WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sebastes aleutianus LHVS00000000.1 (LHVS01) 9 0 0 1 3 5 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sebastes aleutianus V8 trav LHVS01116895.1 807 SRGQVTVTQPGAVSSTLGRSVSISCRVSHGVDGGCSGSIPCLFWYQQKDGEAPKLLIYGSNRRASGTPDRFSGGGSGTDFTLTINGVQGEDAAVYYCQSIKTLDRQL
Sebastes aleutianus V6 trbv LHVS01083966.1 261 LTDGSDVTQTDIMWKDEGDDATIHCSQTQGVQYDQMYWFRQLPGETIKLIVRTSFTTKGHDFGDFGKERFSATKPDFESGKFTVKNLQPEDKGLYFCAVS
Sebastes aleutianus V5 trbv LHVS01083965.1 628 LTDGSDVTQTDILWKDEGDDATINCSHTKGLQYSQMYWYRQRQGETIKLIVFTTYGKENHDFGDFDKGKFSATKPDLESGTFTVKNLQTEDKGLYFCAVSQ
Sebastes aleutianus V4 trbv LHVS01117518.1 378 VSQSVLITQWPLYISSPPSGSAEMHCYQNDTNYEYLYWYRQLKGEGFQLMVYILGTPTYEEGFKSGFQAVKSKEKQWSLTITSVQKKDEAVYLCAAS
Sebastes aleutianus V3 trav LHVS01116560.1 110 CKGEDRVNQTTGDVIATEGHTLTLDCTFQTATASPTLFWYKQEVHDSPKYMLKSFSNNADKAPEFQKDRFDARINKTSVPLRIQKLQLSDSAVYYCAVR
Sebastes aleutianus V2 igkv LHVS01116491.1 256 SSSQVTVTQPAAVTSSLGSTVTLTCKTNPKVHIWSDGDSRVNWYQQKSGEAPKLVISLAQNPTSEFSSRFSGTGDGVNTVMTISGVQTEDAAVYYCQSAHEINSAWV
Sebastes aleutianus V1 trbv LHVS01113289.1 281 FTDGSDVTQTPLVWLDEGQSATMNCSHTKDGTFYQMYWYRQLPGEGMKQIVFTQPSSPHQYESGFTEEKFPAKKSDAQTGSLSVVTLLPEDSGVYFCAVS
Sebastes aleutianus V0 trav LHVS01075105.1 30377 LSPCKEIHQDPPAILGRLHVSATISCSHSIGSYDTMLWYQQPTGDSELKLIGYVFYSSPIVEKPFSDNFKVTGDGSKKAELHVLKLRHPEDSGVYYCAAAAAIVV
Sebastes aleutianus V7 trbv LHVS01111505.1 1210 FSFCVKIHQPPIIISREGEPAVTFQCEQDDSEYLYMFWYRRISSGRIQMVTYSLGKDVWNVEAPFNKSKYSMSRPAVLQSSLQIHPVEAADSAVYYCASRR