WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Takifugu flavidus AOOT00000000.1 (AOOT01) 85 63 0 4 6 9 3 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Takifugu flavidus V3 ighv AOOT01103062.1 376 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMAWVRQAPGKGLEWISFIYHDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V2 ighv AOOT01101136.1 354 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYATNWIRQPAGKGLEWIGENCIGCTPYYKDSLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V1 trbv AOOT01100170.1 821 AADDKSVRQTPPSITKREGDALVSGINCSHQVSSFQVILWYKQDESRALKLLGYLNINFKNVEEDMKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu flavidus V0 trgv AOOT01066250.1 1046 LVVIETQLTQDQISVTSRAGESASISCGGINNCDYYVFWYQKKESGTFERLLNIDKSSSEIERYSHADQDDFSAKIQQNNCELIISSVKPSHAASYYCSCWKSG
Takifugu flavidus V40 trgv AOOT01040442.1 1423 LVVIETQLTQDQISVTRRAGESASISCGGIDDCNSNYVLWYQKKESGTFEVLLNIVKSNGKITRYSHAEKDDFSARIQQNNCELIIFSVKPSHAASYYCSCWKSG
Takifugu flavidus V39 igkv AOOT01012262.1 1009 ITSTPGSTVALTCKTNPAVHSRCYNGQSTSHCMSWYQQKPGQPPQLLVRHVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLGYNSDGT
Takifugu flavidus V38 ighv AOOT01124750.1 5684 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQVPGKGLEWIAYIYSSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V37 trbv AOOT01119926.1 181 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLEFQLLGYMFLNEPNVEKGGGVTIGGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu flavidus V36 ighv AOOT01117329.1 41 VDAQTLTQSEPVVKRPGESHTLTCSATGFTFSSYGMAWVRQAPGKGLEWIAYIYSSGSSYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V35 ighv AOOT01117320.1 1700 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYDTNWIRQPAGKGLEWIGWHRVGYTPSYKASLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V34 ighv AOOT01116179.1 498 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWIAYIYSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V33 ighv AOOT01115512.1 689 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYRMNWVRQAPGKGLEWIAFISNYGGSIQYYSESVKGRFIISRDDNKAQLNLQMNSLKTEDSAVYYCARN
Takifugu flavidus V32 ighv AOOT01115510.1 2406 ADAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMHWVRQAPGKGLEWISAIGTDSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V31 ighv AOOT01115510.1 902 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGCKYTGGSYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V30 ighv AOOT01115508.1 490 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDFGMHWVRQAPGKGLEWIAYIYSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARY
Takifugu flavidus V29 ighv AOOT01115507.1 468 VKSEQLTQPASVTVQPGQCLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V28 ighv AOOT01115506.1 286 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWISAISSGSSYKYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V27 ighv AOOT01115287.1 1494 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTNWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V26 ighv AOOT01114628.1 1275 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMNWVRQAPGKGLEWISAISTDSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V25 ighv AOOT01113776.1 5644 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISSPSGSDKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V24 ighv AOOT01113776.1 2805 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYRMNWVRQAPGKGLEWIAFISNYGGSIQYYSESVKGRFIISRDDNKAQLNLQMNSLKTEDSAVYYCARN
Takifugu flavidus V23 ighv AOOT01113776.1 506 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYYTNWIRQPAGKGLEWIGWHCFGYNPIYKASLKNKFIISSDPSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V22 ighv AOOT01113571.1 363 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYAMHWVRQAPGKGLEWIAYIYSSPEYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V21 trgv AOOT01113157.1 155 LVVIETQLTQDQISVTRRAGKIASIRCGGIDECGSYVLWYQKKESGTFEVLLDIYKSSSEITRYSHAEKDDFSARIQQNNCELLIFSVKPSHAASYYCSCWKSG
Takifugu flavidus V20 trav AOOT01111447.1 496 VSAVTVLTQKPTVVSLSRGESVTMDCNLGTGTNAAHWYKQVPGGVPQYVLSWYHGWSSVTYGSGFSSPRFTSTHQSTSDYRLMINNLEEGDSAVYYCQTWDGSAK
Takifugu flavidus V19 trav AOOT01110816.1 661 VSAVTVLTQKPTVVSLSRGESITMDCNLGTGTNYAGWYKQVPGGVPQYVLSWRSSWSSVDYGSGFSSPRFTSTHQSTSDYRLMINNLEEGDSAVYYCITWDDSAKENV
Takifugu flavidus V18 ighv AOOT01108467.1 480 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISAISTGSSTYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V17 ighv AOOT01108463.1 1534 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMHWVRQAPGKGLEWISLIYYDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARN
Takifugu flavidus V16 ighv AOOT01108002.1 130 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISDGGISQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V15 ighv AOOT01107973.1 678 VKGEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGWKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V14 ighv AOOT01107634.1 1523 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSFEMNWVRQAPGKGLEWISAISSSGSSTYYSASVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V13 ighv AOOT01107634.1 374 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMVWVRQAPGKGLEWISLIYTDGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V12 ighv AOOT01107548.1 684 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWIAYISSASSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V11 ighv AOOT01107546.1 497 VKGEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGYHRVGYTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V10 ighv AOOT01106447.1 322 VDDQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMVWVRQAPGKGLEWISRISSSGGSQYYSESVKGWFIISRDNNRAQLNLQMNNLKTEDSAVYYCARE
Takifugu flavidus V9 ighv AOOT01106446.1 1019 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGCKYTGASYDKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V8 ighv AOOT01106365.1 379 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISFIYTDGSYKYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V7 trbv AOOT01106145.1 374 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLELQLLGNMYNNNPNVEKESGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu flavidus V6 igkv AOOT01105530.1 967 VSAVTVLTQKPTVVSLSRGESVTMDCNLGTSTDAGRWYKQVPGGVPQYVLSWYHGWSSVDYGSGFSSPRFTSTHQSTSDYRLMINNLEEGDSAVYYCQTWDGSASEGV
Takifugu flavidus V5 ighv AOOT01105236.1 201 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWIAYIYSSGSSYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V4 trav AOOT01104663.1 702 VSAVTVLTQKPTVVSLSRGESVTMDCNLGTVTNSAARWYKQVPGGVPQYVLSWHSSWSSVTYGSGFSSPRFTSTHQSTTDYRLMINNLEEGDSAVYYCGTWDGNTVV
Takifugu flavidus V78 ighv AOOT01117907.1 151 VKCEQLTQPAFVTVQPGQSLTITCQVSYSLRSYWTSWIRQPAGKGLEWIGYNGVGWTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V77 ighv AOOT01117906.1 650 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMHWFRQAPGKGLEWISAISTDGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V76 trbv AOOT01117448.1 509 AADDKSVRQTPPSITKREGDALVSGINCSHQVSSFQVILWYKQDESRALKLLGYLYTNNQNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu flavidus V75 trbv AOOT01117443.1 934 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLELQLLGNMYNNNPNVEKGSGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu flavidus V74 igkv AOOT01116710.1 1069 ITSTPGSTVALTCKTNPAVGSGCYNGQSNSDCMFWYQQKPGQPPQLLVRNVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLG
Takifugu flavidus V72 ighv AOOT01116370.1 315 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISDGGISQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V71 ighv AOOT01116369.1 432 VKGEQLTQPASVTVQPGQRLTITCQVSYSLNSYGTNWIRQPAGKGLEWIGSNCAGCTPGYKVSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V70 ighv AOOT01116369.1 2040 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWISAINTDGSIQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V69 trbv AOOT01116101.1 510 AADDKSVRQTPPSITKREGDALVSGIKCSHSISSYDRIYWYKQDESRALKLLGYLNTNFKNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu flavidus V68 trbv AOOT01116097.1 1129 ATDTKSVSQKPSFTILRTGEFVVSEINCSHSINSYDRIYWYKQDESRALKLLGYLNTNIQNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu flavidus V67 ighv AOOT01116002.1 435 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISAISNGGSSQYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V66 ighv AOOT01114394.1 405 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISRISSGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V65 ighv AOOT01114319.1 2289 VDAQPLTQSEPVVKRPGESHTLTCSASGFTFSDYGMNWVRQAPGKGLEWIAYISSSSSYKYYSESVKGRFLISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V64 ighv AOOT01114319.1 3671 VKCEQLTQPASVTVQPGQRLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V63 trbv AOOT01112230.1 243 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNQIFWYKKSNLELQLLGNMYANNPNVEKGSGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu flavidus V62 trbv AOOT01112230.1 921 AADDKSVRQTPPSITKREGDALVSGIKCSHSISSYNQIYWYKQDESRALKLLGYLYTNNQNMEEDMKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu flavidus V61 ighv AOOT01111961.1 176 VKGEQLTQPASVTVQPGQRLTITCQVSYSLSSYDTNWIRQPAGKGLEWIGYHGVGYTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V60 ighv AOOT01111112.1 728 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWISAINTDGSIQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V59 trav AOOT01110815.1 109 VSAVTVLTQKPTVVSLSRGESVTMDCNLGTVTNSAASWYKQVPGGVPQFVLYWHRSLSSVTYGSGFSSPRFTSTHQSTTDYRLMINNLEEGDSAVYYCQTWDGNTVV
Takifugu flavidus V58 ighv AOOT01110507.1 403 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDFGMHWVRQAPGKGLEWISLISYPSGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V57 ighv AOOT01110507.1 1457 VKSEQLTQPASVTVQPGQCLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V56 ighv AOOT01110300.1 46 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTSWIRQPAGKGLEWIGHHRIGYNPVYKTSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V55 ighv AOOT01108687.1 1225 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYWMAWVRQAPGKGLEWISFIYHDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V54 ighv AOOT01108687.1 2475 VKGEQLTQPASVTVQPGQRLTITCQVSYSLSSYYTNWIRQPAGKGLEWIGYHRVGYTPFYKASLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V53 ighv AOOT01105622.1 1195 VKCEQLTQPASVTVQPGQGLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSSTVTLNGVNVQPEDTAVYYCARE
Takifugu flavidus V52 ighv AOOT01105323.1 730 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTNWIRQPAGKGLEWIGAHRVGYNPVYKASLKNKFSISSDSSSKTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V51 ighv AOOT01105214.1 146 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMSWVRQAPGKGLEWISDIKYDGSTKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V50 igkv AOOT01104793.1 2509 ITSTPGSTVALTCKTNPAVASGCYNGQSNSDCMGWYQQKPGQPPQLLVKHIINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCQSYHSGDV
Takifugu flavidus V49 ighv AOOT01100574.1 4004 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYEMNWVRQAPGKGLEWIAYISSSSSYKYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V48 ighv AOOT01100574.1 5392 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGWNSVGSTPRYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V47 ighv AOOT01098669.1 3208 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYDMAWVRQAPGKGLEWIAYIYSSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V46 trav AOOT01096465.1 1536 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTGSSPNLFWYKQDGTSRPQFILSRFKGDTGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu flavidus V45 ighv AOOT01095614.1 842 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDHYMNWVRQAPGKGLEWISRISSSGGSKHYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V44 ighv AOOT01095614.1 2232 VKCEQLTQPASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTI
Takifugu flavidus V43 ighv AOOT01087406.1 157 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSGYWMAWVRQAPGKGLEWISGIYTDGSSQHYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu flavidus V42 ighv AOOT01087405.1 2170 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMSWVRQAPGKGLEWISDIKYDGSTKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V83 ighv AOOT01128312.1 1981 VKGEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu flavidus V82 ighv AOOT01128301.1 1960 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFRSYWMVWVRQAPGKGLEWIAYISSGSGSSQYYSESVKGRFIISRDNNKAQLNLQMNSMKTEDSAVYYCARY
Takifugu flavidus V81 ighv AOOT01128300.1 258 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTGWIRQPAGKGLEWIGNGVGSSTYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu flavidus V80 ighv AOOT01128299.1 263 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMHWVRQAPGKGLEWISLIYYDGSNKYYSESVKGRFLISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu flavidus V84 ighv AOOT01128312.1 619 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYEMHWVRQAPGKGLEWIAYIYRSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu flavidus V79 ighv AOOT01117908.1 79 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDYWMSWVRQAPGKGLEWISAISTDSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARN
Takifugu flavidus V73 trav AOOT01116581.1 55 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSDPSPYLFWYKQDGTSRPQFILSRVKGDKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu flavidus V41 ighv AOOT01087404.1 87 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYWMYWVRQAPGKGLEWISLIYTDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE