WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Anguilla japonica AVPY00000000.1 (AVPY01) 91 15 1 4 50 14 5 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Anguilla japonica V25 trav AVPY01411404.1 564 DSFQDEITSATNAVHALEGSSVVLSCNYTTSASGGSLQWYRQYPRSKPEFLILIYRTKGREDKDKDGWIVNHDIANNHVDLELTSAKVTDSAFYYCALQ
Anguilla japonica V24 trgv AVPY01403823.1 1607 CTLAQITHPKSWLMAKTARSARIECVVDKNVNLADTHIHWYQHREGDAFKRVLYIPAGLAVGKPDDGFQGRFIGALNSKDRKSTLTITNVNTNDAASYYCAYYD
Anguilla japonica V23 trav AVPY01383724.1 559 STGAINVQQSPIAQFVKLGEGMKLTCQHDDSNYDRMYWYQKLNGQQALVLVGFLNFEVVNQDKEYKGKFNLSGNARSKGFLTTSNLNAEDSGTYFCAAS
Anguilla japonica V22 trav AVPY01360178.1 5068 TVTQSTVDAIALEGESVTLGCKYSTSSQSPDLFWYIQYPNGFLKHMLTRSTYGNTKTVPEFKERFYAHVNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V21 trav AVPY01360176.1 961 CRAEDTVTQSTGDVIAFEGESVTLGCNYSTSDTTPYLFWYIQYPSGFPKYILRRDTLTAGKTVPGFERFDAQLNKTSSSIPLTIQKVQLSDSAVYYCVLR
Anguilla japonica V19 trav AVPY01352628.1 156 ANGLTVVTQKPPVLTVSKGDTATMDCSTGINENTAWWYKQVPGGAPQFVLYFHLTHSSPTYGAGVSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla japonica V18 trav AVPY01305962.1 182 TVVTQKPPVLSVSKGDTATMDCNLGTVTGSAARWYKQVPGGVPQFVLNYHHSWSSPSYGAGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYYCKTHDSSASEIV
Anguilla japonica V17 trbv AVPY01271747.1 572 ITVEQTPSSLFGNPRDDVQLICKHDGSNYQFMYWYQRVQGQQALELIGFLNSDIVNQDEKYKGKFNLSGHAKDKGSLDITSLSVEDSGTYFCAAS
Anguilla japonica V16 trbv AVPY01271741.1 809 ITVEQTPSSLFGNPRDDAKLICKHDDSSYLYMYWYQRVQGQQALELIGFLNYDVVNKEEKYKEKFNLSGHAKQKGYLDISNLSVEDSGTYFCAAS
Anguilla japonica V15 trbv AVPY01271740.1 883 ITVVQTPSSLFGNPRDHVQLTCKHDGSNYQFMYWYQRVQGQQALELIGFLRYDVVDQDEKYKGKFNLTGHAKDKGSLDITSLSVEDNGTYFCAAS
Anguilla japonica V14 trav AVPY01164647.1 1196 LSDATTITQKKAVVQREGDSVHIKCEQDGTDPQMFWYRQGHQNGLELIFFSQMDGLDTEKLVVEDRFTATRENRQRFHLNVTELQPQDSAVYFCASS
Anguilla japonica V13 trbv AVPY01164646.1 65 LSDATTITQKKAVVQREGASVHIKCEQDGTDQQMYWYRQGHKNSLELIFFSRTDGVDTEKLVVEDRFTATRENRQRFHLNVTKLQPQDSAVYFCASS
Anguilla japonica V12 trav AVPY01103358.1 3504 YVQGINVSQAPNAVFNQRGSEAVLSCSHKDSSYIYMYWFQQLKGKGMQLMVYSAVGSSPQFEKDFEEERYTFERPDAQNGALKIKAVEPVDTALYFCAASNTVSQ
Anguilla japonica V11 trav AVPY01082887.1 1242 ITVQQSPSSLFRKLNDDVQLTCQHGDSSYYTMLWYQQAKGKQSLELVGFLVHAEVTQDEKYKGKFNLTGNGNKRGSLLISQLSAEDSGTYFCAAS
Anguilla japonica V10 trav AVPY01082887.1 487 DVIQTPKQAVMKAGESVEISCSHKDNSLHYLYWYWQLPGKGIELIAYILTNQEATFENDFSNRTKRYEIKKTETLFGSFRIEVLQISDSAVYFCAAT
Anguilla japonica V9 trav AVPY01082884.1 400 ITVQQSPSSLFGKLSDDVQLTCQHDDSNYNRMYWYQQVKGKQSLELVGFLNYNNVNQDEKYVRKFNLTGNGDKKGSLFISRLNAEDSGTYFCAAS
Anguilla japonica V8 trav AVPY01082881.1 963 FTAAINVQQSPASLFGSLHKTTLLTCKHDDSSYQYMFWYRQVKGQQHLELVGFLFLKNVNQDKEYEGKFELSGNAQESGSLLISGLKAEDSGMYFCAAS
Anguilla japonica V7 trgv AVPY01029503.1 335 ADAQKRLEQNIISVTATEGDTAVLTCKATGLISSDYVHWYQKKEGGPFERVLYISHGGNKVRDTSHAQKDSFSTEKSNPPYDLRIDSVKMEHAATYYCACW
Anguilla japonica V6 trav AVPY01678105.1 16 AVSQSGVEVIQSTGVLMLKPGQSAVMNCTQSTSHTYMYWYQQKNNGPLKFIFSTANSEEVKEKSDGIPDRFTVSRKSVPKTELMITGVQPEDSALSYCAAS
Anguilla japonica V5 trav AVPY01617044.1 175 ALLGKNIVQPDALVRAQLGDTVTLSCFHPTTDVSHVSWFKQPLGLKPQLVAIVSKYQSNATFFNEFKNSKRFTAKATTESVRLTVSQVEPSDSATYYCAV
Anguilla japonica V4 trbv AVPY01613032.1 230 VQCQSQQEVSQWPSQTAVTQGSSVELQCSQSGSDTYMYWYRQQSTTVLQLVMLSVYMSEPERGEDISDRFTSTRAKTENISLTISQAEESDTGVYFCAAS
Anguilla japonica V3 trgv AVPY01496147.1 511 CTLAQITHPKSWLMAKTARSARIECVVDKNVNLADTPIHWYQHREGDVFKRVLYIPAGLASGKPDDGFQGKFIGALNSKDRKSTLTITNVNANDAASYYCAYYD
Anguilla japonica V2 trav AVPY01463899.1 176 FTAAINVQQSPASLFGSLHKTTLLTCKHGDSSYQYMFWYRQVKGQQHLELVGFLNYEMVNQDKEYEGKFDLSGNSRESGSLLISGLKAEDSGMYFCAAS
Anguilla japonica V1 ighv AVPY01455556.1 981 SHCVELTKPGSMVLKPGETLSVPCKVSYSVTRVSTVWIWQPAGKVLEWIGVMWSGGNTGYKDSLKGKFTITNDTSSNTVFLHGSSLQAGDTVVYYCARY
Anguilla japonica V0 trbv AVPY01454111.1 561 ITVEQTPSSLFGNPRDDVQLICKHDGSNYQFMYWYQRVQGQQALELIGFLQYDIVNQDEKYKGKFNLSGHAKERGSLDITSLSVEDSGTYFCAAS
Anguilla japonica V64 trav AVPY01297249.1 1296 CRAEDTVTQSIGDVIDLEAQSVPLGCKYSTSSPSPDLFWYIQYPNGFLKHMLTRSTYGNTKTVAEFKERFDAHVNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V63 trav AVPY01297235.1 1768 DSFQNGITSATNAVYALEGNSVTLSCNYTTSDAGADLHWYRQYPSSKPEFLILINRYKESIKKEAFIVKHENVNSLVHLELSSAKVTDSALYYCALR
Anguilla japonica V62 trbv AVPY01256925.1 82 RQSPSLLWRTQGLDKAGPAEMRCEHTDVSYYQMYWYRQPPGRDLQLVVLSDTLNAPDFGTFDGGKYAVAKSVAREGSFTVKEPAPEDSGLYFCAAA
Anguilla japonica V61 trav AVPY01256923.1 445 PSLCSKVSQSPAHLARQVGESAQLQCSNRIAGYDRLLWYMQSGNGVFTYLGYMNLNFGYPEDQYKGKFSLQGDARNNATLTIQNLSTTDSATYFCAAS
Anguilla japonica V60 trbv AVPY01256918.1 892 LSQSVNVKLLPFRLLKNPGQSSALNCSCDDPSYTYMFWYQQPGGEGRLKLIGTLYRQSLTPGDHFSDRFQILGDATKTGTLEISNLTSEDAAVYFCAMSV
Anguilla japonica V59 trav AVPY01256914.1 986 VRSNVGITPRILWGRIGDPAQMNCSHTLGAAYRQMYWYKQNPPEGIQLIVFTTSYASPEFGDFSKDRYVAEKAVPELGSLTVKKLEAEDSGTYFCAVS
Anguilla japonica V58 trav AVPY01230965.1 1974 CRAEDTVTQPMGDVIVLEGESVTLGCNYSTSYTPYLFWYIQYPNGFPKYILRRDTVTAGETVPGFERFNAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V57 trav AVPY01230965.1 4388 DSFQDEITPAAKEVHVLEGSNVILSCTYTAAANTLHWYRQYARSKPEFLILVAGTLSKKDEKGRFIVTNDKDNKHVHLEFTAEVADSALYYCALR
Anguilla japonica V56 ighv AVPY01230965.1 5961 EVKQKEAFKSAREEHEVSLECPFRTSSTNYLIYWYRQYPGSALQFILFHRYKDYKEDFASARFSSVVNDSKSVLTISTLIPEDTAMYYCALQ
Anguilla japonica V55 ighv AVPY01230961.1 38 MSTGEVKLLSRREEEQVSMECTFRTSSSNDYYFFWYRQYPGSALQYILRRGYSSHTSNFAQGRFDATADKSSGKTILTISKLIPEDTAFYYCALVQ
Anguilla japonica V54 ighv AVPY01230960.1 142 MSTGEVKLLSRREEEQVSMECTFRTSSSNDYYFYWYRQYPGSALQYILRRGYRSHTSNFAQGRFDATADKSSGETSLTISKLIPEDTAFYYCALVQLTS
Anguilla japonica V53 trav AVPY01230953.1 182 EDAVTQSTGDLITLEGHSVKLGCNYSTSNTSPYLFWYIQYPNAFPKYMLRGNVYGSKDTAQEFKERFIAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V52 ighv AVPY01230952.1 116 MSTGEVKLLSRREEEQVSMECTFRTSSSGFYIFYWYRQYPGSALQFILHRGYSSYTSNFAKGRFDATADKSSGKTILTISKLIPEDTAFYYCALVQLTG
Anguilla japonica V51 trav AVPY01164654.1 1195 ITVQQSPSSLFGKLSDDVQLTCQHDDSNYYRMYWYQQGRQSLELVGFLNYNNVNQDEKYRKKFNLTGNGDKKGSLFISKLNSEDSGTYFCAAS
Anguilla japonica V50 trav AVPY01164653.1 2822 LSEAITVQQSPSSLFGKLNDDVQLTCQHDESSYNTMLWYQQVKGQQGLELVGFLLYAGVTQDEKYKGKFNLTGNGDKKGFLLISKLSAEDRGTYFCAAS
Anguilla japonica V49 trbv AVPY01164653.1 4976 VQCQSQQKVSQWPSQTVVTQGSSVELQCNQSGSDNYMYWYRQQSSAGLHLVIFYAYLSEPERGKEISGRFTSTRPKLETITLTISQAEESDTGVYFCAASPT
Anguilla japonica V48 iglv AVPY01112396.1 5096 LEAVLILTQEKSLSVSPGSNVKISCISSKGYSISWYQSKPGSSPRFLVVNSTRGTGVSSRFVDSRSGKNNYLHIDKVTAEDEAVYYCGCASCGE
Anguilla japonica V47 trav AVPY01098963.1 862 GVSGQKVLTQKPTMLSLTKGQKATMDCNIARHDGYVVSWHKQVPGSAPQFVLYFYHSYSSPTYGAGFSSSRFTSTAQGNTDYQLIITNVEAGDSAVYYC
Anguilla japonica V46 igkv AVPY01095174.1 137 SLGQKTVTQTPAVKSAVPGDRVTLSCKTSTSDNLDDDVYWYQQKAGEAPKLLIYGATNLESGISDRFSGSGSGTDFTLTISEVRPEDAGVYYCFAYYGAPN
Anguilla japonica V45 trav AVPY01064974.1 17 DSFQDGITAAKAKVHVLEGNSVTVSCNYTAATSMLFWYRQYSRSKPEFLISVVSTDKTEGQFTAKHDKKNKTVVLEISSVQVTDSALYYCALR
Anguilla japonica V44 trav AVPY01064971.1 726 NSSQDEITAVKAKVHVLEGSSVSLSCTYTAAVDSLYWYRQYPRSKPEYLVFVVSSDRTEGPFTAKHDKNNKTVVLAISVAGMTDSALYYCALK
Anguilla japonica V43 trav AVPY01064966.1 45 DSFQYGITSATDAVHALEGSSVTLSCNYTGANSGDSLQWYRQYPSSKPEFLILVIRSKEGAKKDRWIVKHNKTSNLVHLEISSAEVTDSALYYCALQ
Anguilla japonica V42 trbv AVPY01627235.1 117 SAVCITVLQSPPELVLHHGEAVTLTCSHDDKNFDRLYWYKQTDGAGLELLGYLSFKQPYTEVGSFNVSGDGEKEGFLNSSAVTAEESGVYFCAVSK
Anguilla japonica V41 trav AVPY01530357.1 275 TVTQSTQDVIAIEGQSVTLGCTYSATSAQKYLFWYIQYPNGFPKYILRRDTVTAGETVPGFERFVAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V40 trav AVPY01501196.1 712 KVTQSTQDVIAIEGQSVTLGCTYSSMSTQKYLFWYIQYPNGFPKYILRRDTVTAGETVPGFERFVAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla japonica V39 trav AVPY01500614.1 185 GLLGNIVQPDALVRAQLGDAVTLPCRYPAEDVPSVSWFKQPLGQKPQLVAIIMNSVSDALFFNEFKNSKRFSAKAAEGSFNLTVSGVEPLDSATYYCSI
Anguilla japonica V38 trav AVPY01499176.1 543 ELSQSVNVQLLPVRLLKNPGQSSALNCSCDDPSYTYMFWYQQPGGEGRLKLIGTLYRQSLTPGDHFSDRFQISGDATKTGTLEISNLTSEDAAVYFCAMSI
Anguilla japonica V37 ighv AVPY01477998.1 157 MSTGEVKLLSRREEEQVSMECTFRTSSSNDYYFFWYRQYPGSALQYILRRGYISHTSNFAKGRFDATADKSSGKTILTISKLIPEDTAFYYCALVQLTG
Anguilla japonica V36 trav AVPY01477181.1 1343 FTAAINVQQSPASLFGSLHKTTLLTCKHDDSSYQYMFWYRQVKGQQHLELVGFLYLKNVNQDKEYEGKFNLSGNAQESGSLLISGLKAEDSGMYFCAAS
Anguilla japonica V35 ighv AVPY01473238.1 27 GSVSCSIVFARAGENVTLSCRCSKDGGCYDELVRWVRMNSNETLQIIDTKCEKSPCRFTSKRTDDISVALTILHVESGDSGRYYCGEDLS
Anguilla japonica V34 trav AVPY01465823.1 739 DSFQDGITSAANAVHALEGSSVMLSCNYTASTNGGSLQWYRQYPRSKPEFLILIYRTKGREDKDKDGWIVNHDIANNHVDLELTSAKVTDSAFYYCALQ
Anguilla japonica V33 ighv AVPY01449684.1 343 IVLSQPGQEVKRPGESMKLTCTVSGFSLGGYWTAWLRQKAEKSPEWLGEINGDGGTINYLSSIRGRLTISKDNGKNTLHMELKSLSMEDTAVYYCAR
Anguilla japonica V32 trbv AVPY01443662.1 385 ITVEQTPSSLFGNPRDDVQLICKHDDSSYQYMYWYQRVKGQQALELIGFLQYDIVNHEEKYKEKFNLAGHAKERGYLDISNLSVEDSGTYFCAAS
Anguilla japonica V31 trav AVPY01440606.1 21 TVVTQKPPVLSVSKGDTATMDCNLGTVTDRRAWWYKQVPGGVPQFVLYFYHSHSAPTYGAGFSSPRFTSNHQSKSDYRLIIETVEAGDSAVYYC
Anguilla japonica V30 ighv AVPY01428732.1 441 GYCVELTQPGSIVVKPGQPLSVFCKVSGYSLDDNSYCTAWIQQPSGTAMEWIGYICYDRNAYYKDSLKGKFTISSDTSSSTVSLQECSLQTGDTAVYYCAR
Anguilla japonica V29 ighv AVPY01426757.1 535 LDAITLTSSPAQTKSPGGSVKVSCQVSGYALTDYGTSWIRKRPGKAMEWMGIIWGSGSIDSPAPFKSRFTISRDSSNVLYLDISSLQTEDTAVYYCAR
Anguilla japonica V28 trbv AVPY01423300.1 454 VPGTIVTQTPRQCVKNLEESIEIFCTHSDSNLRYMNWYRQLPGKGIELIANIVTNGDPNYETGFDERRYSIVYTSSGDFKGSFKISPLKSVDSGAYFCAAT
Anguilla japonica V89 trav AVPY01448060.1 183 FGWSADVHQTPLQVITNPGGLLNISCSHNDNNLDYMYWYRQRLGKGFELIAYIGTHTEAEFEDEFKKKKMRFEIKKPGTLSGSFIMKTLTEEDSAVYFCAAS
Anguilla japonica V88 trav AVPY01447469.1 521 AVSQSRVEVIQSPGVLMLKPGQSAVMNCTQSTSQANMYWYQQKNNGPLQFLFSTVNSEEVTEKSDGVPDRFKVSRKSVPKTELMIIGVQPEDSALYYCAAS
Anguilla japonica V87 trav AVPY01441334.1 416 TVVTQKPPVLSVSKGDTATMDCNLGTVTDWAARWYKQVPGGAPQFVLYFHRTSSSPTYGAGFSSSHFSSECQTKSDCQLIIKTVEAGDSAVYYC
Anguilla japonica V86 ighv AVPY01425268.1 335 ISSGEVKLQTIAEERVSMECTFSTSSLSSNRLYWYRQYPGSALQYILVRGSYTDTSDFAKERFDATADQSSGKTILTISKLIPEDTAFYYCALL
Anguilla japonica V85 igkv AVPY01422996.1 38 SLGQITVTQTPAVKSAVPGDRVTLSCKTSTSNDLGDDLSWYQHKAGEAPKLLIYGATNLESGISDRFSGSGSGTDFTLTISEVRPEDAGVYYCLAYYGAPD
Anguilla japonica V84 trav AVPY01421704.1 110 GLLGNYVNQPYALMRPQLGDTVTLPCFHAREVVSCVSWFKQTLGEKPQIVAITMNPESDAIFLNEFKDSTRFSAKAAKGSFNLTVSQVEPSDSATYYCSI
Anguilla japonica V83 trav AVPY01421703.1 370 GLLGNYVNQPYMLMRPQLGDTVTLPCFHAREVVSCVSWFKQPLGEKPRIIALTMNPESGALLFNEFKDSERFSAKAAKGSFNLTVSQVEPSDSATYYCAL
Anguilla japonica V82 trdv AVPY01414665.1 855 LANGVKFDEQVPVRAARPGERVEIACSHDDNSLLIMSWYEQRERSRTLRLIGFGYSTGEPTYEGPFAARFQLRRESVQKGSLLIPNVTMADSAEYFCAASK
Anguilla japonica V81 ighv AVPY01414663.1 44 GASSSPVVLQAEAHLTPSPGDTVTLRCSMAAGFSMSGYTMYWYRQARAAGAPIEFLKKEYDTSGETERFSVSLATAENRFDLRVSNLTPADTAAYYCAA
Anguilla japonica V80 igkv AVPY01412734.1 209 SLGQKTVTQTPAVKSAVPGARVTLSCKTSTSSGLGSDLSWYQHKAGEAPKLLIYDATNLESGISDRFSGSGSGTDFTLTISEAQPEDAGVYYCFANYGAPD
Anguilla japonica V79 trav AVPY01411786.1 2874 FTAAINVQQSPASLFGSLHKTTLLTCKHDDSSYQYMFWYRQVKGQQHLELVGFLNYEMVNQDKEYEGKFNLSGNSRESGSLLISGLKAEDSGMYFCAAS
Anguilla japonica V78 trav AVPY01405046.1 75 GVSGQKVLTQKPTMLSLTKGQKATMDCNIARDDGYYVSWHKQVPGSAPQFVLYFYHTPTYGAGFSSSRFTSTDQGKTDFQLIITNVEAGDSAVYYC
Anguilla japonica V77 trbv AVPY01402634.1 1722 INVQQSPASLYGSLNQKIFLTCKHDDSNYQYMFWYRQVKGQQHLELVGFLNFEMVNQDNEYEGKFNLAGNARESGSLLISGLNAEDSGMYFCAAS
Anguilla japonica V76 ighv AVPY01389441.1 244 SSSGDEVTQEQPSVQKTEKEEVSLKCSFKSTSSDYYIFWYRQYPQSALQYILRRGSRASYSRTADFANGKFESTVTNSETLLTISKLTPEDTAVYYCALS
Anguilla japonica V75 ighv AVPY01382873.1 1060 ISSGEVKLQTIAEEGQVSMECTFGTSSLNYNTFYWYRQYPGSAFQYILHRGYWTGTSDFAKERFDATADTSSGKTILTISKLIPEDTAFYYCALL
Anguilla japonica V74 ighv AVPY01350086.1 1223 ISTGEVEVLNMREEQRVSMECTFRTSSLSNYYFFWYRQYPGSALQYILRRGYSSHTSNFAEKRFESTADESSGKTILTISNLIPEDTAFYYCALVQ
Anguilla japonica V73 trav AVPY01350081.1 1075 DSFQDEIRPAAKEVHVLEGNNANLSCTYTAAAFNLYWYRQYPRSKPEFLILVAGTLSKKDEKGRFIVTNDKENKHVLLEFTAEVTDSALYYCALR
Anguilla japonica V72 trgv AVPY01344119.1 829 EVRQKEAFKSAREEHEVSLECPFRTSSTNYLIYWYRQYPGSALQFILFHRYKDYKEDFASARFSSVVNDSKSVLTISTLIPEDTAIYYCALQ
Anguilla japonica V71 trav AVPY01344119.1 2228 DSIGQDAITSTSEKEHVLDGSSVTLSCNYSAVNPRNLQWYRQHPGSRPEFLILIYATSEEKTDKQFTVKHDKKNSRVHLEISSAEVTDSALYYCALE
Anguilla japonica V69 trav AVPY01327354.1 22 VSSGDEVNQEQKSVNGTEEQQASLKCTFKTSSSYPYLNWYRQYPGSALQFILYNGNSNRKAEFAKVRFDSTVDKSAGTTVLTISKLIPEDSAVYYCALD
Anguilla japonica V68 trav AVPY01327353.1 738 GSFQNSVTPKSNTVHDLKGSDVVLSCSYSATARFSNSLHWYRQYPRSKPEFLLLILEGTGSVQKATPPDPRLSAKLDMNNKRVDLEISSAKVTDSALYYCALQ
Anguilla japonica V67 trav AVPY01318156.1 1133 ANGVTVVTQKPPVLSVSKGDMATMDCNLGTVTDRGAWWYKQVPGGVPQYVLYFYHSWSSPNYGAGFSSPRFTSNNQSTSDYRLIIDNTEAGDSAVYYC
Anguilla japonica V66 trav AVPY01299329.1 41 IVVTQKPPVLSVSKGDTATMDCNLETETKNSARWYKQVPGSAPQFVLRFHHSWSVPKYGADFSSPHFTSTNQSTSDYRLIINTVEAGDSAVYYC
Anguilla japonica V90 trbv AVPY01448380.1 647 LSDATTITQKKAVVRREGDSVHIKCEQDGTDQQMYWYRQGHQNGLELIFFSRMDGVDTEKLVVEDRFTATRENRQRFHLNVTKLQPQDSAVYFCASS
Anguilla japonica V70 trdv AVPY01327356.1 380 GSFQNEITPTSTTVHALEGNNVVLSCNYSGYANNLQWYRQYPRSKPEFLLLILEGAGTVQKATPPDHRLSAKIDKIDRIVDLEISSANATDSALYYCALQ
Anguilla japonica V65 trgv AVPY01297254.1 635 ISSGEVKLINKTEEQYIFMECTFSTGPSGYYLFYWYRQYPGSALQYILHTGDHTGTSNFAKGRFDATADKSSGKTILTISKLIPEDTAFYYCALW
Anguilla japonica V27 trav AVPY01423297.1 20 VPGTIVTQTPRQFMENSEESIEIFCTHSDINLLYMNWYRQLPGRGIELIANIVTNGDPNFETGFDERRYSIVYTRSDNFKGSFKINPLKSADSGTYFCAA
Anguilla japonica V26 trav AVPY01412024.1 181 GLLGKNVVQSDALVTAQLGENVTLSCIYYLDEIPAVSWVKQPFGQKPQLVAIIMDPKSDAMFVNQFKNSKRLSAKGTKGTSTLTVSQVELSDSATYYCAI
Anguilla japonica V20 igkv AVPY01354437.1 145 SLGQITVTQTPAVKSAGPGDRVTLSCKTSTSNNLGDDVYWYQQKAGEAPKLMVKKISSRESGISDRFSGSGSGTDFTLTISEARPEDAGVYYCFANFGGAN