WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Stegastes partitus JMKM00000000.1 (JMKM01) 49 5 0 3 21 15 1 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Stegastes partitus V13 trbv JMKM01007160.1 16872 GSFHDELEQSPSEVKRPGETVKISCITSGYRMTSYAVSWIKQKSGEALEWIGVMSTNTANAAYARSFQSRFSLTQDVSSSTQYLQIKSLTAEDSAVYFCA
Stegastes partitus V12 ighv JMKM01007160.1 18398 GVEDQTLTESESVVKRLGESHTLSCTGSGFRFSSYHMNWVRQAPGKGLEWIAFVHTGSSYIYYSQSVQGRFTISRDDSSSKVYLQMNSVRTEDTAVYYCA
Stegastes partitus V11 ighv JMKM01002238.1 3512 VWSEIRLEQSPSEVKRPGETVKISCITSGYRMTSYAVSWIKQKSGEALEWIGVMSTNTANAAYARSFQSQFSLTQDVSSSAQYLQIKSLTAEDSAVYFCA
Stegastes partitus V10 igkv JMKM01041781.1 73 SRGQVTVTQPGAVTSALGGSVTISCRTSQDVYSSNRLAWYQQKDGGVPKRLIYRASSRDSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQSFHSINSQDV
Stegastes partitus V9 igkv JMKM01040084.1 3967 SSAEISVTQSDGSQSVVPGQTVSITCRTSESVGGNLHWYLQKPGEAPKFLIYYVSTRQSGVSDRFSGSGSGTHYTLTISRVQTEDSGVYYCQQGYSP
Stegastes partitus V8 igkv JMKM01038902.1 63 SRGQTTLTQPGAVSSALGGSVTISCRTSQRVNNGNYFSWYQQRDGGAPKMLIYLASSRASGIPVRFTGRGSNTDFSLTISGVQTEDAAVYYCMAEFYINSQYS
Stegastes partitus V7 trav JMKM01038881.1 1798 EDKVIQPPGDVIAAEGDTVILDCTFETSSTGPTLFWYKQEVNNSPKHMMKTYSASLQKAPEFQEDRFHTGIQEKSVPLKIHKLQLSDSAVYYCALQ
Stegastes partitus V6 trgv JMKM01038540.1 137 QLIQDDLTLTRRVGQSVSFSCQQIDQCSSDYVFWYQKKETETFRLILRIDKSNGKIYSGYNHPQRDDFSAVNKQNGCELKIENVKLQHSATYYCYCWTG
Stegastes partitus V5 trbv JMKM01038442.1 346 SSVHEKVRQDPTDMFKNPEEKAKITCSHSVNNYYVILWYKQLKNRQLQLLGYMYKTNENKESGLDEDVTMEGSADKDQNCTLIINSVSVSSSAVYFCAAS
Stegastes partitus V4 trdv JMKM01036143.1 2506 TQPPEDIIAAEGDTVTLECTFESSYTTAQLNMLWYKQEVNGFPKYILRRGAYGDDNAPEFHKDRFDAQVNKKSVPLKIQKLQLSDSAVYYCALK
Stegastes partitus V3 trav JMKM01036141.1 2056 KVTQPPGDVIAAEGDTVTLNCTFDTIDLSPTLFWYKQEVNGSPQYMMKSFSKSVDKAPEFQEDRLHTGIQDKSVPLKIQKLQLSDSAVYYCALK
Stegastes partitus V2 trav JMKM01036140.1 108 IQPPGDVIAAEGDTVTLECTFDTSSMITQLNLFWYKQEVNGFPKYILRRGAYGDDNAPEFYKDRFDAKLNKTSVPLKIQKLQLSDSAVYYCALQ
Stegastes partitus V1 trav JMKM01007585.1 10637 KVIQPPGDVIDAEGDTVRLECTFETSYTNLDLFWYKQEVNGFPKYILKRGNYGNDNAPEFHKDRFDAKLNKTSVPLKIQKLQLSDSAVYYCGLR
Stegastes partitus V0 trav JMKM01007584.1 3359 IQPPGDVIAAEGDTVTLGCTFESSYTTAQLNVLWYKQEVNGFPKYILLRRGSYGDNAPEFQKDRFDAKLNTTSVPLKIQKLQLSDSAVYYCALK
Stegastes partitus V47 ighv JMKM01040417.1 429 ETTISPVEDEVSGTEGQSVTLRCNYETDDAVAYLHWYKHHSDIQAPQFILWKQGKGRSTENIPDERKYGSQTSDTSTTLTIRELALADTALYYCAVE
Stegastes partitus V46 trav JMKM01040063.1 1593 CKGEDKVIQPPGDVIAAEGDTVTLDCTFDTSDPSPALFWYKQEVNGSPQYMMKSYSKSVEKAPEFQEDRFHTGIQDKSVPLKIQKLQLSDSAVYYCALR
Stegastes partitus V45 trdv JMKM01040063.1 5615 LIAETTISPQQDEVSGTEGQSVTLSCNYETDDAVALLYWYKHHSDLQAPQFILWKQGKGGSAEHIPDKRKYGSQTSATSTTLTIRELTLADTALYYCAV
Stegastes partitus V44 trdv JMKM01039263.1 81 LIAGDTISPGQDEVSGTEGQSVTLSCNYEADNDGYTRRLYWYKHHSDLQAPQFILWKGAKGNRGENIPDKGKYESQTSATSTTLTIRELTLADTALYYCAVEK
Stegastes partitus V43 trav JMKM01038606.1 1821 NVMQPKGDVSLAEGEAATLDCLYNSTSSNPYLYWYKQDGNNSPKFLLSRVKLDEGNTADDFKERFLCTLNSTFRSAPLKIQKLQLSDSAVYYCAVR
Stegastes partitus V42 trav JMKM01037041.1 723 VGLGVEVHQTPAEVLRKLGDKVQLVCSHARTDYTLMLWYQKSPGEQTLKRIGHVNYGIIEHEKPFESNFNITGDMSGETAKKGSLFIVDLQAEHSAVYYCAASY
Stegastes partitus V41 trbv JMKM01037040.1 299 SSLSDKVDQNPPNMYKNPEEKAKIYCSHSIATWNRILWYKQSDRQLQYLGNMVAGSALPESGLDEDVTIGGSADEGRNCTLTINSVSVSSSAVYFCAAS
Stegastes partitus V40 trav JMKM01037037.1 942 VSLGLDVLQSPSDFVTKPGDKVQIFCSHDKTDYRVMLWYQQPPGETAMKLIGYLYHKAPTLEELYKKDFNISGDLSGSDKKKIPLTIQVVGLEQGAVYYCAASKAQ
Stegastes partitus V39 trav JMKM01037035.1 1694 FSLGVQVNQSPSAVFRKEGEEVQLICTHERSDYRVMLWYQKSPGDEALKLIGYGYTQFKDDGVEEPFRKHFKLAGNLSEDKKNGSLSIISLKVQEHTATYFCAASE
Stegastes partitus V38 trbv JMKM01037032.1 3880 QAESVTFKETQPIITNSKEKVEFTCSHDDGALNVMLWYQQTESGKMNLIGFGYYLSNPNYEKEFENRFKITRENIQTGGLVIDSVDASDSAVYFCAGSTQ
Stegastes partitus V37 trbv JMKM01037032.1 4443 QVSAVTFHQLPSRIVTESSEVHINCSHDDSSLIIMLWYQQKQDNTALTLIGFGYEMSENYEGQFEEQFKLTRRSATEGALMIKKANQSHSAVYFCAA
Stegastes partitus V36 ighv JMKM01037031.1 2146 VCFCVKIQQPPFVFSRDGDATGTLACEQDDSQYYYMFWYRQRNGGKIELVTYSLAKDDWKVEGPFNKSKYTMSRPSLLSSSLQIHPVKAEDSAVYYCASSR
Stegastes partitus V35 trbv JMKM01037026.1 2056 DGSDVTQTSIIWKNKGEDATIDCSQTKGVSYIQMYWYRQLPGDTLELVVFSTLLNNDFGGFSNKKFSANKTAAESGSLTVKNLHEGDQGWYFCAVG
Stegastes partitus V34 trav JMKM01036470.1 669 CKGEEVIQPPGDVIAAEGDTVTLNCTFVTSDRSPYLFWYKQKVNGYPKYMMKKLGSEPPYKAPEFQEDRFHTEIQDKSVPLKIQKLQLSDSAVYYCALR
Stegastes partitus V33 trav JMKM01036470.1 11482 VSCQQLTAVKDEESSSEGSTVTLTCKYTKGSADYFFWYRQHPGKPPEFLISHLESGQISLNPVPGLSATVRKEETQMDLKISSAAVTDSAVYYCAVR
Stegastes partitus V32 trav JMKM01036469.1 3859 MGSMNSIKPISTEQVVAEGRNIRLTCDYDGTIYSIQWYRQYQRSRPEFLLSITEGGSIHPTLSDFSAHINKTHKRVDLEIISAAVTDSAVYYCALE
Stegastes partitus V31 trav JMKM01036465.1 549 CKGEDKVTQSPEVVIAAERDTVTLDCTFKTSDTNPYVFWYKQEVNGFPKYILQRYTYGDDNAPDFHKDRFDAKLNKTSVPLKIQKLQLSDSAVYYCALR
Stegastes partitus V30 trav JMKM01036465.1 2354 SSEDVLTPFKDVLMALEGDTVTLSCNYSGSADYLFWYQQKSSSSPQLLIAEYTEKVERLSFKHDKQSKEFHLQISSAAVTDSAVYYCALR
Stegastes partitus V29 trav JMKM01036463.1 3472 CKGEDKVIQPPGDVIAAEGDTVILGCTFETTATSSDLFWYKQEFRFPKYILRRSTYGGDDNAPEFHKDRYDAKLNKTSVSLKIQKLQLSDSAVYYCALR
Stegastes partitus V28 trav JMKM01036463.1 6074 VRCQQLTAVKDEESSLEGSTVTLTCKYTKGSADYFFWYRQHPGKPPEFLISHSESGELLLNPVPGRSVTVKKQETQMDLKISSAAVTDSAVYYCAVR
Stegastes partitus V27 trbv JMKM01015908.1 1036 SSFSDKVRQTPANIYDKPGQTAKIQCSHNIPNYYRILWYKKLERQLQLLGYMDYGNASPEPGLDVKMDGDASQGRNCTLTIENLSVNSSAVYFCAAS
Stegastes partitus V26 trbv JMKM01015908.1 1802 SSQSDKVRQTPAELYYRPGEQAKINCSHSVQSYDQILWYKQSENDRMELLGYMVVNVGYIESGADVKIDGGANKDETCVLTMEGLSVNSSAVYFCAAS
Stegastes partitus V25 trbv JMKM01015908.1 3842 SSLRDQIYQIPANIYKNPGQSAKIHCSHSIESYDHILWYKQSKNNQMQLLGHMYGNSGLPETGLNVKIDGSAKKDQNSTLSIEGLSLSSSAVYFCAVR
Stegastes partitus V24 trbv JMKM01015908.1 6169 EISKNRVDQTPTALIKALGEEIQIQCNHSNSDFDMIQWYKQSPGKNDMVLLGHVRFNSPAVEDAFKNIYNVTGSGSSLSTFHIPKLRQSVDDAVYFCAASR
Stegastes partitus V23 trav JMKM01015907.1 12340 LTVVVLQSGEQICHQGDTRTLECSLGKGFSMASHTMYWYRQSHHGAQIEYLTKEHETPLGRFKSSINTAENKFSLQISELLVNDSSVYYCAASHSD
Stegastes partitus V21 trbv JMKM01015907.1 22766 GFSLGVQVNQSPSAVIRKEGDEVQMLCTHERRDYRVMLWYQQPPGEKAVKLIGHVEYAQINYEESYKKHFNITGDMSVNTEKNGSLFIVDVKASEHSAVYYCAARY
Stegastes partitus V20 trav JMKM01015907.1 26727 HCQDVTQSPDISWSFASQSAEMNCSHKKDFSYNQMYWYRQRPGETMRLIVYTAAGGQPDYGGVSQTKYTASKEKYDYGALTVKDLQPEDSGVYFCAVG
Stegastes partitus V19 trbv JMKM01015907.1 27904 SSLSDRVFQTPDHISKEPGEEAKMNCSHTIQGYDRILWYKQTRNSPPQFLGHVYVTVVNPEPGLDVQMEGSASEGQTCTLTVKDLSPNSSAVYFCAVR
Stegastes partitus V18 trbv JMKM01015907.1 29944 SSLSDKVDQKPSEMYIEAAKTANISCIHDIQDYTRIFWYKQSENHRMQLLGYMNVNQENLEDGVNVKMHGGATRGQTCTLTIKDASQSSSAVYFCAAS
Stegastes partitus V17 trbv JMKM01015907.1 31614 SSFSDKVRQTPANIYDKPGQTAKIQCSHNIPNYYRILWYKKLERQLQLLGYMDYGNASPEPGLDVKMDGDASQGRNCTLTIENLSVNSSAVYFCAAS
Stegastes partitus V16 ighv JMKM01015332.1 875 VWSEIRLDQSPSELKRPGETVKMSCITSGYRMTSYNIHWIRQRPGEALEWIGRMDTGNNAAIYGNSFQGRFLMTEDVSSSTQYLQIKSLTAEDSAVYFCARR
Stegastes partitus V15 trav JMKM01014463.1 6270 IQPPGDVIAAEGDTVTLGCTFETSAAVAQLNLFWYKQEVNDFPKYILRRSSYGGDDNAPEFHKDRFDAKLNKTSVPLKIQKLQLSDSAVYYCALR
Stegastes partitus V14 trav JMKM01014281.1 47439 QMDTLKIFASVHQQNRFLSGTTGDDVTLQCFYEGDAVMLYWYKQTLGQKPRLISTFYKHDINATFHNEFKGDPRFTLFAAKGENHLKITDLHASDSATYFCASSYL
Stegastes partitus V48 trdv JMKM01041224.1 84 GDTISPEQDEVSETEGQSVTLSCNYETASGYANLFWYKHQSDLQAPQFILWKEGKGGSDEHIPDKQKYGSQTSDTSTTLTIRELTLADTALYYCAV
Stegastes partitus V22 trbv JMKM01015907.1 14549 KVESVTFQQSPPQVVKEGTKELKIDCSHDGSSLQVMLWYQHKQSSRSMSLIGYTILQTDPVYESQFQGRFQLKRDNTMNGSLIINTATPSDSAVYFCAAS