEDTAVYYCA
Myotis lucifugus V309 ighv AAPE02055905.1 1941 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMNWVRQAPGKGLEWVAYINSGGGSTYYSNSVKGRFTISRDNAKNKLYLQMNSLKAEDTAVYYCAR
Myotis lucifugus V310 trav AAPE02056765.1 7146 SSVAQKVTQPQQEMSVQEKETATLACTYDTSESNYYLFWYKQPPSGEMIFIIRQEAFKQQNATDHRFSVNFQKATKNFSLRISDCQLEDAAVYFCALRG
Myotis lucifugus V311 trav AAPE02056768.1 17114 PGGADWINSQETEVSAMEGKSVTLLCNYGTSSSVAVVLYWFRQYPNQAPEFILYRGWGYSGKGDAGFATGKFYSKSTANATTLYIGKLKFADTARYHCALRK
Myotis lucifugus V312 trav AAPE02056768.1 7140 SGGADWINSQETEVSAMEGKSVTLLCNYGTSSRGAVDLHWFRQYPNQAPEFILYRGWGYSGKGDADFATGKFYSNSTANATNLYIGKLKFADTARYHCALRK
Myotis lucifugus V313 trav AAPE02056769.1 16785 PGGADWIKSQEIEVSATEGKSVTLLCNYGTSSRGTVDLYWFRQYPNQAPEFILYRGWGYPGNGDADFATGKFYSKSTANATTLYIGKLKFADAAQYHCALRK
Myotis lucifugus V314 trav AAPE02056769.1 8150 PGGADWINSQETEVSVMEGKSVTLLCNYGTSSRGTVDLYWFRQYPNQGPEFILYRWWGYPGKGHADIGTEKFYSKSTADVTILYIGKLKFADTARYHCALRK
Myotis lucifugus V315 trav AAPE02056770.1 26624 VSGQQLNQSPQSMSISEGEAISMSCISSSTFNTLLWYKQDAGGGPVLLITLYKGGEFIRNGKLTAQFGGTRKDSLLNISAPELADAGTYFCAG
Myotis lucifugus V316 trav AAPE02056770.1 20951 VYSEDKVLQSPPSLAVHEGDSATLHCRYEVTSFQGLYWYKQKEKATIFLCRLITSGFDSGRIKGTIDKTERLSTLHITATQMEDSATYLCALE
Myotis lucifugus V317 trav AAPE02056770.1 15427 PGGADWINSQETEVSAMEGKSVKLLCNYGTSSRGTVDLYWFRQYPNQGPEFILYRGWGYTGKGDAEFAIGKFYSDSSADTTNLYFRKLEFADTARYHCALRK
Myotis lucifugus V318 trav AAPE02056770.1 5979 PGGADWINSQETEVSAMEGKSVTLLCNYGTSSSVAVDLYWFRQYPNQAPEFILYRGWGYPGKGDADFATGKFYSKSTANATTLYIGKLKFADTARYHCALRK
Myotis lucifugus V319 ighv AAPE02056838.1 44247 VLSQVQLQESGPGLVKPSQTLSLTCTISGLSPRSYGVFWIRQAPGKGLEWVGVLWSSGNTAYNAALKSRLSITSDTSKSQVYLTLNSLRAEDTAVYYCA
Myotis lucifugus V320 ighv AAPE02056838.1 33003 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFAITTTGYVWHWIRQSPGKGLEWMGYIDYDGDTDYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDRAVYYCAR
Myotis lucifugus V321 ighv AAPE02056838.1 24107 VHSQVQLVQSGAEVRKPGASVKVSCKASGSTFTSYWMHWVRQAPGLGLEWMGRVLPLLGITDYTQKFQGGASMTRDMSTSTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V322 ighv AAPE02056838.1 20567 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTTGYAWSWIRQPPGKGLEWMGNIWYDGDTYYSPSLKSRTSISRDTSKNQFSLQLSSISTEDTAVYYCAR
Myotis lucifugus V323 ighv AAPE02056838.1 15980 VQCEVQLVESGGGLLQPGGSLRLSCAASGFTFDDYYMHWIRWAPEKGLQWVSANSGGGSSKYTNSVKDHTTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Myotis lucifugus V324 ighv AAPE02056838.1 13216 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSGYYWSWIRQPPGKGLQWIGYIDYDGDTYYSPSLKSRTSISRDMSKNQFSLQLSSLTIQDTAVYYCAR
Myotis lucifugus V325 ighv AAPE02056838.1 2007 VHSQMQLVQSGAEVRKPGASVKVSCKASGSTFTSYPVHWVRQAPGQGLEWVGIVFPLLEITNYVQKFQGRISITGDTSTNTFYMELSSLRAEDTAMYYCA
Myotis lucifugus V326 ighv AAPE02056839.1 5519 AAAGVGPGLVKPSQTQSLTCSVSGYSITSGYYWYWIRQPPGKGLEWIGYISYSGSTNYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V327 ighv AAPE02056840.1 2552 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQELEWVGRVDPLPGITNYAQKFQGRVSITGDTSTSTAYMELSSLRAEDTAVYYCAR
Myotis lucifugus V328 ighv AAPE02056842.1 2707 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYYMHWVRQAPGKGLEWVSGISYSGGSTYYAESVKGRFTISRDNAKNTLSLQMNSLRAEDTAVYYCAR
Myotis lucifugus V329 ighv AAPE02056843.1 8119 VQCEVQLVESGGALVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLVWVSRIGSDGSSYIHYANSVKGRFTISRDNAKNTLYLQMSSLRSEDTAVYYCVR
Myotis lucifugus V330 ighv AAPE02056843.1 4273 VLSQVQLQESGPGLVKPSQTLSLTCNVSGGSVTSSDYWNWICQPPGKGLQWMGWWSGSTRYNPAFQGHICITADQARNKFSLQLSSVTTEDTAVYYCAR
Myotis lucifugus V331 ighv AAPE02056869.1 50325 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYSVHWIRQAPGKGLEWVGVMWDDGSTDYNPTLKSHLSNTRDTSKSQVYLTLNSLRAEDTALYYCA
Myotis lucifugus V332 ighv AAPE02056869.1 45437 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFISYYMHWVRQAPGQGLEWVGTIHPLLGSTNYAQKFQSRVSITEDTYASTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V333 ighv AAPE02056869.1 29192 GVQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWLRQAPGKGLEWVSLISSDGSSYIYYAASVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYFCAR
Myotis lucifugus V334 ighv AAPE02056869.1 24100 VHSKVQLVQSGAEVRKPGVSVKVSCKASGYTFTSYLMHWVCQAPEQGLEWMGIVNTYSGNTNYAQEFQGRVAMTRDTSTSTAYMELSSLRAEGTAMYYCA
Myotis lucifugus V335 ighv AAPE02056869.1 19603 VQCEELLVESGGGLVQPGGSLRLSCAASGFTFSSYEMNWVRQAPGKGLEWVAYISSDGSSYISYAASVKGRFTISRDNAKNTLYLQMSSLRADDTAVYYCAR
Myotis lucifugus V336 ighv AAPE02056869.1 15836 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSDGVHWIRQAPGKGLEWVGGVWYDGSTHYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V337 ighv AAPE02056869.1 4606 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYWSWIRQPPGKGLEWMGNIWYDSSTYYNPSLKSRTSISRDMSKNQFSLQLSSVTTEDTAIYYCA
Myotis lucifugus V338 ighv AAPE02056870.1 1205 VQCEEQLVESGGGLVQPGGSLRLSCAATGFTFSSYWMHWVCQAPGKGLEWVSLISSDGSSYIYYAASVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V339 ighv AAPE02056872.1 13708 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYAWNWIRQPPGKGLEWIRYIDSGGSTYYSPSLKSRTSISRDTSKNQFFLQLSSVTTEDTAVYYCA
Myotis lucifugus V340 ighv AAPE02056872.1 7636 VQCDVQLVESGGGLAQPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVAYINWNGGSIYYADSVKGRFTISRDNAKNTLYLQMSSLRAEDTALYYCAR
Myotis lucifugus V341 ighv AAPE02057698.1 1212 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSHYMHWVRQAPGQGLEWMGRIYPGSGNTNYAQKFQGRVSITGDTSTSTAYLELSSLRAEDMAVYYCAR
Myotis lucifugus V342 ighv AAPE02057699.1 22259 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYYMHWVRQAPGKGLEWVSGISYSGGSTYYADSVKGRFTISRDNAKNTAYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V343 ighv AAPE02057699.1 19067 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYVWHWIRQPPGKGLEWIARIDYDEDTYYSPSLKSQTSISKDTSKNQFSLQLRSVTTEDMAVYFCA
Myotis lucifugus V344 ighv AAPE02057699.1 14547 FHYQVQLVQSEAEVRKPGASVKVSCKASGYTFTGYAMRWVRQAPGQGLEWVGRIYPGSENTNYAQKFQGRVSITGDTTMSTAYMELSSLRAQDTAVYYCGR
Myotis lucifugus V345 ighv AAPE02057699.1 10501 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYVWDWIRQPPGKGLEWIGIIHNNGATYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V346 ighv AAPE02057699.1 442 VLSQVQLQESGPGLVKHSQTLSLTCTVSGFSLTSYGVHWIRQAPGKGLEWVGVMFGGGSTDYNPTLKSRLSITRDTSKSQVYLTLNRLRAEDTAVYFCAR
Myotis lucifugus V347 ighv AAPE02057702.1 15584 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWVRQAPGKGLEWVSLISPSGGSTYYADSVKGRFTISRDNAKNMVYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V348 ighv AAPE02057702.1 4364 VLSQVQLQESGPGLVKPSQTLSLTCSVSGSSITTNGYCWGWIRQPPEKGLEWMGRICSSGDTAYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V349 ighv AAPE02057703.1 13432 VLSQVQLQESGPGLVKPTQTLSLTCSVSGYSITTGYYWSWIRQPPGKGLEWIGYISSSGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAMYYCA
Myotis lucifugus V350 ighv AAPE02057703.1 3987 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSLTSYDVHWIRQAPGKGLEWVGAVWGGGSTDYNPTLKSRLSITRDMSKSQVYLTLNSMRGEDTAVYFCAR
Myotis lucifugus V351 ighv AAPE02058234.1 14294 VQCEVQLVESGGGLVQPGGSLRLSCAVSGFTFSNYYMNWVGQAPGKGLEWVSLISGSSGSTINYAASVKGRFTCSRDNAKNTLYLQMSSLGAKDTALYYCA
Myotis lucifugus V352 ighv AAPE02058234.1 11144 VLSQVQLQESGPGLVKPSQTLSLTCTVSEFSITTTYYYWSWFRQPPGKGLEWIGYIRYEGNAYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDSAVYYCT
Myotis lucifugus V353 ighv AAPE02058234.1 7607 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYSVHWIRQAPGKGLEWVGVMWDDGSTDYNPTLKSHLSNTRDTSKSQVYLTLNSLRAEDTALYYCA
Myotis lucifugus V354 ighv AAPE02058234.1 2719 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTDYYMNWVRQAPGQGLEWMGWIYPGSGNTYYAQKFQGRVSITGDTSTSTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V355 ighv AAPE02058236.1 9771 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGRVDPSDGNTNYAQKFQGRVSITGDTSTSTAYMELSSLRAEDTAVYYCGR
Myotis lucifugus V356 ighv AAPE02058236.1 5391 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYAWDWIRQPPGKGLEWMGIIYNDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTQDTAVYYCAR
Myotis lucifugus V357 ighv AAPE02058236.1 1536 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSISSGYCWDWIRQPPGKGLEWIAEICSSGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V358 ighv AAPE02058461.1 3086 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSNYYWSWIRQPPGKGLEWIGYIHYNGDSDYSPSLKSPTCISRDTSKNQFSLHLSSVTTEDTAMYYCAR
Myotis lucifugus V359 ighv AAPE02058462.1 16464 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWHWIRQPPGKRLEWIAIICYDGSTNYSPSLKSRTSITRDTSKNQFSLQLSSMTTEDMAVYYCS
Myotis lucifugus V360 ighv AAPE02058467.1 11204 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSRINTGGYTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEDSAVYYCAR
Myotis lucifugus V361 ighv AAPE02058467.1 8618 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYYRNWIRQPPGKGLQWMGYWSGGTSYNPAFQGRISITADTAKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V362 ighv AAPE02058467.1 732 VQCEEQLVESGGGLVPPGGSLRLSCAATGFSISSYEMNWLRQAPGTGLEWVAYVNSGGGSKYYSNSVKGSFTIYRDNAKNSLYLQMNSLRADDTAMYYCAR
Myotis lucifugus V363 ighv AAPE02058468.1 3617 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWSWIRQPPGKGLEWMGYICYNGYTNYSPSLKSRTSISIDTSKNQFSLQLSSVTTKDTTVYYCA
Myotis lucifugus V364 ighv AAPE02059173.1 3095 VQCEVQLVESGGGLVQPRRSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVSFITGNGGSIYYANTAKGRLSISRDNAKNMLYLQMNSLTAEDTAVYYCA
Myotis lucifugus V365 ighv AAPE02059176.1 933 ALSEVKLQESGPALVTPSQTLSLTCTVTGYSITSGYCWSWIRQPPGKGLEWMGRICYDGNLYYTPSLKSRTSISRDTSKNQFFLQLSSVTTEDRAVYYCAR
Myotis lucifugus V366 ighv AAPE02059179.1 5682 VQCEMQLVETGGGLVLPGGSLRLSCAASGFTFSDYWMHWVRQAPGNGLEWVSCISGDGSSYINYTNSVRGRFTISRDNSKNTLYLQMNSLRAKDTALYYCAR
Myotis lucifugus V367 ighv AAPE02059179.1 2771 VLSEAQLQESGPRLVKPLQTLSLTCTVSGLSITTSASCWHWIRQALGKGLEWMGRICSDGSTNYSPSLKSRTSISRDTSKNQFSLQLSLVTTEDTAVYYCMS
Myotis lucifugus V368 iglv AAPE02059633.1 778 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGNNHASWQQQLPGKAPKCIIHSSNTRPSGIPDRFSGSKSGSSGTLTITGLQAEDEAVYYCSAWDDSLKA
Myotis lucifugus V369 ighv AAPE02059925.1 2426 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYPVNWIRQAPGKGLEWVGVMFGGGSTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCA
Myotis lucifugus V370 ighv AAPE02059926.1 9930 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVAYISGGSTYYADSVKGRFTISRDNAKNMLDLEMSSLRTQDTAVYYCAR
Myotis lucifugus V371 ighv AAPE02059926.1 2574 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITTGYCWSWIRQPPEKGLEWIGYICSNGNTYYSPSLKSRTSISRDTSKNQFSLQLSSLTTEDTAVYYCAR
Myotis lucifugus V372 ighv AAPE02059928.1 4731 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFPITTSGYWNWIRQPPGKGLEWMGCIWYDGNTYYSPSLKSRTSISRDTSKNQFSLQLSSLTSEDTAVYYCAR
Myotis lucifugus V373 ighv AAPE02060065.1 7876 VLSQVQLQESGPGLVKPSQTLSLTCSVSGGSVTSSYWWNWIRQPPGKGLQWMGYWTGSTSYNPAFQGRISITADTAKNQFSLQLSSVTTEDTAVYYCA
Myotis lucifugus V374 ighv AAPE02060065.1 3142 VLSQVQLQESGPGLVKPLQTLSLTCTVSGGSVTSSYWWSWIRQPPGKGLEWFGGIWHDGDTNYSPSLKSRTSISIDTSKNQFSLQLSSMTTEDTAVYYCAR
Myotis lucifugus V375 ighv AAPE02060068.1 14870 VLSQVQLQESGPGLVKPSQTLSLTCTVSEFSITTTYYYWSWFRQPPGKGLEWMGYIRYEGNAYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDSAVYYCT
Myotis lucifugus V376 ighv AAPE02060069.1 2445 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWIAYITSGSSTYYANSVKGRFTISRENAKNSLYLQMSSLKAEDTAVYYCAR
Myotis lucifugus V377 iglv AAPE02061323.1 17610 SRSQAVVTQEPSATVSPGVTVTLTCGSSTGAVTDGLYPQWIQQKPGQVLTTLIQNTNKKYSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSSR
Myotis lucifugus V378 iglv AAPE02061323.1 14648 SWAQSVLTQPSSVSGSPGQRVTISCTGSSTNIGKPNSVYWFQQLPEKAPKRIIYEDSKRPSGVPDRFSGSRSGSSASLTITGLQAEDEADYYCLAWDDSIS
Myotis lucifugus V379 iglv AAPE02061323.1 5233 SLSQPVLTQPPSLSASPGATARLTCTLRSDINVGGYRINWHQQKPGSPLRYLLNYHTDSDKGQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Myotis lucifugus V380 iglv AAPE02061323.1 2124 SRSQAVVTQEPSESVVPGVTVTLTCSTNTGEVTSGHYPYWIQQKPGQVPRTLIYDTNKKHSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSRH
Myotis lucifugus V381 iglv AAPE02061649.1 8879 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGSYHVSWHQQLPGKAPKPLIYESSKRPSGIPDRFSGSKSGSSASLTITGLQAEDEADYYCESYDSSING
Myotis lucifugus V382 iglv AAPE02061649.1 4951 SLSQPVLTQPPSLSASPGATARLTCTLRSDISVGSYTIYWYQQKPGSPPRFLLYFSSSTSLGSGVPSRFSGSKDASANAGLLTISGLQPEDEADYYCVIWTSSG
Myotis lucifugus V383 iglv AAPE02061649.1 1497 SWAQSVLTQPSSVSGSPGERVTISCTGSSTNIGDNYVSWYQQLPGKAPKLLIYYNSDRESGVPDRFSGSKSGSSASLTITGLQAEDEADYYCLSYENSIRG
Myotis lucifugus V384 iglv AAPE02061650.1 1173 SWAQSVLTQPSSVSGSPGQRVTISCTGSSSNVGLGYVHWYQQLPGKAPKLLIYDSSKRPSGVPDRFSGSRSGNSASLTITGLQAEDEADYYCSAWDSSLSG
Myotis lucifugus V385 iglv AAPE02061734.1 10828 VDSQTVVTQDPSLSVSPGGTVTLTCGLSSGAVTSGNYPSWYQQTPGKPPRPLIYQTNSRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCILYNVGDV
Myotis lucifugus V386 iglv AAPE02061734.1 7534 SGVRAGLTQEASLSGSPGQKVTLSCKGNSNNVGARTVGWYQQVTGSAPKTVMFGSSRPSGIPERFSGSQSGNTASLVITGLQPEDEAVYYCSTW
Myotis lucifugus V387 iglv AAPE02061734.1 3907 VDSQTVVTQEPSMSVSAGGTVTLTCGLSSGSVSTSNYPGWYQQTPGKPPRMLIYHTNNRTSGVPDRFSGSISGNKAALTISGAQPEDEAEYYCAL
Myotis lucifugus V388 iglv AAPE02061735.1 651 SGVRAGLTQEASLSGSLGQKVTLSCKGNSNNVGTYGVGWYQQVTGSAPKTVILGSSRPSGIPERFSGSQSGNTASLVITGLQPEDEADYYCSTW
Myotis lucifugus V389 iglv AAPE02061736.1 9178 VDSQTVVTQEPSMSISAGGTVTLTCGLSSGAVSTSNYPGWFQKTPGKPPRQLMYSTSSRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCALNNVGAV
Myotis lucifugus V390 iglv AAPE02061736.1 6568 SGVWAGLTQEASLSGSPGQKVTLSCTGSSNNVGARTVGWYQQVTGAAPKTVMLGSSRPSGIPERFSGSKSGNTASLVITGLQPEDEAVYYCSTWDNGIS
Myotis lucifugus V391 iglv AAPE02061736.1 2411 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAVSTSNYAGWFQQTRGKPPRMLIYSTSNRPSGVPDRFSGSISGNKAALTISGAQPEDEDDYYCG
Myotis lucifugus V392 ighv AAPE02062781.1 3315 VQCEEQLVESGGGLVQPGGSLRLSCSASGFTFSEYGMNWVRQAPGKGLEWVSYISGDSSSDIYYAASVKGRFTISRDNAKNMVYLQMNSLRAEDTALYYCVR
Myotis lucifugus V393 ighv AAPE02062781.1 594 VQCEEQLVESGGGLVPPGGSLRLSCAATGFSFSSYPMNWVRQAPGKGLEWVSGISTGGGSTYYAASVKGRFTISRDNAKNSLYLQMNNLRAEDTAVYYCAR
Myotis lucifugus V394 ighv AAPE02062782.1 11158 VLSQVQLQESGPGLVKPLQTLSLTCTVSGYSITSGYCWNWIRQPPGKGLEWIGRICSSGNTYYSPSLKSRTSISRDTSKNQFSLQLSSITTEDTAVYYCAR
Myotis lucifugus V395 ighv AAPE02062782.1 8437 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTTSYYWSWIRQPPGKGLQWMGYWTGSTRYNPAFQGRISITADTSKNQFSLQLSSMTTEDTAMYYCGR
Myotis lucifugus V396 ighv AAPE02062947.1 12578 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYYMHWVRQAPGKGLEWVLADSGGSTYYVNSVKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCAR
Myotis lucifugus V397 ighv AAPE02062947.1 9755 VLSQVQLQESGPGLVKPAQTLSLTCTVSGFSITTSGYAWHWIHQPLGKGLEWIAHIDYDGDTYYSPSLKSRTSISKDTSKNQFSLQLSSVTTEDTAVYYCAR
Myotis lucifugus V398 trbv AAPE02062952.1 17501 HQDAVVTQFPRHRILGTRKELTLECSQNMNHISMYWYRQDPGYGLQLIYYSNGIRTIAKGDVPEGYRVSRSELKYFPLTLESASTNQTSVYFCASSD
Myotis lucifugus V399 trbv AAPE02062952.1 9076 PTEAEVTQTPRHLITETKKQLTVTCSQNMDHELMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYKVSRTEKGNFPLTLESANISQTSLYLCASR
Myotis lucifugus V400 trbv AAPE02062952.1 6543 LMDAEVTQVPRYLIKRKGEKVLMECLQDMDHERMFWYRQDSALGLQLLHFSYGVENYEKGDFPDGYSVSRKKKKGFSLILGTASTNQTSVYLCASSR
Myotis lucifugus V401 trbv AAPE02062952.1 2715 SVFGALLTQRPLRDICQRGTSVTIQCQVDSQVAVMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFPIHRPNLTYSILTVNSVNPEDSSFYFCSAG
Myotis lucifugus V402 iglv AAPE02062954.1 16500 SWAQSVLTQPSSVSGSPGERVTISCTGSSTNIGDNYVSWYQQLPGKAPKLLIYYNSDRESGVPDRFSGSRSGSSASLTITGLQAEDEADYYCESYESSIDG
Myotis lucifugus V403 iglv AAPE02062954.1 10759 SVSAGSLSQPVLTQPPSLSASLGATARLTCTLSSDISVGGKAIHWYPQKPGSPPRFLLYYYTGTNLGPGVPSRFSGSKDASANAGLLTISGLQPEDEADYYCMI
Myotis lucifugus V404 iglv AAPE02062964.1 7185 SLSQPVLTQPPSLSASPGATARLTCTLSSDISVGSYGISWYQQKPGSPPRYLLYYYTSTSLGTGVPNRFSGSKDTSTNTGHLLISGLQPEDEADYYCQV
Myotis lucifugus V405 iglv AAPE02062964.1 4642 SLSQPVLTQPPSLSASPGATARLTCTLSSGSNVGGYRIYWYQQKPGSPPRYLLNYYTSTSLGTGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCQVYDSSA
Myotis lucifugus V406 iglv AAPE02062964.1 2623 SLSQPVLTQPHSLSASPGASARLPCTLSSGAVVAGYHISWYQQKPGSPPRFLLRYKSDSDKGQGSGVPSYFSGTKDASANAGLLLISGLQPEDEADYYCAT
Myotis lucifugus V407 iglv AAPE02062965.1 4985 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAVSTGNYPSWFQQTPGKPPRTVIYETNKRPSGVPDRFSGSISGNKAALTISGAQPEDEAEYYCALHLDGATY
Myotis lucifugus V408 iglv AAPE02062965.1 2027 VDSQTVVTQEPSVSVSAGGTVTLTCGLSSGAVSTGNYPGWFQQTPGKPPRLLIHNTNSRPSGVPARFSGSISGNKAALTISGAQPEDEAHYHCL
Myotis lucifugus V409 ighv AAPE02063012.1 9338 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVAYISSDGSSTYYANSVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Myotis lucifugus V410 ighv AAPE02063012.1 6639 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYWSWIRQPPGKGLEWMGHIWYDGSTYYSPSLKSRTSISRDTSKNQFSMQLSSVTTEDTAMYYCAR
Myotis lucifugus V411 iglv AAPE02063073.1 13643 PVASSEVTQPPAVSVALGQTSRITCQGELITKVNPLWLQQKPGQAPVLVIYGDKNRTSTIPERFSSSWSGDTETLTITGAQAQDEANYYCSMWDNNAK
Myotis lucifugus V412 iglv AAPE02063073.1 10896 LCADPVLTQPPSASASPGASAKLTCTLSAEHSNFDYIHWYQQSPGQAPRFLMYIRSSGSHTKGDGISDRFSGSRSGADRYLTISSLQSEDEAEYYCGAAYGSWS
Myotis lucifugus V413 iglv AAPE02063073.1 4311 PVASSGVTQPPAVSVAPGQTARITCQGNPITQYYPSWLQQKPGQAPVVVIYGNNERPSGIPERFSDSYSGDTNTLTVSGVQAQDEAEYYCVVWDNSAE
Myotis lucifugus V414 iglv AAPE02063073.1 1599 LCADPVLTQPPSASAAPGASAKLTCTLSAEHSGYYIHWYQQRPGQAPRYIMYLKSDGSHTKGDGIPDRFSGSSSGADRYLTISNLQSEDEAEYYCGVPYGSGSY
Myotis lucifugus V415 trav AAPE02063297.1 6660 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASNYFPWYKQEPGKGPQFILGIRSNKDINEDERLTVFLNKAAKHLSLHITATQPGDSAVYFCAAS
Myotis lucifugus V416 trav AAPE02063297.1 1979 SSIAQKVTQGQRAILVQEKEAVSLECTYGTSDPRYSLFWYKQLSSGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALTE
Myotis lucifugus V417 ighv AAPE02063416.1 16581 VLSQVQLQESGPGLVKPSQTLTLTCSVSGFSITTSGYSWSWIRQFPRKGLEFIGEIYNDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAMYYCA
Myotis lucifugus V418 ighv AAPE02063416.1 4121 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWNWIRQPPGKGLEWMGSICSGGDTYYMPSLKSRTSISRDTSKNQFYLQLSSMTTQDTAVYYCAR
Myotis lucifugus V419 iglv AAPE02063753.1 12959 SWAQSAVTQPSSVSGSLGERVTISCTGSGNNIERGNYVSWHQQLPGKAPKCIIYGTSSRPSGIPDRFSGSRSGSSASLTITGLQAEDEADYYCSTW
Myotis lucifugus V420 iglv AAPE02063753.1 5642 SWAQSVLTQPSSVSGSPGQRVTISCTGSSTNVGYGDYVSWFQQLPGKAPKLLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEAVYHCS
Myotis lucifugus V421 iglv AAPE02063753.1 2300 SWAQSVLTQPPSVSGSLGERVTISCSGSSTNVGGNGVEWYQQVPRKAPKLLIYDNSNRPSGISDRFSGSRSGSSGTLTITGLQAEDEADYYCSAWD
Myotis lucifugus V422 trbv AAPE02063949.1 5292 TVAAGITQSPRHIIKGRGGKAILKCQPISGHRSVYWYQQTLGHGPQFLISLYEKEEEQKGNIPDRFSAKQFSDYSSELAMSALQLGDSAVYLCASSL
Myotis lucifugus V423 trbv AAPE02063950.1 7439 SVAAGVTQSPRHIIKVQGGKAVLKCHPISGHSNVYWYQQALGHGLEFLISFYEKQDGHKGNIPDRFSGKQLNNYSSELTLSTLQLGDSAVYLCASSL
Myotis lucifugus V424 trbv AAPE02063950.1 2755 NLDARITQSPRYKVVGTEKNVTLNCHQTNNHGVMYWYRQDLSHELTLIYYSVGAGITAKGDGADGYSVSRSNTKNFALTLESETPSQTSVYFCASSE
Myotis lucifugus V425 trbv AAPE02063950.1 1568 HTDAGVSQSHRHIVTERGQNVTLRCDPISGHSFLYWYRQMLGQGPEFLLYFQNKNPLDTSGIPNKRFFAERPDGSYSTLTIQRAEQGDSAVYFCASSL
Myotis lucifugus V426 ighv AAPE02064168.1 6826 VQCEVQLVESGGSLVQPGGSLRLSCAASGFTFRSYWMHWVHQAPGKGLQWVSHINPDGSGSYYADFVKDQFTTSRENAKNMLYLQMNSLRAEEMALYYCARET
Myotis lucifugus V427 ighv AAPE02065147.1 5121 GLCQVQLVESGGGVVPPGGSLSLSCKASGFTFTNYSINWVRQAPGKGLQWVAEVSYPTGKDQWYAPAVQGRFTISRDNPKSTVSLKMTKLTSEDTAVYYCT
Myotis lucifugus V428 trav AAPE02066554.1 4060 VTNGDSVTQTEGPVTLTEGASVILNCNYQTTYSAPYLFWYVQHRNKAPSLLLKSSTEHQTAEHEGFQAKLVKSDSSFHLEKSSLQMSDSAVYYCALR
Myotis lucifugus V429 trbv AAPE02066733.1 5603 HTDAGVSQSPRHIVTERGQDVALRCDPISGHSVLYWYQQTLGQGPEFLLYFQGKNGPYTSGMPKERFSAERPDGSYSTLKIQRAEQGDSAVYLCASSL
Myotis lucifugus V430 ighv AAPE02069152.1 1750 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGTFHPLHEITNYAQKFQGRVSITEDTYASTAYMELSSLRAEDTAVYYCA
Myotis lucifugus V431 trav AAPE02069243.1 3128 SSVAQKVTQPQQEMSVQETETATLACTYDTSGTDYYLFWYKQPPSGEMIFIIRQEAFKQQNATDHRFFVNFQKATKNFSLRISDCQLEDAAVYFCALRG
Myotis lucifugus V432 ighv AAPE02069640.1 4846 VLSQVQLQESGPGLVKPSQTHSLTCTVSGFSLTSNRVHWIRQASGKGLEWVGVLWSSGNTAYNAALKSRLSITRDTSKSPIYLTMNSLKAEDTALYYCAR
Myotis lucifugus V433 iglv AAPE02071561.1 2762 SWAQSVLTQPSSVSGSPGQRVTISCTGSSSNIGGDYVSWYQQLPGKAPKLLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEADYYCS
Myotis lucifugus V434 trav AAPE02015068.1 55159 RIHGDSVTQTKGQVTLSEGAPLTVNCSYETILFPALFWYVQYPGEGPQLLLTATMVNESGSSKGFVATYQKQPDAFHLEKASVHQSDSAMYYCALG
Myotis lucifugus V435 trav AAPE02015068.1 50479 GVTGMNVEQSPSILILQEGTSSTLRCNFSTSVFNVQWFQQNPGGGLINLFYMTSGTKHSGRLSSTLNTKDLYSTLSITASQLEDSATYLCATS
Myotis lucifugus V436 trav AAPE02015068.1 35284 GVTGMNVEQSPSILSLQEGTSSTLRCNFSTTVTNVQWFQQNPGGGLINLIYLASGTKHSGRLSSTLNTKDLYSTLSITASQLKDSATYLCAGS
Myotis lucifugus V437 trav AAPE02015068.1 18194 VSHGEKVDQNPSTLNVQEGNTAVINCSYSDSGSDYFPWYKQELGKGPQFIIGIRSNKDINEDERLTVFLNKAAKHFSLHIAATQPGDSAVYFCAAS
Myotis lucifugus V438 trav AAPE02015068.1 13560 SSIAQKVTQGQQAILVQEKEAVSLECTYDTSDTSYSLFWYKQLSRGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALSE
Myotis lucifugus V439 trav AAPE02015068.1 5631 RIHGDSVTQTKGQVTLSEGAPLTVNCSYETILFPALFWYVQYPGEGPQLLLTATMVNESGSSKGFVATYQKQPDTFHLEKASVHQSDSAMYYCALG
Myotis lucifugus V440 trav AAPE02015068.1 956 GVTGLNVEQSPSVLILQEGTSSTLRCNFSTSVRNVQWFQQNPGGGLINLFYMTSGTKHNGRLSSTLNTKDLYSTLSITASQLEDSATYLCAAD
Myotis lucifugus V441 trav AAPE02015072.1 12212 GVTGMNVEQSPSALSLQEGTSSTLRCNFSSTMYKVLWFRQNPGGGLISLFHMSSGTNHNGRLSSTVDSANLYSTLSITASQLKDSATYLCAAD
Myotis lucifugus V442 trav AAPE02015074.1 3712 GVRGMKVEQSPSILSLQEGTSSTLRCNFSTTVTKVQWFRQNPGGGLINLFYLASGTKHSGRLSSTLNTKDRYSTLSITASQLEDSATYLCAAD
Myotis lucifugus V443 trav AAPE02015074.1 769 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSTSSYFPWYKQEPGKGPQLSIDIRSNKDINEDERLTVFLNKAAKHLSLHITATQPGDSAVYFCAAS
Myotis lucifugus V444 trav AAPE02015075.1 5737 SSIAQKVTQGQRAILVQEKEAVSLDCTYDTNVPRYSLFWYKQLSRGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALTE
Myotis lucifugus V445 trav AAPE02015076.1 1375 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASAYFPWYKQEPGKGPQLSIDIRSNKDKIQAGRLTVLLNKAAKHLSLHIAATQPGDSAVYFCAAS
Myotis lucifugus V446 trav AAPE02015078.1 62963 DARAQSVDQPDNHISVSEGASLELRCKYSYTGTVYLYWYVQDPRQGLQLVLKYLSGDTLVKGIKNFEAELRKNESTFNLRKHFAHWSDSAEYFCAVS
Myotis lucifugus V447 trav AAPE02015078.1 49339 RSNGDSVTQTKGQVTLSEGASLTVNCSYKTTGYPTLFWYVQYPGEGLQLLLKAAKANEKGSNKGFEATYQKQPDAFHLEKASVHQSDSAMYYCAVG
Myotis lucifugus V448 trav AAPE02015078.1 38450 DARAQSVDQPDNLISVSEGASLELRCKYSYTGTVYLYWYVQDPSQGLHLLLKYYSGDTLVKGIKNFEAELRKNESTFNLRKHFAHWSDSAEYFCAVS
Myotis lucifugus V449 trav AAPE02015078.1 18851 DARAQSVSQPDHHVSVSEGASLELRCTYVYAATPSLFWYVQYPSQGLQLLLKNFSGKTLVQGIKGFEAEFKKNESSFILRKPSAHWSDSAVYFCALS
Myotis lucifugus V450 trav AAPE02015078.1 6768 GVRGMKVEQSPSALSLQEGTSFTLRCNFSTTVTYIQWFRQNPGGGLINLFYLTSRTKHNGRLSSTLNSKDRYSTLSITASQLEDSASYLCAAS
Myotis lucifugus V451 trav AAPE02015080.1 22247 AESKDQVFQHSTMVSSEGAVVEISCNHSISNAYDFSWYLHSPGCAPRLLVKGSRPSQKGRYNMTYERFSSSLLILQVQVADAATYYCALGDTEAEN
Myotis lucifugus V452 trav AAPE02015080.1 9806 TLSLAKTTQPIFMLSDEGQEVNIPCNHTNIATNEYIFWYQQFHNQGPQFVIQGYKTDTANEVASLFIAADRKSSVLRLPWASLKDTAVYYCIVSG
Myotis lucifugus V453 trav AAPE02015080.1 1365 LSSQKMEQNPQSLSIQENEKAILTCSYANYSPVFFQWYRQDPGRGPIFLLLIRENERTKLVGRLRATFDTTIKQSSFYITASQPSDSATYLCAA
Myotis lucifugus V454 trav AAPE02015082.1 1117 TAGQGVQQPPELTAMEGASVQINCTYQTSGFNGLFWYQQHDGGAPIFLSYNVLDGLDRRGRFSSFLSHSDTYSYLLLRELQMKDAASYLCAVI
Myotis lucifugus V455 trbv AAPE02029195.1 16997 VGAQTIHQWPSTKVKLKGSPLSLECTVKGTSSPNLYWYRQAEGGGPQMLFYSISTGKVDSQAPQNLEASRPQDGYFILRSKKLLLSDSGFYLCAWS
Myotis lucifugus V456 iglv AAPE02038809.1 1742 CGPQPMLDQPPSVSSPLGTTVRLACTLSRDHDVNIYSIYWYQQRPGHPPRFLLRYFSHSDKRQGPKVPPRFSGFKDVAENTGYLSISGLQPEDEAMYYCAV
Myotis lucifugus V457 trdv AAPE02039938.1 60635 VSLDIILESDTQTLTVLVGEAATFHCRVTGADLKNYQMSWYKKHEDNSLTLVYRQSNNSNDHLRSNIKGKIDILNNQYILDIQKATTKDVGTYYCGSD
Myotis lucifugus V458 trdv AAPE02039938.1 39368 VMSAIVLVSQDQEVTMSLGMSATLRCSLKGETISNYYISWYRQTQGNTMTFIHREGGMYGRGFFGKFRANINDSSNEAELEILKASERDEGIYYCASD
Myotis lucifugus V459 trav AAPE02039941.1 40009 VNGKNGVEQSPQHLSAQEGEVITINCSYSIGMTSLHWMRQNPGGGIVSLFTLSLEMKKKGRISATINTKESRSALHISAAQPRDSAVYLCAVE
Myotis lucifugus V460 trav AAPE02039943.1 8998 SSVAQKVTQPQPELSVQETETATVACTYDTSWTDYYLFWYKQPPSGEMIFIIRQEAFKQQNATDNRFSVNFQKATKNFSLRISGCQLEDAAVYFCVLSE
Myotis lucifugus V461 trav AAPE02039944.1 6314 SSVAQRVTQPQPEMSVQEAETATLACTYDISRSDYYLFWYKQPPSGEMIFIIRQEAFKQQNATDSRFSVNFQKATKNFSLRISGCQLEDAAVYFCALSG
Myotis lucifugus V462 trav AAPE02039945.1 11167 SSWAQKVTQPQQEMSVQEAETATLACTYDTSDSNYYLFWYKQPPSGEMIFIIRQEAFKQQNATDNRFSVNFQKATKNFSLRISDCQLEDAAVYFCALSG
Myotis lucifugus V463 trav AAPE02039945.1 4673 SSWAQKVTQPQPEMSVQETEPVTLACTYDTSGSDYYLFWYKQPPSGEMIFIIRQEAFKQQNATDHRFSVNFQKATKNFSLRISDCQLEDAAVYFCALSG
Myotis lucifugus V464 trav AAPE02039948.1 604 SSVAQKVTQPQQEMSVQEKETATLACTYDTSESNYYLFWYKQPPSGEMIFIIRQEAFKQQNATDHRFSVNFQKATKNFSLRISDCQLEDAAVYFCALRG
Myotis lucifugus V465 trav AAPE02039950.1 3608 SSWAQKVTQPQPEMSVQEAEPVTLGCTYDTSEGAYYLFWYKQPPSGEMIFIIRQEAFKQQNATENRFSVNFQKATKNFSLRISDCQLEDAAVYFCALSE
Myotis lucifugus V466 trav AAPE02039952.1 1226 PGGADWINSQETEVSVMEGKSVTLLCNYGTSSRGAVDLYWFRQYPNQAPEFILYRGWGHTGDADFATEKFYSKSTANATTLYIGKLKFADTARYHCALRK
Myotis lucifugus V467 trav AAPE02039953.1 1192 VSGQQLNQSPQSMSISEGEAISMSCISSSTFNTLLWYKQDAGGGPVLLITLYKGGEFIRNGKLTAQFGGTRKDSLLNISAPELADAGTYFCAG
Myotis lucifugus V468 trdv AAPE02039957.1 10336 FITTEKSIQAQTTVTVQEGEAVTMDCTYETSWSFYSLFWYKQHPSGELVFLIYQFSSYPNAKQDRYFVNFQREKNFISLTISSLQLADSAKYFCALG
Myotis lucifugus V469 trav AAPE02039957.1 3201 IMGDAKSTQPGAMESTAEEAVHLPCDHSTISGSEYIHWYRQIPHQGPEYVIHGLKDNVTKGTYSLIIATDRKSSTLILPQVSLRDSGVYYCIVRD
Myotis lucifugus V470 trdv AAPE02039958.1 56733 SSMAQKVIQDQVETVKQEGALVTTLNCRYETSDSVYYIYWYKQLTSGKLIFLIRQGSTGQNAEDGRYSINFQKAAKSISLTISTLQLEDSAKYFCALWE
Myotis lucifugus V471 trav AAPE02039958.1 45467 VSSELNVEQSPPSLRVQEGKSTNFTCRFPTSSFYALYWYRWEPAKSPTILFVISLNGDVKKEGRVTATLDTTKGYSYLYIIGSQPEDSATYLCAF
Myotis lucifugus V472 trav AAPE02039958.1 40670 VNGQQIKQIPQFLLLQEGENFTTYCNFSSTVNNLQWYKQSPGGNPVFLVMLVRGGEVKKQERLTARFGETRQDGSLHITATQTADVGAYFCAE
Myotis lucifugus V473 trav AAPE02039958.1 33637 AMIDAEITQPNSMDYAEGKDVNLPCNHSTIGGTDYIHWYRQNPNQRAQHIIHGLRNKVTNNIASLIITEDRKSSTLILPRVTLRDSAVYYCAVR
Myotis lucifugus V474 trav AAPE02039958.1 23183 ETRAQSVTQPDGHITVSEGAPLELRCSYSYGGAIYLFWYVQYPNQGLLNILKYVTGTTLVTGIKGFKAEFRKNETSFHLRKLSAHWSDSAVYFCALS
Myotis lucifugus V475 trav AAPE02039958.1 15955 ESTQQLEQTPRFLSIQEGENCTVSCSSSSVFPTFQWYRQEPGEGPVLLMTLTKGGEKKEQKRLTAQFGTERKDSSLLITAAQPGDAGTYLCAG
Myotis lucifugus V476 trav AAPE02039962.1 27594 LSGEDQVEQSPQTLRVQEGDNVSLTCSYTVSTFKGLQWYRQDPGKGPEHLFLLYSVGKGQQKGRLSVSLSQKESSLHITTPTAEDSATYLCAVE
Myotis lucifugus V477 trav AAPE02039962.1 19487 VSSEQEVNQSPGALTVHEGDSLFLNCSYTDSAIYFLQWFRQDPGKGLTSLLLIQSSQREETSGRIKVLLDKTSRHSALYIATSQLGDSATYLCAV
Myotis lucifugus V478 trav AAPE02039962.1 10953 VRGVQVEQSPPALILQEGASSTLRCNFSTSVNNVQWFRQNPGGRLVNLFYVPSGTKWNGNLKATTDPKERRSSLHVSSSQTTDSATYFCAVEAQCFP
Myotis lucifugus V479 trav AAPE02039963.1 9516 VTNGDSVTQTEGPVTLTEGASVILNCNYQTTYSAPYLFWYVQHRNKAPSLLLKSSTEHQTAEHEGFQAKLVKSDSSFHLEKSSLQMSDSAVYYCALR
Myotis lucifugus V480 trav AAPE02039965.1 79772 SSIAQKVTQGQRAILVQEKEAVSLECTYDTSDTSYSLFWYKQLSRGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALTE
Myotis lucifugus V481 trav AAPE02039965.1 70033 RIHGDSVTQTKGQVTLSEGAPLTVNCSYETTQYPVLIWYVQYPGEGPQLLLKATRVNENGSSKGFVATYQKQPNAFHLEKASVHQSDSAMYYCALG
Myotis lucifugus V482 trav AAPE02039965.1 65488 GVRGIKVEQSPSILILQEGTSSTLRCNFSTAVRNVQWFRQNPGGGLINLFYMTSGTKHSGRLSSTLNSKDRYSTLSITASQLEDSATYLCAAE
Myotis lucifugus V483 trav AAPE02039965.1 60446 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASNYFPWYKQELGKGPQLSIDIRSNKDKIQAGRLTVLLNKAAKHLSLHITATQPGDSAVYFCAAS
Myotis lucifugus V484 trav AAPE02039965.1 49759 QTHGDAVTQMEGQVTLLEGAPLTVNCTYSATGYPTLFWYVQYPGEGPQLLLKAATVNGKGRNKGFEATYQKEPKAFHLEKASAHQSDSAMYYCAVG
Myotis lucifugus V485 trav AAPE02039965.1 37523 GTGAQSATQPDGHVTVSEGAPLELRCKYSSSTSPYLYWYLQCPNQGLELVLKYFSGNTLVKGIKDFEAEFRKDETSFNLKKHSAHWSDSAVYFCAVS
Myotis lucifugus V486 trav AAPE02039965.1 31994 GIRAQTVTQPEDIISVLEGASVQVKCNYVYSGSPVLFWYVQYPRQSLRLLLKHFSGESAKGFTAVLDKSEASFHLKKPSAQEEDSAVYYCAVS
Myotis lucifugus V487 trav AAPE02039965.1 23871 GTSGAPVNQTEGPVTLVEGAFLTLKCTYQSTYSVFVFWYVQYQNKEPVLLLKSSSDNQEVSNRGFRASLVKTDSSFHLRKPSVQMSDSAVYYCALG
Myotis lucifugus V488 trav AAPE02039965.1 14942 GTSGASVNQTEGPVTLIEGEFLTLKCTYQTSYSDFLFWYVQHQNKEPVLLLKSSSDNQEVSNRGFRASLVKTDSSFHLRKPSVQMSDSAVYYCALR
Myotis lucifugus V489 trav AAPE02039965.1 6123 GTSGASVNQTEGPVTLVEGAFLTLKCTYQSTYSVFVFWYVQYQNKEPVLLLKSSSDNQEVSNRGFRASLVKTDSSFHLRKPSVQMSDSAVYYCALG
Myotis lucifugus V490 trav AAPE02039966.1 3750 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASNYFSWYKQELGKGPQFILGIHSNKDINEDERLTVFLNKAAKHLSLHITTTQPGDSAVYFCAAS
Myotis lucifugus V491 trav AAPE02039967.1 2505 ISHGEKVDQLPSTLSVQEGNTAVINCSYSDSASSYFPWYKQEPGKGPQLSIDIRSNKDKNQAERLTIFLNKAAKHLSLHIAAAQPGDSAVYFCAAS
Myotis lucifugus V492 ighv AAPE02043534.1 1382 VHSQVQLVQSGAEVRKPGDSVKISCKASGYTFTSFIISWVRQASGESMKYMGWIKTETGAPTYAQGFSERFVFSVDTSISTAYLQINGLKSEDTAMYYCARE
Myotis lucifugus V493 ighv AAPE02043536.1 24525 VQCEVQLVESGGGLVQPGGSLRLTCAASGFTFSDYEMDWVRQAPGKGLEWLGEINPAGSSTSYANSVKGRLTISRDNAKNMLYLQMNTLRAEDMAVYYCAR
Myotis lucifugus V494 ighv AAPE02043539.1 11042 AAGGVWGKLGAAWRVSDTRLCSSGFTFSDYWMSWARQAPGKGLEWVSDIRSDSSTTYYAASVKGRFTISRDNSRNTLYLQMNSLRVEDKALYYCV
Myotis lucifugus V496 ighv AAPE02043542.1 48048 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMDWVRQAPGKGLEWLCRMNPDGSTTHYANSVKGRFTISRDNAKNMLYLQMNSLRAEETAMYYCAR
Myotis lucifugus V497 ighv AAPE02043542.1 31430 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGWVYPNNGNTKYAQKFQGRVSMSRDTSTSTAYMELSSLRAEDTAMYYCAR
Myotis lucifugus V498 ighv AAPE02043543.1 595 VQCDVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGEGLEWVSLINPAGSSTYYANSVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCSR
Myotis lucifugus V499 ighv AAPE02043544.1 136358 VHCRMQIVQSGAEVRKPGASVKVSCKASGYTFTSYWMQWVRQAPGQGLEWMGRVNPNNGNTNYTQKFQGRVSMSRDTSMNTAYMELSSLRAEKTAVYYCARL
Myotis lucifugus V500 ighv AAPE02043544.1 135209 VLSQVQLQGWGPGLVKPSQTLSLTCAVYEFSITTSSYDWSWIRQPPGKGLEWMGCINHNGDTKYSPSLKSRISISRDTSKNQFSLQLSSVTTEDTALYYCV
Myotis lucifugus V501 ighv AAPE02043544.1 131749 VLSIPCAAAGAAVGPRTGKTLADPLPHLHCLWFFHPQWLLELNQPAPSEVGSTCYDGNTYYSPSFKNLTSISRDTSNNQFSLQLSSMITENMAIYYCA
Myotis lucifugus V502 ighv AAPE02043544.1 129024 VQSEVQLVESGGDLVKTGGSLRLSCAASGFTFSSSWMNWVRQAPGKGLEWVSYIRGDGSTISYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAT
Myotis lucifugus V503 ighv AAPE02043544.1 106188 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVQWTRQAPGKGLESVAGIWSNGDTYYNPTLKSRLSIIKDTAKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V504 ighv AAPE02043544.1 100672 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGEVNPNNGNTNYAQKFQGRVSMTRDTSTSTAYMELSSLRAEDTAMYYCAR
Myotis lucifugus V505 ighv AAPE02043544.1 97201 VLSQVQLQESGPGPVKPLQTLSLTCTVSGFSLTSYGVHWTRQAPGKGLEWVGAVWADGSTNYNPTLKSRLSITRDTSKSQVYLTLNSMRAEDTAMYYCAR
Myotis lucifugus V506 ighv AAPE02043544.1 78073 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSNWMHWVRQAPGKGLEWLCRINPDGSTTNYANSVKGRFTISRDNAKNMLYLQMNSLRAEETAMYYCA
Myotis lucifugus V507 ighv AAPE02043544.1 74446 VLTQVQLRESGPGLVKPSQTLSVTCADHGVSITTSGYCWSWMRQPPGKGLKRMGCICYDGNTYYTLSLKSRTSVSRDTSKNHVSLQLSSVTTDDTAVYYCAK
Myotis lucifugus V508 ighv AAPE02043544.1 53818 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSNYDMHWIRQAPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNAKNMAYLQMNSLRVEDMAVYYCAR
Myotis lucifugus V509 ighv AAPE02043544.1 28915 VLCQVQLVESGGGVVPPGRSLSLSCKASGFTFTNYSMYWVRQAPGKGLQWMAGVSYPTGKNQWYAPAVQGRFMISRDNPTSTVSLKMTKLTSEDTAVYYCT
Myotis lucifugus V510 ighv AAPE02043544.1 352 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSFGMNWVHQAPGKGLEWVAGVSSIGGTTYYADSVKGRFTVSRDNAKNTLYLQMNSLRTEDTAVYYCAR
Myotis lucifugus V511 ighv AAPE02043545.1 68571 VQCDVQLVESGGGLVLPGGSLRLSCAASGFTFSSYWMHWVRQAPGEGLEWVSLINPDGSTTYYANSVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCSR
Myotis lucifugus V512 ighv AAPE02043545.1 62960 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSSWMVWVRQAPGKGLEWVSLINPDGSTTNYANSVKGRFTISRDNAKNMLYLQMNSLRAEETAMYYCAR
Myotis lucifugus V513 ighv AAPE02043545.1 26485 VQCEVQLVESGGGLGKPEGTLRLSCAASGYASSSYYMNWVRQTPGKGLEWICAITGNSDSTYYADSVKGRFTISRDNAKNTIYLQMNSLRAEDMTVYYCAT
Myotis lucifugus V514 ighv AAPE02043545.1 13106 VLSQVQLQESGPGLVRPLQTLSLTCTVSGFSITTSDYCWSWIRQPHGKGLEWMGCIHSEGSLYYSPSLKSQTSISRDTSKNQFSLQLSSVTTEDTAIYYCV
Myotis lucifugus V515 ighv AAPE02043545.1 9186 ALPQMQLHEMGPGLMKPSQTLSLTCTVSGLSLMSIGVHWTRQAPGKGLEWIGVIGSAGDAYYNPNLKTLVSISRDTSKSQVYLSLTSLRAEDMAMYYCAVLLCE
Myotis lucifugus V516 ighv AAPE02043545.1 2041 AQCEVQLMESGGDLVQPGGSLRLSCVGAGFTFSSNNMNWVRQAPGKGLEWVSYINPDGSSTYYANSVKGRFTMSRDNARNTLYLQMNSLKAEDMALYYCTTD
Myotis lucifugus V517 ighv AAPE02043546.1 67545 VQGEVQLVESGGGWVQPGGSLRLSCAASGFTFSSHWMGWVRQAPGKGLEWVSFITDYGGSIYYANTAKGRLSISRDNAKNMLYLQMNSLTAEDTAVYYCV
Myotis lucifugus V518 ighv AAPE02043546.1 63660 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSHWMGWFRQAPGKVLEWLGEITPDGSTTHYAKSVKGQFTISRDNAKNTLYLQMNSLRAMDTALYYCA
Myotis lucifugus V519 ighv AAPE02043546.1 30985 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYEMDWVRQAPGKGLEWVSYINPGGSSTSYANSVKGRFTISRDNAKNTLYLQMNSLRDEDMALYYCAR
Myotis lucifugus V520 ighv AAPE02043546.1 13015 VQCEVQLVESGGGLVQPGGSLRLSCKGSGFTFSDYYINWIRQTPGKGLEWVGFIRNKANSHTTEYAASVKGRFTISRDDSKSTAYLQMSSLRAEESALYYCAR
Myotis lucifugus V521 ighv AAPE02043550.1 20270 VLSDVQLQESGPGLVKPSKTLSLTCTVSGFSITTSGCCWTWIRQPPGKGLEWMGCIGYDGNIYYTPSLKSRTSISRDTSKNQFSLQLSSVTTEDTALYYCVR
Myotis lucifugus V522 ighv AAPE02043550.1 6072 VLSEVQLQESGPGLVKPSQTLSLTCTVSGLSITTSASCWHWIRQALGKGLEWMGRICSDGSTNYSPSLKSRTSISRDTAKNQFSLQLSLVTTEDTAVYYCMS
Myotis lucifugus V523 ighv AAPE02043552.1 1369 VQCEVQLVESGGGLVQPGGSLRLSCEASGFTFSNNWMSWVRQAPGKGLEWVGIVSTDGGTTNYADSVKGRFTISRDNAKNMLYLQMNSLTAKDTAVYYCA
Myotis lucifugus V524 ighv AAPE02043553.1 24118 VLCQVQLQESGPGLVKPSETLSLTCTVSGFSLSSHGVHWNRQAPGKGLEWIGVIWADVSRIYNPTLKSRVSITKDTSNSQVYLTLNSLVAEDTARYYCA
Myotis lucifugus V525 ighv AAPE02043553.1 10217 GLCQVQLVEAGGGVVPPGGSQRLSCRASGFTFTNYSMNWVRQAPGKGLQWVAEVSYPTGKGQWYAPAVQGRFTISRDNPMSTVSLKMTKLTSEDTALYYCT
Myotis lucifugus V526 ighv AAPE02043554.1 21567 AAAGVGPRTGEDLTHPLPHLHCLWILPNEHWCTLDPPASGKGLEWVGVIWNTGNTAYNPTLRSRLSITRDTSKSQVYLTLNSLRTEDTAMYYCAK
Myotis lucifugus V527 ighv AAPE02043555.1 33681 VQCEVQLVESGGGLVQTGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSTITHTDGSTYYPDSVKGRFTISRDNTKNMLYLQMNSLRSEDTAVYYCA
Myotis lucifugus V528 ighv AAPE02043555.1 29967 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYCWTWIRQPQGKGLEWMGCIRYDGNTYYSPSLKSRTSISKDTSKNQFSLQLSSVTTEDMAVYYCAT
Myotis lucifugus V529 ighv AAPE02043555.1 25645 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMNWVHQVLGKGLEWVSGVSSIGGTTYYADSVKSRFTVSRDNTTSTLYLQMNSLRTEDMAVYYCAR
Myotis lucifugus V530 ighv AAPE02043555.1 22345 VQCEVQLVESGGSLVQPGGSLRLSCAASGFTFRSYWMYWVHQAPGKGLQWVSHINPDGSGSYYADFVKDQFTTSRENAKNMLYLQMNSLRAEEMALYYCARET
Myotis lucifugus V531 ighv AAPE02043555.1 15491 VQCEVQLMESGGGLVLPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWLCQINPVGNTTYYANSVKGRFTISRDNAKNMLHLQMSSLRAEESALYYCA
Myotis lucifugus V532 ighv AAPE02043555.1 12382 VLSQVQLWEWGPGLVKPSQTLSVTCADHGVSITTSGYCWSWIRQPPGKGLEWMGCICHDGNTYYSPSLKSRTSISRDTSKNQVSLQLSSVTTDDTAVYYCAR
Myotis lucifugus V533 ighv AAPE02043558.1 77828 AVGGVWGRLGAAWGSLRLSCAASGFTFSSSGMNWVRQAPGKGLEWVAVIWSDGSQKYYADSVKGCFTTSRDNAKNTLYLQMSNLRAEDMAMYYCAR
Myotis lucifugus V534 ighv AAPE02043558.1 67907 VQCEVQLVESGGGLVLPGGSLRLSCAASGFTFSSNWMHWVRQAPGKGLEWLCRMNPDGSTTNYANCVKGRFTISRDSAKNMLYLQMNSLRAEETAMYYCTT
Myotis lucifugus V535 ighv AAPE02043558.1 36760 VQCEVQLVESGGGLVLPGGSLRLSCAASGFTFSSYWMQWARQAPGKGLEWLGEIKTDGSITNHGTSVKGRFTISRDNDKNMLYLQMNSLRAEDTAVYYCST
Myotis lucifugus V536 ighv AAPE02043558.1 21250 VQCEVQLVESGGGLVQPVGSLRLSCSASGFTFISYRMNWVCQAPGKGLEWVSYIEDGSSTYYANSVKSRFTISRDNDKNMLYLQMNSLRSQDTAVYYCLRD
Myotis lucifugus V537 ighv AAPE02043558.1 16581 VQCEVQLVESVGGLVPPRGSLRLSCAISGFTFSRYHITWVHWDPGKGLDWVAIINTNGGTTNCANSVKGQFTISRDNSKKTLHLQMNSLRAKDTAVYYCST
Myotis lucifugus V538 ighv AAPE02043561.1 50030 VHSQVQLAQSGAEVRKPGAYLKVSCKVSGYTFTSYWMQWVRQTPGQGLEWMGEVNPSNGNTNYAQKFQGRVSITRDTSINTAYMELSSLRAKDRAMYYCA
Myotis lucifugus V539 ighv AAPE02043561.1 46297 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSSYDWTWIRQTPGKGLEWMGCINNNGNTYYSPSLKSRTSISRDTSKNQFTLQLSSVTTEDTAVYFCA
Myotis lucifugus V540 ighv AAPE02043561.1 36321 GPCQVQLVESGGGVVPPRTSLSISCKAPGFTFTDYHMYWVHLAPRKGLQWVAKVSQPTGDKQWYAPAVQGRFTIFRDNPISTVSLKMTKLTSEGTALYYCTR
Myotis lucifugus V541 ighv AAPE02043561.1 21688 GLCQVQLVDSWGSVVPPGGYMSLSCKASGFTFTDYTMNWVRQAPGKGLQWVARVSQPTGKDQWYAPAVQGRFTISRDNPTSTVSLNMTKLTSEDTAVYYCT
Myotis lucifugus V542 ighv AAPE02043562.1 68824 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYAVQWLLQVPGKGLEWVGGIWGNGVTNYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis lucifugus V543 ighv AAPE02043562.1 54186 VQCEVQLMESGGGLVQPGGSLRLSCAASGFTFSSYRMNWVRQAPGKGLEWVSYINEDGSSTYYANSVKGRFTISRDNDKNTLYLQMNSLRSQDTAVYYCLR
Myotis lucifugus V544 ighv AAPE02043562.1 49299 VQCAVQLVESVGGLVPPRGSLRLSCAVSGFTFSRYHITWVHWDPGKGLDWVAIINTNGGTTNCANSVKGQFTISRDNSKKTLHLQMNSLRAKDTAVYYCST
Myotis lucifugus V545 ighv AAPE02043562.1 37243 VLSQVQLQESGPGLVQPSQTLSLTCTVSGLSLTSIGVHWTCQALGKGLEWIGVIGRAGDTYYNPTLKSRFSINRDTSKSQVYLSLTSLTAEDTAVYYCA
Myotis lucifugus V546 ighv AAPE02043562.1 26548 VQCEVQLVNSGGGLVQTGGSLRLSCKGSGFTFSDYYIHWIRQTPGKGLEWVGFIRNKANGHTTEYAASVKGRFTISRDDSKSTADLQMSSLREEDTAMYYCATE
Myotis lucifugus V547 iglv AAPE02048177.1 18836 SWAEPVLTQPSSVSGSPGERVTISCTGSSTNVGVGDYVSWYQQLPGKAPKPLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEAVYYCL
Myotis lucifugus V548 iglv AAPE02048177.1 15225 SWAQSVLTQPSSVSGSPGERVTISCTGSSTNVGYGDYVSWYQQLPGKAPKLLIYQSSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEAHYYCS
Myotis lucifugus V549 iglv AAPE02048177.1 12284 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGRGDYVSWYQQLPGKAPKLLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAEYEADYYCESYDSSIYS
Myotis lucifugus V550 iglv AAPE02048177.1 10349 SWAQSVLTQPSSVSGSPGQRVTISCTGSSSNIGDNYVNWYQQLPGKAPKLIIYLDSITESGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCSAWDDSLNA
Myotis lucifugus V551 iglv AAPE02048177.1 7471 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGGGSYVYWYQQLPGKAPKLIIYDNSNRPSGVPDRFSGSKSGNSGILTITGLQAEDEADYYCSAADSSIYS
Myotis lucifugus V552 iglv AAPE02048178.1 1420 SWAQSVLTQPSSVSGSLGQRVTISCTGSSTNVGYGDYVSWYQQLPGKIPKLLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEADYYCASYENSPTG
Myotis lucifugus V553 iglv AAPE02048180.1 1277 SVSAGSLSQPVLTQPPSLSASPGATARLTCTLSSDVSVGGKTIHWHQQKPGSPPRFLLYYHTGTNFGSGVPSRFSGSKEASANAGLLTISGLQPEDEADYYCST
Myotis lucifugus V554 iglv AAPE02048181.1 6473 SCAEPVLTQPSSVSGSPGERVTISCTGSSSNVGRGDYVSWYQQVPGKAPKFLIYGSNTRPSGVPDRFSGSRSGSSASLTVTGLQVEDEADYYCQSYDSSIDG