WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Xiphophorus hellerii LNCB00000000.1 (LNCB01) 89 34 0 15 23 13 1 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Xiphophorus hellerii V0 trgv LNCB01015339.1 1793 SGFDSQASVDQPKYATVPPGGSVTLNCTVQTGSCGGEHKVYWFRNSDGSPPGLVYGHGAKSEQCETNPYRQTHTCVYDLPVENLDASHAGTYYCAIASC
Xiphophorus hellerii V7 ighv LNCB01021112.1 1833 NDGQTLTESESVVKRPGESYRLTCTYSGFSSTPYIVWIRQAAGKGLQWIAFINNGGGTRHSDSLKTRFTISRDNSRSQVYLQMNSLTSEDSAVYYCAQE
Xiphophorus hellerii V6 ighv LNCB01021110.1 757 VKCEQLTQPASVTVQPGQRLTISCQVSYSMSTYATAWIRQPAGKGLEWIGWKYTGGSYYKDSLQNKFSIDLDTSSNTVTLNGQNMQPEDSAVYYCARD
Xiphophorus hellerii V5 ighv LNCB01021109.1 6673 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGSYWTAWIRQPAGKGLEWIGMKHGVGASYYKDSLQNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARR
Xiphophorus hellerii V4 ighv LNCB01021109.1 4048 VKCEQLTQPASVTVQPGQRLTISCQVSYDLSYYTAWIRQPAGKGLEWIGMKDSYGTVHFKGSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR
Xiphophorus hellerii V3 ighv LNCB01021108.1 4863 QRMESIPSSSVVKKPGETLSLSCRGSGFTFTDYVMAWIRQPAGKGLEWLGFGSNNPSNNRYASGLSGRIEVRKDSSNSMTHLTLSNLKPEDSAVYYCAAE
Xiphophorus hellerii V2 ighv LNCB01021108.1 3156 QRMESIPSSSVVKKPGETLSLSCRGSGFTFTDYVMHWIRQPAGKGLEWIGSGYSDNSRNTYASSVRGRIEISREDSNSMTHLRLSNLKPEDSAVYYCAAG
Xiphophorus hellerii V1 trbv LNCB01020462.1 5370 LVCNSRIQQSLPQIVKENAQVQIQCSHEDKTRPFMLWYQQRDHGQPVVFIGYEYGTKAQIYGGQFEEQFKMKRENSLTGILTVLSANLSHSAVYFCAIT
Xiphophorus hellerii V88 igkv LNCB01107730.1 789 SSGDIILTQTPGSQSVAPGQTVSITCKTSSGVYSNLHWYLQKPAEAPKLLIYYATTLQSGVPARFSGSGSGSDYTLTINGVQAEDSGVYYCQQGYDRP
Xiphophorus hellerii V87 ighv LNCB01107264.1 617 TDGQTLTESESVVKRAGESHRLTCTYSGFSNHHWNAWVRQAAGKGLEWVATISDTSTYIYHSDSVKGRFTISRDNSKYQVYLQMNSLTAGDSAVYYCARE
Xiphophorus hellerii V86 ighv LNCB01107264.1 1816 VECEQLTQPASMTVQPGQQLTISCQVSYDLSSYYTAWIRQPAGKGLEWIGRDTEFKNSLKNKFGGSLDSSSKTVTLNGQNMQPEDSAVYYCARQR
Xiphophorus hellerii V85 trav LNCB01107264.1 2935 VKCEQLTQSASVTMQPGQRLTISCQVSYSMSSYATHWIRQPAGKGLKWIGWKNAGGSSYKDSLQSKFSIDLDASRKTVTLNGQNMQPEDSAVYFCARD
Xiphophorus hellerii V84 trav LNCB01107264.1 4289 TDGQTLTESESVVKSPGESHRLTCTYSGFSSTPSIAWIRQAAGKGLEWIAYISSGSSGIYYSDSVKGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARE
Xiphophorus hellerii V83 ighv LNCB01106763.1 105 VYCIDLIQPDSQLVQPGQSLTITCRPSGYSVTDSYATGWIRHRERKPMEWIFHMWGSGTFYKNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCV
Xiphophorus hellerii V82 igkv LNCB01095563.1 145 SSGDIILTQTPGSQSVDPGQTVSITCKTSSSVSNYLHWYLQKPAEAPKLLIRYATTLQSGVPARFSGSGSVSDFTLTISGVQAEDSGVYYCQQGSSSP
Xiphophorus hellerii V81 ighv LNCB01094609.1 219 TDGQKLTESESVVKRLGESHRLTCTYCGFSTTNHMHWVRWAAGKGLEWVTHSTGSSYIYYSDSVQNRFTVFRDNIRSEVYLQMNSLTAGDSAVYYCA
Xiphophorus hellerii V80 ighv LNCB01086885.1 192 TDGQTLTESESVVKRPGESHRLTCTYSGFGGDDNNAWIRQAPGKGLEWIAYISWNSGSIYHSDSVRGRFTVSRDNSRSQVYLQMNSLTAGDSAVYYCARE
Xiphophorus hellerii V79 trav LNCB01084661.1 1746 CKGDSVKQTEGEVVAAAGESLTLRCTYETSFTPTLFWYKQDKNGFPKFMLKQLSSMKDKAPEFNSSRFDADLNSTIKSFNLKIQDLRLSDSAVYYCALQPTVTG
Xiphophorus hellerii V78 ighv LNCB01081341.1 122 ARGQSLTSSEAVISKAGQSATLSCKVQGLPLSWLHWIRQKPLEAVEWIGRIDSGTGTIFAQHLQGQFSITKDTSKNTVSLTAKSLKPEDSAVYYCARETQ
Xiphophorus hellerii V77 trav LNCB01081340.1 2356 AVFILAAEGQSITESEPANKKPGESHRLTCTTSGFDFRNSVWVWVRQASGKGPEWIALVDTDSIPIFYSDSVRGRFSISRDDSSSKVYLQMNSLKTEDSAVYYCAQS
Xiphophorus hellerii V76 trav LNCB01080857.1 3445 CKGDSVKQTEGEVVAAAGESLTLRCTYETISVTPTLIWYKLEENSFPQYILKQQTLTTYKALDFDSSRFDANLNKTNKSFNLKIQDLRLSDSAVYYCALQPTVTG
Xiphophorus hellerii V75 trav LNCB01080857.1 8031 QTDGVLQPERDVMAAEGGSATLNCLYNTSASNHYLYWYRLEEGSSPTFILSRFKIGDGKTVEKRFSSSLDATARSVPLKIQDLRPSDSAVYYCALQPTVTG
Xiphophorus hellerii V74 igkv LNCB01078744.1 2082 VRGQITVTQPAAVRADLGGSATINCRTSQNVYSSNCLAWYQQKDGQTPKLLIYYISTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQHV
Xiphophorus hellerii V73 igkv LNCB01078743.1 2450 SSGDIILTQTPGAQSAVQGQTVSIRCKSDRLIGDDINWYFQKPGEAPKLLIYDTTERQPGVPERFRAKAEQTDFTLTISGVQAEDAGVYYCQQHNSFP
Xiphophorus hellerii V72 igkv LNCB01078741.1 360 TQQPAAVRADLGGSATINCRTSQNVYVYNSNHRFGWYQQKDGQTPKLLIYDASTRTSGTPSRFTGRGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQWV
Xiphophorus hellerii V71 trav LNCB01078142.1 12119 CKGDSVKQTEGEVVAAAGESLTLGCTYETSGTNYALFWYKQEGNSFPKYMVKQLSSSKYKAPDFDNDRFDADFNKDEKSFNLKIQDLRLSDSAVYYCALQPTVTG
Xiphophorus hellerii V70 trav LNCB01077785.1 5152 VNCQQLTAAKTEEFSSEGSSVTLTCSYTKDSAQVLFWYQQNPGEPPEFLRSHSPSGGSEHLDRMTFKGSKEEMSMKISSAAVTDSAVYYCAVR
Xiphophorus hellerii V69 trav LNCB01077784.1 2261 CKGDSVKQTEGEVVAAAGESLTLRCTYETSYAATLFWYKLEVNSYPKFMLKRFSTGGDNDPGFKKDKFDAQHEKTSFNLKIQDPQVSDSAVYYCALQPTVTG
Xiphophorus hellerii V68 trdv LNCB01077784.1 5877 AADIISAVTDEVRGTEGHSVSLSCNYETTSDYADLYWYKHPSDLQAPRFLLLKNGKGGSADFNIDQKHFKSQTSSSSTELTIRELTLADTALYYCALE
Xiphophorus hellerii V67 trdv LNCB01077784.1 6894 QSLEADITAIRSEMFPSEGDRVTLSCNYSVKADNLQWYRQDPGSAPRFLLLITDTKDPTVVEAEPPNPRLTAGLNKERNRVDLLISSAAVTDSAVYYCALQ
Xiphophorus hellerii V66 igkv LNCB01067222.1 13936 FRAATLPTVLVGVGEDATLHCPLLDGSNGTSNSADPATLSWYRKAAGGGPTLLLSLSPANGSVVRYGDGVGPQKVSAAANGSLVLHGSEQSDSAVYYCGV
Xiphophorus hellerii V65 trav LNCB01021506.1 1624 MRGATVLTQKPPVLTVRKGETATMDCNLGTVVNTVYWYKQIQGGVPQWVLYFYHSSGSPSYGSGFSSPKFTSTHQSTTDYCLIINNAEERDSAVYYCKTWENSKAV
Xiphophorus hellerii V64 trav LNCB01021506.1 1624 MRGATVLTQKPPVLTVRKGETATMDCNLGTVVNTVYWYKQIQGGVPQWVLYFYHSSGSPSYGSGFSSPKFTSTHQSTTDYCLIINNAEERDSAVYYCKTWENSKAV
Xiphophorus hellerii V63 trav LNCB01021506.1 5415 VRGATVVTQTPPVVTVRKGETATMDCNLGSVTNSAALWYRQIPGEVPLYMLRFYHGWSAPEYDTGFPSSRHTATHQSTSDYRFRISNVEEGDSAVYYC
Xiphophorus hellerii V62 trav LNCB01021505.1 360 ITLTQTPPVKTVSAGQQVVLNCNIQRYDGNSVIWYKQVSSGVPQYVLSFWHHDSSLYFGTGFSSNRFNSKSSSDIDYQFIIKQAEAGDSALYFCQTWDDSANEAV
Xiphophorus hellerii V61 ighv LNCB01021140.1 1283 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIEYDSDRKYYSQSVQGRFTVSRDNSREQLYLQMNSLKAEDSAVYYCARA
Xiphophorus hellerii V60 ighv LNCB01021140.1 2949 VFSIDLIQPDSKVLQPGESLSITCRLSGYSLHNSYGTGWIRQREEKTMEWIFDQWGGRSGSLYQNNALTNKFSFSRDMSAETVTITGQNLQPEDTAVYYCVRR
Xiphophorus hellerii V59 trav LNCB01015030.1 7926 LAPSSSGLGFEAVNVGRDVTLKCSYQKNSAIGVYWYKQSPGRKPQLMSEFLQHARKGSMKSPFNNDPRFQPDTGVGKNNLKISNVQTSDSAVYYCVS
Xiphophorus hellerii V58 igkv LNCB01015029.1 6066 LAPSSPLDFKSVRVGQNVTLKCFYQGSNGPIFYWYKKSMGGKAQLMSEFYKHKQNGSLHSDLITGDPRFKLEPGSGEFHLKILNAQVSDSATYYCVSLF
Xiphophorus hellerii V57 igkv LNCB01012513.1 1733 QVTVTQQPEAVRAGLGGSVTINCRMSQNVHVHLSSFPCLAWYQQKDGQTPKLLIYFSSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQS
Xiphophorus hellerii V56 igkv LNCB01096995.1 167 QITVTQQPAAVRADLGRSATITCRTSQNVYNNNYLHWYQQKDGQTPKLLIYTTSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNS
Xiphophorus hellerii V55 trav LNCB01083079.1 1766 QAILQVSSSVQQDSRFVSVKAGESVTLQCFRDPDTPARAYWYKLTLRQKPQLISTVFKYDPNGTFHREFKDNPRFTLDTKGNLNNLKITNLQPSDSATYFC
Xiphophorus hellerii V54 igkv LNCB01082316.1 2954 SSAVITLTQTPGSQSVTPGQTVSFSCKASSPVDDDLHWYLQKPGAAPKLLIYSASSRWTGVSDRFTGSGYDIDFILTISRVQAEDAGVYYCQHDENFP
Xiphophorus hellerii V53 ighv LNCB01080426.1 1603 LSLSKDVHQDPPSMLSSPQSPATISCSHSISGYYVILWYQKPIGGSALKLIGYIANTKPTMEKEFEDRFKISGDGSKESELEVQELQPEDSSMYYCAAS
Xiphophorus hellerii V52 igkv LNCB01078436.1 6956 LTGEIMVTQTPGSQSVALGQTVSLKCKTSSYVSNYLHWYLQKPAEAPKLLIYAATTRQSGVPARFSGSGSGSDFTLTISGVQAEDSGVYYCQQSYSS
Xiphophorus hellerii V51 igkv LNCB01078436.1 4245 SKIQPTVTQPAAVSSSLGRSVTISCKTSHNVYSSNRLAWYQQKDGEVPKLLLYSTSTRASGTPSRFTGSGSNSDFTLTISGVQTEDAAVYYCKGEFPS
Xiphophorus hellerii V50 igkv LNCB01078436.1 2784 SSAVIILTQTPGSQSVTPGQTVSFSCKASSPVDDYLHWYLQKPGAAPKLLIYEAITRWTGVSDCFTGSGYDIDFTLTISSVQAEDAGVYYCQHSENVP
Xiphophorus hellerii V49 igkv LNCB01078012.1 1540 QVTVTQLVAVRADLGGSISINCRTSQNVYVDSNGHRLAWYQQKDGQTPKLLIYYASTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVISSQWV
Xiphophorus hellerii V48 ighv LNCB01070858.1 5708 VGGQTLTESEPVVKKPGESHTLTCTTSGFTFGDYWMYWIRQAPGKGLEWVATISFWAGSDKRYSQSVRGRFTISRDNGKQQVFLQMNSLKTEDSAVYYCARG
Xiphophorus hellerii V47 ighv LNCB01070858.1 2030 VRCEQLTQPSSLVLQHGQQLAIGCQVSYSVGDHHTHWIRQPPGKELEWIGGARVGYEAYQKSSLKNKFSFSLESSSNTVTLNGLNMQPDDTAVYYCARQ
Xiphophorus hellerii V46 trbv LNCB01030257.1 8266 SSLSEKIVQVPDRAFRGRGDTLAISCSHSIQRYDQILWYRRTDDRELQLLGYTYGTASFPEKELNVTIDGDANKDKTCTITITGLSPGSSAVYFCAARYHSA
Xiphophorus hellerii V45 ighv LNCB01030257.1 5344 CSLTNDVQQDPPAILGTLQGPATITCSHSVSTFNVILWYQKPTGGSALQLVGHTLYEKPTVEPEFNGRFSIKGDGSKKSELHVEKLQPEDSSMYYCAAS
Xiphophorus hellerii V44 trav LNCB01030255.1 2257 VSIGLRIDQPPSLLLEVGQQAVNLKCEQDDEQYLNMYWYRQISSSSSSMELVAYSVGKDISTIEAPFQDTKYSMSRPSTLSTTLQINKAEPGDSAVYYCASSK
Xiphophorus hellerii V43 ighv LNCB01030254.1 3193 VSLGLEVHQSHSDLIKRTGDKVHIFCTHKKTDYRVMLWYQRSPGDTAMKLIGYLHYDKPSMEDKDEKDFEISGDLAGDTAKNGSLTIQTVKQNHTAVYYCAARE
Xiphophorus hellerii V42 trbv LNCB01030253.1 1823 SSLGDRVVQLPANILKTSGEATVIKCSHQVPNYDRILWYKQSEDHQMQYLGYMNVNDGYPETGVKVKIDGEATEGKTCSLTIEGVNMSSSGVYFCAAS
Xiphophorus hellerii V41 trav LNCB01030249.1 3923 SSPSDQIVQIPADMFKSPGETAKISCSHSIPDYDRVLWYKQSKLHGMKLLGYMLGDNGYPEKELNVNIDGSANRDKNSTLTVTELSPDSSAVYYCAAR
Xiphophorus hellerii V40 trbv LNCB01030249.1 2468 SSLSDRVHQTPADLFHEPGGNAVISCTHSIDNYDVILWYKHSTSSQMQLLGYNDAVNGYPEPGLKVKISGSASKDKISTLTVEDLSESSSAIYFCAAK
Xiphophorus hellerii V39 trbv LNCB01030249.1 749 SSLNDQVHQTPFNILAKRGEAARISCSHNIQSYNVILWYKRLEDKQLQLLGHMYIDNKNPEPGTDVKMELEGNANKGETCTLVIKELSEKSSAVYYCAAS
Xiphophorus hellerii V38 trbv LNCB01030248.1 276 QSKNSVDQTPAALIKEPGESVQIKCNHSNTNFYMIQWYKQPPGKTDMTLLGYARYTTQTVEDQFQNLYNVTGSGQSLSSLVIPKLRQSEDSAVYFCAASD
Xiphophorus hellerii V37 trav LNCB01030240.1 2580 ITASQPIVQQSPASILVEPGQAARLHCYHGDNSYPYMLWYQSAAGGGRRTMDLIGLLHYENQSPEKGFESRFNMTGHSKGKAQLIVSDAKPGDTAEYFCAAS
Xiphophorus hellerii V36 trav LNCB01030239.1 21632 HCQDVTQLPKIIWKSAAESAEMNCSHTRDKGHNQMYWYRQRPGETMTLVVYTVYGGKTDYGENLQTKYSAVKDTIETGALTVKDLQPDDSGVYFCAVS
Xiphophorus hellerii V35 trbv LNCB01030239.1 19024 LLHEKVHQDPPDIHKRPGESSKIRCSHAIDNYDEILWYKQTSIGGQLQFLGRVENSFRYPEAGMNVSLEGSADKGQTCTLTIEGLTSRSSAVYFCAARYHSAES
Xiphophorus hellerii V34 trbv LNCB01030239.1 18300 ASPSDEVHQTPSDLYKKLDQTAEIDCSHNINNYDRILWYKRTAGRQMEFLGYMLANIGYPEEGAKVKIDGNANKGQTCTLTMDRLNVNSSAVYFCAAS
Xiphophorus hellerii V33 trbv LNCB01030239.1 16871 SSQSSKVQQRPADIYKYPNESKAEIRCSHDDDTFTRILWYKQSASTGLQFLGYLYGGSGSPEKDVNVTINGKATKGETCILTVEGLNQNSSAVYFCAAS
Xiphophorus hellerii V32 trbv LNCB01030239.1 15537 PSAYQVLQSPRFAAPKPGESVTVHCSHNVSIFERILWYKREKHGALRYLGYMNRNYPYPEGDVKDKMNFGGDGSKHATLNISTVSENDSAIYFCAAS
Xiphophorus hellerii V31 trbv LNCB01030239.1 13663 VDQTPPSIIKKSGESVDKEIRCSHSIPSYQVILWYKQDKDKALKLLGYLNNVFANLEQDVKGKINFEGDGRQQSNLTVSNLTVDDSAVYFCAAS
Xiphophorus hellerii V30 trbv LNCB01030239.1 9695 VDQTPPSIIKKSGESVDKEIRCSHSIPSYQVILWYKQDKDKALKLLGYLNLEFPNIEQDVKGKISFEGDGRKQSYLTVSNLTVDDSAVYFCAAS
Xiphophorus hellerii V29 trav LNCB01030239.1 6913 VALGLEVRQSDSDLIRNPGENVQVFCSHDKTDFRTMLWYQRQPGKTSLNLIGYLNYQASTMEDVFNKGFSLHGDLGGSGAKNGSLLIQKVEREHSAVYYCAASK
Xiphophorus hellerii V28 trbv LNCB01030239.1 1314 ASDSKHVGQTPPSVIRKTGESVDKEIRCSHSIPNHDVILWYKQDENRTLKLLGYLNLNHVAVEEDAKKTISFEGDGRTHSDLTVADLTADDSGVYFCAARY
Xiphophorus hellerii V27 igkv LNCB01029857.1 39573 LAANPSVTQSPSVKSAALGETVSLSCSASEGVEDDLSWYLQKPGQPPKLLFYQISSRQSDTPSHFSSSGSEPQFTLTISGVQAEDTGDYYCMGAYIGL
Xiphophorus hellerii V26 trav LNCB01021136.1 65 VKTPGESLSLSCRGSGFTFSCCWMHWIRQPAGKPLEWMGLIYSDGRGTQHSSSLQGRIGITRDNSKNMVYLTLSNLRPEDSAVYFCAKE
Xiphophorus hellerii V25 ighv LNCB01021134.1 3508 VTGQTLTESEPVVKRPGESHRLTCTGSGFTFSRYPMDWVRQAAGKGLEWIAFVHTGSSHFYYSQSVQGRFTISRDDSSSKVYLQMNNLRTEDTAVYYCAR
Xiphophorus hellerii V24 trdv LNCB01021133.1 122 VFSEIKLDQSQSEGKRPGETVKMSCVMSGFDMTRYFIHWIRQKPGRALEWIGRMNAGRNSADYGTSFQSRFIMTENVPSSTQYLEIRSLTAEDSAVYFCARE
Xiphophorus hellerii V23 ighv LNCB01021130.1 1976 AWSQIRLEQSDSEVKRPGETVKMSCVIHRYSATSDYNHWIRQRPGRGLEWIGRMVNGRNSVIYGSSFQTRFIMTENVPISTQYLEIRSLTAEDSAVYFCARE
Xiphophorus hellerii V22 ighv LNCB01021127.1 455 AWSQIKLEQSDSEVKRPGETVKMSCVISGYSMTSYNIHWIKQRPGRALEWVGRMYTGSNAAIYGSSFQSRFIMTENVPSSTQYLEIRSLTAEDSAVYFCARR
Xiphophorus hellerii V21 ighv LNCB01021126.1 3648 VKCEQLTQPASLAVRPGQPLTLSCQVSYSVSSYWTAFFRHPAGKALEWIGGSGEGSRWNTLYKDSLQNQFSITFVSSTNTATLNGHNMQPEDSAVYYCAKQ
Xiphophorus hellerii V20 ighv LNCB01021126.1 2054 TECQTLTESESVVKRAAESHRLTCTYSGFSGIWFAWVRQPAGKGLEWVSGISNSGDRTYYPQSLRNRFTISRDNSREQVYLQMNSLSAEDSAVYYCVRW
Xiphophorus hellerii V19 trav LNCB01021126.1 618 VECQQLTQPASVTVQPGQRLVISCQVSYSLSSYWTVWIRQPAGKGLEWIGGAGVGYTNYCKDSLKNKFSISLDSSSKTVTLNGQNMQPGDSAVYYCARR
Xiphophorus hellerii V18 ighv LNCB01021125.1 3619 VKCEQLTQPASVTVQPGQPLTISCQVSYSVTSYWTAWIRQPAGKELEWIGDAKGSSTDYKDSLRNKFSISTESTSNTVTLKGQNLQPEDTAVYYCAR
Xiphophorus hellerii V17 trav LNCB01021125.1 1113 VWGEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTQYGMNWIRQKSGKGLEWIGWINTDTVVATYASSFQSRFTFTQDVSSSTQFLQITDLTTEDSAVYFCAR
Xiphophorus hellerii V16 ighv LNCB01021123.1 8547 VKCEQLTQPASVTVQPGQHLTINCQVSYSVGTATHWIRQPAGKGLEWIGYMCTGCTGARKDSLKSKFSITVDASSKTVTLNGQNLQPEDSAVYYCARD
Xiphophorus hellerii V15 ighv LNCB01021123.1 3762 VKCEQLTQPASVTLQPGQTLTISCQVSYSVRSYYTDWIRQSAGKGLEWIGRAADGSTTHYKDSLKNKFSLSAHSSSNTVTLNGQNMQPEDSAVYYCARQ
Xiphophorus hellerii V14 ighv LNCB01021123.1 2361 VKCEQLTQPASLTVQPGQTLSISCQVSYDLSSYHTHWIRQPAGKAPEWMGVIWHNGGNAYATNVGGRIEITRNTNEKIVYLSLSAMKPEESAVYYCAG
Xiphophorus hellerii V13 ighv LNCB01021121.1 7963 LKGEQLNQLPSMTVQAGRSVSITCQVSYSISSHFTHWIRQPAGKGLEWMSSDTTIKDSLQNKFSVNLDSSNSRVTLYGQNMQPEDTAVYYCARER
Xiphophorus hellerii V12 ighv LNCB01021121.1 1845 IYCQTLTESESVAKRPGESHKLTCTASGFTFSSYEMNWVRQAPGKGPEWIAYINSGGGGTKYYSQSVQGRFTISRDNGREQLYLQMNSLRSEDSAVYYCARE
Xiphophorus hellerii V11 ighv LNCB01021119.1 269 VCCQTLTESDSVVKSPGESHRLTCTASGFTLSSYWMAWIRQAPGKGLEWLAAHYNDHNLHHSQSVQGRFTISRDNGKQQLYLQMNSLRTEDSAVYYCARE
Xiphophorus hellerii V10 ighv LNCB01021118.1 622 VAGQTLTESESVVKTQGESHKLTCTASGFSINGRWMHWIRQAPGKGLEWLAAHYDDRNIVYSQSVQGRFTISRDNSREQLYLQMNGLRTEDSAVYYCARE
Xiphophorus hellerii V9 ighv LNCB01021115.1 755 TDGQTLTESESVVKKPGESHRLTCTYSGFSSTSYIAWIRQAAGKGLEWIAYIWDDSRGIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSTVYYCARR
Xiphophorus hellerii V8 ighv LNCB01021114.1 2473 VKCEQLTQPASVTLQPGQRLTISCQVSYSLGSYYTAWIRQPAGKGLEWIGMKFTGASYYKDSLQNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE