WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sebastes steindachneri LCWK000000000.1 (LCWK01) 5 0 0 1 2 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sebastes steindachneri V4 trbv LCWK011212566.1 70 LIDGSGVTQTDILWKDEGDDATIHCSHTKGLQYSQMYWYGQRQGETMKLIVYTTYGKENHDFGDFDKGKFSATKPDIESGTFTVKNLQPEDKGLYFCAVSQ
Sebastes steindachneri V3 trav LCWK010770104.1 46 VCLSLDVHQSPSDVIKKPGDKVQISCSYDKTDYRVMLWYQRSPGDTAMKLIGYLNYQDVTMEGPYKEHFNISGDLRVNTVKTGSLIIQVTGREQGAVYYCAASR
Sebastes steindachneri V2 trav LCWK010500032.1 38 VSGVAVVTQEPPVVTVRKGETANMDCDVSTDDGSRWYKQSPGGAFQFVLRNHYSYSSPRYGSGFSSPRFTSSHLSGTKYRLTISNVEEGDSAVYHCETWDDSAK
Sebastes steindachneri V1 trbv LCWK010408275.1 106 VCLGVEVHQTPPELLRRPGDKVQLVCSHEKTDYTQMYWYQKSPGDPALKRIGHVYYGTIEHEESFKEHFNITGDMSGSTAKNGSLFISNLKAPEHSAVYYCAASY
Sebastes steindachneri V0 igkv LCWK010171800.1 236 SSGEIILTQSPGSQSVVPGQTVSIKCKASSSAGGSLQWYLQKPGESPKLLIYSATARQTGVSDRFSGIGSGTDFTLTISGVQADDSGVYYCQQSSSFP