WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sebastes minor LHCJ00000000.1 (LHCJ01) 8 1 0 0 2 5 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sebastes minor V7 trav LHCJ01862120.1 135 SDVTQTPLVWMDEGQSATMNCSHTKDISHSQMYWYRQLPGEGMKQIVYTTPSPPHQYESGFTEDRYPAKKSDAQTGSLTVERLLPEDSGVYFCAVS
Sebastes minor V6 ighv LHCJ01858650.1 197 AQGQSLTSSEPVVSRAGQAVTLSCKVEGLALTWLHWIRQKPGRGLEWIGRIDDGTGTIFAQSLQGQFTITKDTSRNLVYLQVKSLRQEDSAVYYCARE
Sebastes minor V5 trbv LHCJ01847281.1 188 VSQSVLITQWPLYISSPPSGSAEMHCYQNDTDYEYLYWYRQLKGEGFQLMVYILGTPTYEEGFKSGFQAVKSKEKQWSLTITSVQKKDEAVYLCAAS
Sebastes minor V4 trbv LHCJ01862339.1 140 FTDGSDVTQTPLVWMDEGQSATMNCSHIKDGTFYQMYWYRQLPGEGMKQIVFTQPSSPHQYESGFTEEKFPAKKSDAQTGSLSVVTLLPEDSGVYFCAVS
Sebastes minor V3 trbv LHCJ01842824.1 3546 FSFCVKIHQPSSILIHEGGPAVTFQCEQDDSEYLYMFWYRRISSGRIQMVTYSLGKDVWNIEAPFNKSKYTMSRPAVLQSSLQIHPVEASDSAVYYCASRR
Sebastes minor V2 trbv LHCJ01778523.1 575 VSLGLDVRQSPSELITTPGDKVQIFCSHDKTDYRVMLWYQRTPGDTAMKLIGYLYNTDVTKEEPYKEDFDMSGDLTGSTAKNGPLIVNLVKQEHSAVYYCAASR
Sebastes minor V1 trbv LHCJ01771615.1 76 VCLGVEVHQTPSELLRRPGDKVQLVCSHEKTDYTQMYWYQKSPGDPALKRIGHVYYSTIEHEESFKEHFNITGDMSGSTAKNGSLFISNLKAPEHSAVYYCAASY
Sebastes minor V0 trav LHCJ01618855.1 162 VCLSLDVHQSPSDVITKPGDKVQISCSYDKTDYRVMLWYQRSPGDTAMKLIGYLNYQDVTMEGPYKEHFNMSGDLRVNTVKTGSLIIQVIGREQGAVYYCAASR