WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Squalius pyrenaicus CVRK00000000.1 (CVRK01) 2 0 0 1 1 0 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Squalius pyrenaicus V1 igkv CVRK01022100.1 26 QITVTQSPSISAVQPGEEVRINCKTSSDVYYHSSYGHYLHWYSQKPGEAPKLLIYGASTRYTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Squalius pyrenaicus V0 trav CVRK01004338.1 89 HYDVSSGQDKVEQSPREMPASEGDQVILRCNYTTTDQNPYLFWYKQLPNRSPTFILNKYTFGEGTTEPEFKKRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALR