WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Xiphophorus couchianus LNCC00000000.1 (LNCC01) 80 28 0 23 17 11 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Xiphophorus couchianus V4 ighv LNCC01017517.1 745 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGSYYTAWIRQPAGKGLEWIGMKYTGDSFYKDSLRNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE
Xiphophorus couchianus V3 ighv LNCC01017516.1 3706 VKCEQLTQPASVTVQPGQRLTISCQVSYDLSYYTAWIRQSAGKGLEWIGMKDSYGTVHFKGSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR
Xiphophorus couchianus V2 ighv LNCC01017515.1 4852 CTGQRMESIPSSSVVKKPGETLSLSCRGSGFTFSDYLMHWIRQPAGKGLEWLGFGSSNPSNNRYASGLSGRIEVRKDSSNSMTHLTLSNLKPEDSAVYYCAAE
Xiphophorus couchianus V1 ighv LNCC01017515.1 3155 QRMESIPSSSVVKKPGETLSLSCRGSGFTFTDYVMAWIRQPAGKGLEWIGSGYSTNSRNTYASSVSGRIEISREDSNSMTHLRLSNLKPEDSAVYYCAI
Xiphophorus couchianus V0 trbv LNCC01016957.1 8387 LVCNSRIQQSLPQIVKENAQVQIQCSHEDKTRPFMLWYQQRDHGQPVVFIGYEYGTKAQIYGGQFEEQFKMKRENSLTGILTVLSANLSHSAVYFCAIT
Xiphophorus couchianus V41 igkv LNCC01025036.1 7606 CSLTNDVQQDPPAILGTLQGPATITCSHSVSTFNVILWYQKPTGGSALQLVGHTLYENPTVEPEFNGRFSIKGDGSKKSELRVEKLQPEDSSIYYCAAS
Xiphophorus couchianus V40 trav LNCC01025034.1 2262 VSIGLRIDQPPSLLPEVGQQAVNLKCEQDDEQYLNMYWYRQISSSSSMELVAYSLGKDISTIEAPFQDTKYSMSRPSTLTTTLQINKAEPGDSAVYYCASSK
Xiphophorus couchianus V39 trbv LNCC01025033.1 1230 SSLSDQVFQVPDHILRKPGESATIRCSHAIPSYDRVLWYKQSTQLQFLGHMYKNMDNPEAGLGVKLGGNAEKDLNCTLTLEVLNPNSSGVYFCAAR
Xiphophorus couchianus V38 trbv LNCC01025032.1 1829 SSLGDRVVQLPANILKTSGEATVIKCSHQVPNYDRILWYKQSEDQQMQYLGYMNVNDGYPETGVKVKIDGGATEGKTCSLTIEGVDTSSSGVYFCAAS
Xiphophorus couchianus V37 trav LNCC01025029.1 3940 SSPSDQIVQIPADMFKNPGETAKISCSHSIPDYDRVLWYKQSKLHEMKLLGYMLGDNGYPEKELNVNIDGSANRDKNSTLTVTELSPDSSAVYYCAAR
Xiphophorus couchianus V36 trbv LNCC01025029.1 2496 SSLSDRVHQTPADLFHESGGNAVISCTHSIDNYDVILWYKHSTSSQMQLLGYNDVVNGYPEQGLKVKISGSASKDKISTLTVEDLSESSSAVYFCAAK
Xiphophorus couchianus V35 trbv LNCC01025029.1 777 SSLNNQVHQTPFNILAKRGEAARISCSHNIQNYNVILWYKRLEDKQLQLLGYMYIDNKNPEPGTDVKMELEGNANKGETCTLVIKELSEKSSAVYYCAARYHSAE
Xiphophorus couchianus V34 trbv LNCC01025028.1 272 DQSKNSVDQIPAALIKEPGESVQINCNHSNTNFDMIQWYKQPPGKTDMTLLGYARYTTQTVENQFQNLYNVTGSGSSLSSLVIPKLRQSEDSAVYFCAASD
Xiphophorus couchianus V33 trbv LNCC01025022.1 13683 VDQTPPSIIKKSGESVDKEIRCSHSIPSYQVILWYKQDKHKALKLLGYLNNVFATLEQDVKGKINFEGDGRQQSNLTVSNLTVDDSAVYFCAAS
Xiphophorus couchianus V32 trbv LNCC01025022.1 9713 ASDSKDVDQTPPSIIKKTGESVDKEIRCSHSIPSYQVILWYKQDKHKALKLLGYLNLEYPNIEEDVKGKISFEGDGRQQSTLTVSNLTVDDSAVYFCAAS
Xiphophorus couchianus V31 trav LNCC01025022.1 6969 VALGLEVRQSDSDLIRNPGENVQVFCSHDKTDFRTMLWYQRQPGKTSLNLIGYLNYQASTMEDVFNKGFSLHGDLGGSGAKNGSLLIQKVEREHSAVYYCAASK
Xiphophorus couchianus V30 trbv LNCC01025022.1 5125 SSPNDKVGQHPADMFKSPSDSEAEIQCSHSDDNFNQILWYKQSDGDLQLLGWMYAGTETLEKEVKVKIDGGANKGEMCTLKIKDLNRNSSAVYFCAAR
Xiphophorus couchianus V29 trbv LNCC01025022.1 1322 ASDSKHVGQTPPSVIRKTGESVDKEIRCSHSIPNHDVILWYKQDENRTLKLLGYLNLNHVAVEEDAKKTISFEGDGRTHSDLTVADLTADDSGVYFCAARY
Xiphophorus couchianus V28 igkv LNCC01024692.1 2829 LAANPSVTQSPAVKSAALGETVSLSCSASKGVDDDLSWYLQKPGQPPKLLFYKISSRQSDTPSHFSSSGSEPQFTLTIGGVQAEDTGDYYCMGAYIGL
Xiphophorus couchianus V27 ighv LNCC01017544.1 8893 VVSQTLTQSESVIKRPSENHKLTCTASGYTFSSYSMHWVRQAQGKGLEWVAYIRNDGSLIYYSPSVQGRFTISKDNSRQQVYLQMNSLKTEDSAVYYCA
Xiphophorus couchianus V26 ighv LNCC01017544.1 6904 ARGQSLTSSEPVVQRPGHSVTLSCKVQGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSFQGQFSITKDTSQNTVSLTVKSLKPEDAAVYYCARE
Xiphophorus couchianus V25 ighv LNCC01017544.1 5335 QTIRESEPAVKNPGESHRLTCTTSGFRFSGSVWVWIRQPPGKGLEWIALVHTSSRPIYYSDSVQGRFSISRDDSSSKVYLQMNSLKTEDSAVYYCARR
Xiphophorus couchianus V24 ighv LNCC01017544.1 1063 VFCIDLIQPDSKIVQPGQSLTITCRVSGYLLTDSSYATSWIRQREGKTLDWILTMWSDGSVAPNNALKNKFSSNRDTSAGTITITGQTLQPEDTAVYYCVRI
Xiphophorus couchianus V23 trav LNCC01017542.1 69 VKTPGESLSLSCRGSGFTFSCCWMNWIRQPAGKPLEWMGFIYTDGSGTQHSSSLQGRIGITRDNSKNMVYLTLSNLRPEDSAVYFCAKE
Xiphophorus couchianus V22 ighv LNCC01017535.1 2315 VYYIDLIQTDSQLVQPGQSLTITCQPSGYSVTDYSYATGWIRHREGKPMEWIFEMWGGGNFYNNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Xiphophorus couchianus V21 ighv LNCC01017534.1 3616 VKCEQLTQPASVTVQPGQPLTISCQVSYSVTSYWTAWIRQPAGKELEWIGDAKGSSTGYKDSLRNKFSISTESSSNTVTLKGQNLQPEDTAVYYCAR
Xiphophorus couchianus V20 trav LNCC01017534.1 1102 VWGEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTNYGMNWIRQKSGKGLEWIGWINTHTVVATYASSFQSRFTFTQDVSSNTQFLQITGLTTEDSAVYFCAR
Xiphophorus couchianus V19 ighv LNCC01017532.1 2520 VKCEQLTQPASVTVQPGQHLTISCQVSYYVSSYQTHWIRQPAGKGLEWIGYMCTGCTGARKDSLKSKFSITVEESSKTVTLNGQNLQPEDSAVYYCARY
Xiphophorus couchianus V18 ighv LNCC01017531.1 2622 VKCEQLTQLASLTVQPGQTLSLNCLVSYSVTSYGTHWIRQPAGKALEWMGVVWSSGRNDYATNVQGRIGITRDTTKNIVYLTLSTIKPEESAVYYCAK
Xiphophorus couchianus V17 ighv LNCC01017531.1 1438 VKCEQLTQPASVTLQPGQTLTISCQVSYSVRSYYTHWIRQPAGKGLEWIGRAADGSTTYYKDSLKNKFSLSAHSSSNTVTLNGQNMQPEDSAVYYCARE
Xiphophorus couchianus V16 ighv LNCC01017531.1 33 VKCEQLTQPASLTVQPGQTLSISCQVSYDLSSYHTHWIRQPAGKAPEWMGVIWSGGSNAYATNVRGRIEITRNTNEKIVYLSLSAMKPEESAVYYCARE
Xiphophorus couchianus V15 ighv LNCC01017530.1 368 VKCEQLTQPASVTLQPGQTLTISCQVSYSVTGYWTHWIRQPAGKGLEWIGQAIGSSTYCKDSLRNKFSISTDSSSNTVTLNGQNVQPGDSAVYYCARE
Xiphophorus couchianus V14 ighv LNCC01017529.1 4644 VRCEQLTQPASLTVQPGQTLTISCQVSYSLTSYQTVWIRQPAGKALEWMGIIWSSGSKDYASSLQGRIEITRDTNKKIVDLRLSTMKPEESAVYYCA
Xiphophorus couchianus V13 ighv LNCC01017529.1 2961 VKSEQLTQPASLAMQAGQRLTITCQVSFSVSTYRTNWIRQPVGKGLEWIGSAHIGYPTFYKDSLKNRFSMTLQDSSKTMTLNGQNMQPEDSAVYYCARY
Xiphophorus couchianus V12 trav LNCC01017529.1 359 VKCQQLTQPASATVQSGQRLTISCHVSYSLSTWTHWIRQPAGKGLEWIGYTCSVCTPVYKDSLTNKFSFTVDSSSNSFTLNGQNLQSQDSAVYYCARGPTVT
Xiphophorus couchianus V10 ighv LNCC01017525.1 406 VGGQTLTESEPVTKRPGESHTLTCTASGFTLSSYYMAWVRQAPGKGLEWIAYIGTYSSPIHYSQSVQGRFIISRDNSNSKIYLKMNQLKAEDTAVYYCARR
Xiphophorus couchianus V9 ighv LNCC01017524.1 2816 LKGEQLNQLPSMTVQAGRSVSITCQVSYSISSYYTDWIRQPAGKGLEWMSRDTTIKDSLQNKFSVNLDYSNNRVTLYGQNMKPEDTAVYYCAREG
Xiphophorus couchianus V8 ighv LNCC01017523.1 6287 VCCQTLTESDPAVKSPGESHRLTCTTSGISFSSYWMNWIRQAPGKGLEWLAIIRYDSREIYYSQSVQGRFTISRDNSREQLYLQMNNLKTEDSAVYYCARG
Xiphophorus couchianus V7 ighv LNCC01017523.1 4679 VAGQTLTESESVVKTQGESHKLTCTASGFSINGWWMNWIRQAPGKGLEWVAAHYDNSNLYYSQSVQGRFTISRDNSKQQLYLQMNGLRTEDSAVYYCAR
Xiphophorus couchianus V6 ighv LNCC01017522.1 2005 IKCEQLTQPASETVLPGQRLTISCQVSYSMSSYATAWIRQPAGKGLEWIGWKYTGGSYYKDSLRNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARESQ
Xiphophorus couchianus V5 ighv LNCC01017519.1 1832 NDGQTLTESESVIKRPGESHRLTCTYSGFGYNPDIVWVRQAAGKGLQWIAYINSGGGTSHSDSLKTRFTISRDNSRSQVYLQMNSLAAEDSAVYYCPRR
Xiphophorus couchianus V78 igkv LNCC01069089.1 146 SSGDIILTQTPGSQSVAPGQTVSITCKTSSSVNNYLHWYLQKPAEAPKLLIYGATARQSGVPARFSGSGSVSDYTLTISGVQAEDSGVYYCQQSSSFP
Xiphophorus couchianus V77 igkv LNCC01067301.1 366 QITVTQQPAAVRADLGRSATITCRTSQNVYNNNYLHWYQQKDGQTPKLLIYYTSTKASGTPSRFSGSGSNSDFTLTISEVQAEDAAVYYCQSFHYPNSQYV
Xiphophorus couchianus V76 igkv LNCC01067301.1 2225 TQQPAAVRTDLGGSVSIRCSISQDVYVHNTVHRLVWYKHKEGQSPKLFIHSAIHRSAGTPQRFSGSGSHSEFTLSIRGVQTEDATVYYCQSQ
Xiphophorus couchianus V75 trav LNCC01067255.1 1226 CKGDSVKQTEGEVVAAAGESLTLRCTYETSYAATLFWYKLEVNSYPKFMLKRFSTGGDNAPGFKKDKFDAQHEKTSFNLKIQDPQVSDSAVYYCALQPTVTG
Xiphophorus couchianus V74 trdv LNCC01067255.1 5761 QSLEADITAIRSEIFPSEGDRVTLSCNYSVKADNLQWYRQDPGSAPRFLLLITDTKDPTVVEAEPPNPRLTAGLNKERNRVDLLISSAAVTDSAVYYCALQ
Xiphophorus couchianus V73 trav LNCC01067255.1 14802 VNCQQLTAAKTEEFSSEGSSVTLTCSYTKDSAQVLFWYQQNPGEPPEFLRSHSPFGGSEHLDRMTFKGSKEEMSMKISSAAVTDSAVYYCAVR
Xiphophorus couchianus V72 ighv LNCC01066089.1 23 TDGQTLTESESVVKRPGESHRLTCTYSGFGDDDNNAWIRQAPGKGLEWISYISWNSGSIYYSDSVNGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Xiphophorus couchianus V71 trav LNCC01065779.1 3460 CKGDSVKQTEGEVVATAGESLTLRCTYETISVTPTLIWYKLEENSFPQYILKQQTLTTYKALDFDSSRFDANLNKTNKSFNLKIQDLRLSDSAVYYCALQPTVTG
Xiphophorus couchianus V70 trav LNCC01065779.1 8351 QTDGVLQPERDVMAAEGGSATLNCLYNTSASNHYLYWYRLEEGSSPIFILSRFKIGDGKTVEKRFSSSLDATARSVPLTIQDLRPSDSAVYYCALQPTVTG
Xiphophorus couchianus V69 trav LNCC01065032.1 1798 CKGDSVKQTEGEVVATAGESLTLRCTYETSVSVTLFWYKQEGNSFPKYMLKEYVKLPDNAPEFSKDRFDAKVNNSAFDLKIHNLHPSDSAVYYCALQPTVTG
Xiphophorus couchianus V68 igkv LNCC01064903.1 141 SSGDIILTQTPGSQSVAPGQTVSITCKTSSGVYNNLHWYLQKPAEAPKLLIQYATTLQSGVPARFSGSGSVSDYTLTISGVQAEDSGVYYCQQGYDRP
Xiphophorus couchianus V67 igkv LNCC01063733.1 1001 QYTLTQPSAVRAELGGSATINCRTSQNVHGSNYLAWYQQKDGQTPKLLIYYASTKASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Xiphophorus couchianus V66 igkv LNCC01061712.1 1922 VRCQYTLTQPAAVRADLGGSATINCRTSQNVYGSNRLAWYQQKDGQTPKLLIYYASTKASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Xiphophorus couchianus V65 igkv LNCC01061711.1 2450 SSGDIILTQTPRAQSAVQGQTVSIRCKSDRLIGDDINWYLQKPGEAPKLLIYDTTERQPGVPERFRAKAEQTDFTLTISGVQAEDAGVYYCQQHNSFP
Xiphophorus couchianus V64 igkv LNCC01061710.1 482 SSAVITLTQTPGSQSVTPGQTVSFSCKASSPVDDDLHWYLQKSGAAPKLLIYSASSRWTGVSDRFTGSGYDIDFTLTISRVQAEDAGVYYCQHDENFP
Xiphophorus couchianus V63 igkv LNCC01061709.1 360 TQQPAAVRADLGGSATINCRTSQNVYVYNSNHRFGWYQQKDGQTPKLLIYDASTRTSGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Xiphophorus couchianus V62 igkv LNCC01058266.1 473 QVTVTQQPAAVRAGLGGSATINCRTSQNVYGSNRLAWYQQKDGQTPHLLFYYVGSRVSGTPNRFNDGGSNSDFTLTISGVQAEDAAVYYCQSFHVISSQYV
Xiphophorus couchianus V61 trav LNCC01056031.1 13951 FRAATLPTVLVGVGEDATLHCPLLDGSNGTSNSADPATLSWYRKAAGGGPTLLLSLSPANGSVVRYGDGVGPQKVSAAANGSLVLHGSEPSDSAVYYCGI
Xiphophorus couchianus V60 trav LNCC01017836.1 8487 VSGATVLTQKPPVLTVRKGETATMDCNLGSVVNTVYWYKQIPGGVPQWVLYFYHSWSSPSYGSGFSSPKFTSTHQSTTDYRLIINNAEEQDSAVYYCKTWENNKAV
Xiphophorus couchianus V59 trav LNCC01017836.1 12267 VRGATVVTQTPPVVTVRKGETATMDCNLGSVTGESARWYRQIPGEVPLYMLRVRHDWSAPKYDTGFPSSRHTATHQSTSDYRFRISNVEEGDSAVYYC
Xiphophorus couchianus V58 ighv LNCC01017549.1 1278 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIEYDSIGKYYSQSVQGRFTVSRDNSREQLYLQMNSLKAEDSAVYYCARA
Xiphophorus couchianus V57 trav LNCC01012400.1 7947 LAPSSSGLGFEAVNVGRDVTLKCSYQENSAIGVYWYKQSPGRKPQLMSEFLKHARNGSMKSPFNNDPRFQQDTGVGKNNLKISNVQMSDSAVYYCVS
Xiphophorus couchianus V56 igkv LNCC01012399.1 6073 LAPSSPLDFKSVRVGQNVTLKCFYQGSNGPIFYWYKKSMGKKAQLMSEFYKHKQNGSLHSDLITGDPRFKPEPGSGEFHLKILNAQVSDSATYYCVSLF
Xiphophorus couchianus V55 igkv LNCC01010388.1 1731 TQQPAAVRAGLGGSVTINCRTSQNVHVHLSSFPCLAWYQQKDGQTPKILIYLSSTKESGTPSRFSGSGSHSDFTLTISGVQAEDAAVYYCQS
Xiphophorus couchianus V54 igkv LNCC01073969.1 574 QVTVTQQPVAVRADLGRSISINCRTSQNVYVNSNGHRLAWYQQKDGQTPKLLIYYASTRASGTPSRFTGSGSNSDFTLTIIGVQAENAGVYYCQS
Xiphophorus couchianus V53 ighv LNCC01073936.1 5169 LSLSKDVHQDPPSTLSSPQSPATISCSHSISGYYVILWYQKPIGGSALKLIGYIANTSPTLEKEFEDRFTISGDGSKESELEVQELQPEDSSMYYCAAS
Xiphophorus couchianus V52 igkv LNCC01073924.1 69 SDGQNIVVTQPAAKSVQLGQTVIIDCKASVQLTGCNTPCLSWYHQKSGEVPKALIYRTSSRFSGISSRFSGSGAGNGLDFTLTISGVQAEDAGVYYCQS
Xiphophorus couchianus V51 igkv LNCC01069882.1 167 QITVTQQPAAVRADLGRSATITCRTSQNVYNNNYLHWYQQKDGQTPKLLIYYTSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Xiphophorus couchianus V50 igkv LNCC01067870.1 177 SSAVITLTQTPGSQSVTPGQTVSFSCKASSPVDDDLHWYLQKSGAAPKLLIYSASSRWTGVSDRFTGSGYDIDFTLTISRVQAEDAGVYYCQHDENFP
Xiphophorus couchianus V49 igkv LNCC01065753.1 158 SDGQNVVVTQSAAKSVQLGQTVTIDCKASRQVACNTPCLSWYHQKSGEVPKALIYRTSSRFSGISSRFSGSGARNKLDFTLTISGVQAEDAGVYYCQSYHDINSQDV
Xiphophorus couchianus V48 igkv LNCC01063281.1 110 QLGQTVTIDCKASVQLTGCSTPCLSWYHHKPGEVPKALIYWTSSRFSGISSRFSGSGAGNKLDFTLTISGVQAEDAGVYYCQSYHYINSQYV
Xiphophorus couchianus V47 trav LNCC01062933.1 1803 VRGQVTVTQPAAVRADLGGSATITCRTNYGVYSSSYLHWYQQKDRAAPKLLMYITSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCMGEFYISSKYS
Xiphophorus couchianus V45 ighv LNCC01062913.1 1529 LSLSKDVHQDPPSTLSSPQSPATISCSHSISGYYVILWYQKPIGGSALKLIGYIANTSPTLEKEFEDRFTISGDGSKESELEVQELQPEDSSMYYCAAS
Xiphophorus couchianus V44 igkv LNCC01061895.1 6539 SRGQVTVTQPSAVNTGFGGSATISCKTSQAVYYDGSDYFLAWYQKKDTEPPKMLIYWGNRRASGIPNRFTGSGSNSDFTLTISGVQAEDAGVYYCQS
Xiphophorus couchianus V43 trav LNCC01061842.1 6416 CKGDSVKQTEGEVVAAAGESLTLRCTYETSDTYPYLFWYKQGENSFPKYMLKRYSTTSENSPEFSEDRFDADLNTEAKEKSVNLKIQDLRLSDSAVYYCALR
Xiphophorus couchianus V79 igkv LNCC01073709.1 919 SDGNPSVTQSPAVKSAALGETVSLSCSASEGVDDDLSWYLQKPGQPPKLLFYKISSRQSDTPSHFSSSGSEPQFTLTISGVQAEDAGDYYCMGVYLVNVDYV
Xiphophorus couchianus V46 igkv LNCC01062926.1 388 TQQPAAVRADLGGSATINCRTSQNVYVNSNGHHLAWYQQKDGQTPKLLIYTTSTKASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVISSQYV
Xiphophorus couchianus V42 trbv LNCC01025036.1 10580 SSLSEKIVQVPDRAFRGRGDPLAISCSHSIQSYDQILWYRRTDDRELQLLGYTYGTASFPEKELNVTIDGDANKDKTCTITITGLSPGSSAVYFCAAR
Xiphophorus couchianus V11 ighv LNCC01017526.1 4930 IDGQTLTQSESVLKRPGESHKLTCTTSGISFSSYWMSWIRQAPGKGLEWVATDTGSQYYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD