WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Thunnus orientalis BADN00000000.1 (BADN01) 29 9 0 5 7 7 1 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Thunnus orientalis V28 trav BADN01131812.1 33 VDAAIVVTQTPAVHTVSTGQEVVLNCNIQRYDNAYVNWYKQVPGKAPQFVLGFYYGSSSLSFGTGFSSDRFNSRSSSNIDYQFIIKRAEAGDSTVYYC
Thunnus orientalis V27 ighv BADN01131256.1 455 LNGQAMESIPSTSVLKKPQEALSLSCRGTGFDFSQFGMHWIRQPAGKTLEWLGLIYYDASKTVYASGVQGRIEITRDNSNSMVYLRLSNLKPEDSAVYYCAR
Thunnus orientalis V26 igkv BADN01130128.1 2262 SRGQYTVNQPAAVRSALGGSTTINCRTSQDVYGSNHLAWYQQRDGETTKLLIYLATYRASGIPDRFTGSGSKSDFTLTIGGVQAEDAAVYYCQS
Thunnus orientalis V25 ighv BADN01128506.1 628 VDGQTLTESEPAVKKPGESHKLTCTTSGLSFSSNWMAWIRQAPGKGLEWIATIRYDSAYIYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARY
Thunnus orientalis V24 igkv BADN01126457.1 1793 QITVTQPAAVRSALGGSATINCRTSQDVHVSGSSHLLAWHQQRDGETPKLLIYYATTRASGIPDRFTGSGSKSDFTLTISGVQAEDAAVYYCQS
Thunnus orientalis V23 trbv BADN01124078.1 122 SSLSDKVYQTPADMYNEPGQQAKINCSHSIENYNQILWYKQLKNRNLQFLGYMSSTLGTPEDGVNVKIEGSANKEKTCTLTIEGLSLNSSAVYFCAAS
Thunnus orientalis V22 trbv BADN01124078.1 1889 SSLSDQVYQTPAHMCSKPGEQAKINCSHSIDNYYRIYWYKQLNKQLQFLGYVYLNKGYPESDVDVTMSGGADKGQTCTLTIEGLSLNSSAVYFCAAS
Thunnus orientalis V21 igkv BADN01119902.1 2619 SSGEITVTQSPGSQSVVPGQTVSIRCKTSSYVSSWLNWYLQKPGEATKLLIYWATNLQPGVSDRFSGSGSGTDFTLTISGVQAEDSGVYYCQQGKGYP
Thunnus orientalis V19 trav BADN01118109.1 405 WISVSVSESQVVEVQSGEEVTLQCINRLIYGSVAFWFRLVNRTKINCISVMIRSGSEAELCDGFQKGKFEMSSNISTVSLNIKQVDSSDSGLYFCGF
Thunnus orientalis V18 igkv BADN01116223.1 859 ASPSVTQSPASKAVSLGETVSLSCSASTGVDDDLSWYLQKPGQPPKLLFYKISSSQSDTPSHFSSSGSEPEFTLTISGVQAEDSGDYYCMGVYRGPV
Thunnus orientalis V17 trav BADN01113815.1 252 FSVCVKIQQLPFLISREGDKTVTLECEQDDKQYYNMYWYRQSSSGEKIQMVSFSAGQGSTNIEAPFNDSKYTMTRPEVLNSSLVIHSAEAGDSAVYYCASSI
Thunnus orientalis V16 trav BADN01059816.1 6927 LIQTAEVPHPISLTVVEVGGNVTLQCPVSEKEDVFFNWYKQSLGYMVQTVATRTYTQIKLVGQFENSRFQVTQGYNEYLLTIRNVSKEDEATYFCQNGTAY
Thunnus orientalis V15 ighv BADN01132951.1 1312 VDGQTLTESEPVVKNPGESHRLTCTASGFTFISYHMNWVRQAPGKGPEWIAFIHTSSSSTSYSQSVQGRFTISRDDASSKLYLQMNSLKSEDTAVYYCAR
Thunnus orientalis V14 ighv BADN01129587.1 743 VNCEQLTQPASVTVQPGQRLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGSARVGYTTAYKDSLKNKFSIDLDSSRNTVTLNGQNVQPEDTAVYYCARD
Thunnus orientalis V13 ighv BADN01128991.1 602 VDGQTLTESEPAVKQPGESHKLTCTTSGFTFSDYSMIWVRQAPGKGLEWVAYIRYDSSKISYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARW
Thunnus orientalis V12 ighv BADN01124677.1 1113 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMRDTRGSYYKDSLKNKFRIDLDSSSNTVTLNGQNVQPEDTAVYYCARY
Thunnus orientalis V11 ighv BADN01118175.1 275 VKCEQLTQPASVTVQPGQGLTITCQVSYSLSSYYTHWIRHPTRKELEWMSYDTTVKDSLKNRFSVNLDSSSNTVTLNRQNVQPEDTAVYYCTRQ
Thunnus orientalis V10 trgv BADN01113403.1 215 DLIQEDLTLTKKAGETVYFRCGGTNQCDRNNVYWLQKKDTETFTVILNIDKSNCKIDKGYNHPQKDDFLAVKKPKGCELKIQKVQLSHSATYYCSCWKDG
Thunnus orientalis V9 trav BADN01110189.1 2458 FSVCVKIQQLPFLISHEGAKTVTLQCEQDDEQYYYMYWYRQSSGGEKIQLVSYSTSQGSTNIEAPFNDSKYTMTRSTLLNSSLVIHSAEAGDSAVYYCASSI
Thunnus orientalis V8 trbv BADN01110187.1 686 QVNAVTFLQSPPQIVKESNEVQINCSHDDTSLLLMLWYQQTGSGLINLIGSSYSGSDPKYEKQFEGQFEITRKDTQTGALNIGSVNLSDSAVYFCAAS
Thunnus orientalis V7 trbv BADN01110186.1 790 SSLSDQVHQTPAHMNNKTGETAKISCSHSIQSYNQILWYKQLEDRQLQYLGYMLRKNGNPEPGVDVTMEGSAEKEQTCTLTITRLALNSSAVYFCAAS
Thunnus orientalis V6 trbv BADN01110185.1 159 STLSDQVYQTPAHMYNNTGETAKISCSHSIQSYDTILWYKQFNKQLQFLGYVYSNKGYPESDVDVTMEGGADKGQTCTLTIKELNSSAVYFCAAS
Thunnus orientalis V5 igkv BADN01090878.1 272 SSGEIILTQSPGSQSVVPGQTVSLRCKSSYSTSYLHWYLQKTGEAPKLLIYKATNRQPGVSDRFSGSRSNTDYTLTISGVQAEDSGVYYCQQISSFP
Thunnus orientalis V4 trav BADN01030999.1 25429 FSCSVKIHQPPFVLSQADTSVTLHCEQDDEEYAYMYWYRHIGSREMQLVTYSLGKQICATEAPFNKSKHAMSRPVVLTSSLQIHHVEAGDSAVYYCASRL
Thunnus orientalis V3 trbv BADN01030999.1 22814 QVNGITIHQSLPQIVKESTEVHISCSHDDSDRQVMLWYQQRRDSQSIILIGFGYGSGDQTYEGKFKEQFELRRDSTLKGALIIRRANPSHSAVYFCAAS
Thunnus orientalis V2 trbv BADN01030999.1 19657 ASPKQSKDVHQTPAHLLYKINDEVKLTCKHRIKDYDTILWYHQSQADTSIELVGFTSYTSTQTVEKPYQGSFNVSGNGESEAFLHLLKLRHPKDSGLYFCAASR
Thunnus orientalis V1 trav BADN01030999.1 16703 GCLGIEIHQSPPVLIRSPGNAVHLICTHEDTNYRVMLWYQQPRGQTAMKLIGYVNYNNIIVEPPYEQNFNISGDLSGNDAKNVSLMIQLSGSEDSAVYYCAARD
Thunnus orientalis V0 ighv BADN01030999.1 9843 HSLSKEVHQVPAAILGHLHDSATMNCSHFISSYDTVLWYQQSLGDSELKLIGYAFYGSHIIEKSFGNNSFKVTGDGSKKAELHVLKLRDPEDSGMYYCAAS
Thunnus orientalis V20 ighv BADN01119496.1 221 VDGQTLTESEPVVKKPGESHRLTCTTSGFTFSSYRMVWVRQAPGRGLEWIAYISTASTPIHYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR