WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sus scrofa LUXX00000000.1 (LUXX01) 79 0 8 11 29 18 4 9
Sus scrofa LUXV00000000.1 (LUXV01) 97 1 11 9 40 19 5 12
Sus scrofa LUXY00000000.1 (LUXY01) 90 2 10 11 35 17 5 10
Sus scrofa LUXT00000000.1 (LUXT01) 81 3 7 11 28 18 5 9
Sus scrofa LUXW00000000.1 (LUXW01) 78 2 7 8 28 18 4 11
Sus scrofa LUXS00000000.1 (LUXS01) 91 1 10 10 33 19 5 13
Sus scrofa LUXTU00000000.1 (LUXU01) 84 3 7 8 30 18 5 13
Sus scrofa AORO00000000.2 (AORO02) 83 0 8 10 35 18 5 7
Sus scrofa AOCR00000000.1 (AOCR01) 93 0 11 3 45 17 5 12
Sus scrofa LUXR00000000.1 (LUXR01) 84 0 8 9 38 17 4 8
Sus scrofa LUXQ00000000.1 (LUXQ01) 80 2 4 8 33 18 4 11
Sus scrofa AJKK00000000.1 (AJKK01) 110 1 10 16 44 21 5 13
Sus scrofa AEMK00000000.2 (AEMK02) 206 32 15 50 64 23 4 18
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sus scrofa V725 trav AEMK02000057.1 576346 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V69 trav AJKK01168462.1 933 TKSQQKGVEQSPASPPIPEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V73 trav AOCR01016943.1 20845 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V74 trav AOCR01016943.1 30219 VRGVDVEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVTTERRSSLYISSAQITDSATYFCTVEHSAPQ
Sus scrofa V75 trav AOCR01016945.1 9281 VRGMDVDQSPPALSLQEGASSTLWCNFSSSTQSVQWYRLTPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSAMYLCAGEHSAPQ
Sus scrofa V76 trav AOCR01016945.1 14354 VDGPQINQIPKFSILQEGENFTTYCNSSSTLYRFQWYKQRSGGSPVFLMLLTKPGEVKKLNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V77 trdv AOCR01016945.1 22985 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V78 trdv AOCR01016946.1 16588 SSVTQKVIQDQPVVSRQVGEAVTLNCHYETGWVVYILFWYKQLPNGEMTFLIRQESNGLNTKDGRYSTNFQKAQNFISLTISALQPEDSAKYFCALRE
Sus scrofa V80 trav AOCR01016948.1 1102 VRGVDVGQRPPVLSLTEGISDTIWCNSSASVLNVLWYRQNPGGRLIELFYIPTGTKQNGRLNATTVTTERRSSLYISSAQITDSATYFCAVQHSAPQ
Sus scrofa V81 trdv AOCR01016948.1 10085 SGVAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V82 trav AOCR01016949.1 5527 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNSFQWYKQRPGGSPVFLMLLTMPGEVKKLNRLTAWFGDTRKDSSLHITAAQSADAGTYFCAE
Sus scrofa V83 trav AOCR01016950.1 367 IVVDAKTTQLSSMDCAEGEDVKLPCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V84 trav AOCR01016950.1 6727 ESTQQLEQHPPFLSIQEGEKSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V85 trav AOCR01016950.1 13494 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGEHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V86 trdv AOCR01016950.1 27842 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V87 trav AOCR01016952.1 3923 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V88 trav AOCR01016953.1 7424 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V24 iglv AORO02003891.1 2370 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V36 trav AORO02005876.1 4336 GTNGDSVNQTEVPVVLPEEAPLTLSCTYQTISSDPYLFWYVKYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V0 trav AJKK01124840.1 338 GTGAQSVTQPDSLITVPEGDPLELRCNYSSSFSPYLFWYMQYPNQGLQLLLKYVSGNPLVKGTKGFEAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V1 trdv AJKK01135924.1 16766 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V2 trdv AJKK01138171.1 140 SSMAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKEEKSLSLTISALQLQDSATYFCALRE
Sus scrofa V3 igkv AJKK01145070.1 618 ASCAIQMAQSPASLAASLGDTVSITCRASQSVSNNLAWYQQQAGKAPKLLIYWASALQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLNSAP
Sus scrofa V4 igkv AJKK01162135.1 3626 ARCAIQVTQSLASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V5 igkv AJKK01162135.1 21099 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQHEYS
Sus scrofa V6 igkv AJKK01162136.1 7999 ARCAIQVTQSPASLAASLGDTGSITCRASQSISSYLAWYQQQPGKAPKRLIYAASSLHSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V7 igkv AJKK01162136.1 11840 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCHQSIQYP
Sus scrofa V8 igkv AJKK01168299.1 10644 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLEEYGSNLLSWYQQKPGQSPRLLIYQATTRASGVPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQFKEFP
Sus scrofa V9 trav AJKK01182799.1 5036 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V10 trav AJKK01182800.1 526 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V11 trav AJKK01182800.1 14446 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V12 trav AJKK01182800.1 17808 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDPRVKQTAFHITASQPADSATYFCAA
Sus scrofa V13 trav AJKK01182800.1 27987 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V14 trav AJKK01182800.1 37518 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVSDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V15 trav AJKK01182801.1 5993 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V16 trav AJKK01182801.1 10953 VSLGEKVEQSPSLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDAAVYFCAAS
Sus scrofa V17 trav AJKK01182801.1 18892 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDTQVEDSAVYFCALSE
Sus scrofa V18 trav AJKK01182801.1 26236 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLQLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDAAVYFCAAS
Sus scrofa V19 trav AJKK01182801.1 31046 FSMAQSVIQDKPTREVPEKEAVTLDCTYDTSYPNYGLFWYKHPSSGGMTFLIHQDSYGQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V21 trav AJKK01182802.1 11529 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSSYFPWYKQEPGKGLQFLTYIRSNGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V22 trdv AJKK01182802.1 14999 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V24 trav AJKK01182803.1 19789 TKSQQKGVEQSPASPPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V25 trav AJKK01205001.1 2194 VKGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFISSGTKWNGRLNATTVTKERRSSLYISSAQITDSATYFCAVEHSAPQ
Sus scrofa V26 igkv AJKK01209525.1 1069 ARCAIQVTQSPASLAASLGDTVSITCLAGQSISSYLDWYQQQPGKAPKLLIYAASSPVSGVPSQFRGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V27 igkv AJKK01209528.1 7255 SSGAIVLTQTPLSLSVSPGEPASISCRSTQSLRGSYGKNYLNWYLQKPGQSPKLLIYWATNRASGVPDRFSGSRSGTDFTLKIIRLEAEDAGVYYCLQDIQSP
Sus scrofa V28 igkv AJKK01209529.1 1396 ARSAIQLTQSPASLAASLGDTVSITCRARQSINKWLAWYQQQPGKAPKLLIYSASTLQSGVPCGFKGSGSGTDFTLTISGLQAEDVATYYCQQHHS
Sus scrofa V29 iglv AJKK01251552.1 7902 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V30 iglv AJKK01251552.1 13405 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V31 iglv AJKK01251553.1 2033 YVASSQLTQVPGVSVSLGGTASIACLGDNFVYAANWYQQKPGQAPILVIYGGSLRPLGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V32 iglv AJKK01251553.1 8346 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V33 trav AJKK01255448.1 146 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V34 ighv AJKK01258747.1 2908 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V35 trgv AJKK01261237.1 8353 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V36 trbv AJKK01266950.1 26757 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V37 trdv AJKK01135927.1 23390 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V38 trdv AJKK01135929.1 20075 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V39 trdv AJKK01135930.1 40844 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYMMYWYRQSSSREMTRIIDIYSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V40 trav AJKK01135931.1 33701 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREVLQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V41 trav AJKK01135932.1 14098 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V42 trav AJKK01135932.1 10086 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V43 trav AJKK01135934.1 12417 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V44 trav AJKK01135934.1 8136 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFAMEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V45 trav AJKK01135936.1 3359 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V46 trav AJKK01135937.1 28702 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V47 trav AJKK01135937.1 22144 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V48 trav AJKK01135937.1 15380 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V49 trdv AJKK01135937.1 996 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V50 trdv AJKK01135939.1 3406 SGVAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V52 trav AJKK01135942.1 8812 VRGMDVEQRPPVLSLQEGASSTLWCNFSKATQYVHWYQQSRGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V53 trdv AJKK01135942.1 2719 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V54 trav AJKK01135945.1 7672 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V55 trav AJKK01135945.1 2573 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V56 trdv AJKK01135946.1 2141 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V57 trav AJKK01135947.1 19287 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V58 trav AJKK01135947.1 9726 VRGVDVEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGHLDHLFSIPSGTKRNGRLNATTVTTERRSSLHISSAQITDSATYFCTVEHSAPQ
Sus scrofa V59 trdv AJKK01135948.1 5997 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V60 trav AJKK01138077.1 16661 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V61 iglv AJKK01138923.1 830 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNNPGWFQQTPGQPPRTVIYQTNNRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V62 iglv AJKK01138925.1 4322 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRLLIYYTNSRPTGVPSRFSGGISGNKDTLTITGAQAEDEADYFCALEKSSAN
Sus scrofa V63 iglv AJKK01138927.1 3980 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V64 iglv AJKK01138928.1 9207 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V65 iglv AJKK01138928.1 3089 SWPQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKVPRSVFTYANLMAIAAPDQFSGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V66 igkv AJKK01162136.1 11053 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V67 igkv AJKK01168300.1 1233 MIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSF
Sus scrofa V68 trav AJKK01168462.1 3237 GVGAQSVTQADGHTDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSAHLSDSAKYFCALS
Sus scrofa V70 igkv AJKK01172192.1 13951 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V71 igkv AJKK01172192.1 4735 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V72 trav AJKK01174801.1 328 VRGVDVMQSPSALSVQEGASPTLWCNFSMNVNSVQWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVVKERHSSLYISSAQITDSAAYFCAVEHSAPQ
Sus scrofa V73 trav AJKK01174802.1 2596 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V74 trav AJKK01174803.1 18381 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSSANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCALR
Sus scrofa V75 trav AJKK01174803.1 14072 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSSANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCALR
Sus scrofa V76 trav AJKK01174803.1 12252 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V77 igkv AJKK01182263.1 6733 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V78 igkv AJKK01182263.1 610 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V79 trbv AJKK01184448.1 20621 DLPAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V80 trbv AJKK01184448.1 18642 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDTMYWYQQKPSQAPKLLFYYYDEGLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V81 trbv AJKK01184448.1 4373 TIDGGITQTPKYLFREEGQEVTLECKQDFDHNAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V82 trbv AJKK01184449.1 57953 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V83 trbv AJKK01184449.1 50597 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHSGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAKRPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V84 trbv AJKK01184449.1 41650 PLAAGVTQTPRHAIKSTGQTVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V85 trbv AJKK01184449.1 35436 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNGEPDKLELRNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V86 trbv AJKK01184449.1 25157 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V87 trbv AJKK01184449.1 4957 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNGSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V88 trbv AJKK01184450.1 20546 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHDYMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPENSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V89 trbv AJKK01184450.1 4229 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V90 trbv AJKK01184452.1 5577 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPENSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V91 trbv AJKK01184452.1 1471 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHDYMYWYKQSAQKPPELMFLCNLKEITENETVPSRFRPKCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V92 trbv AJKK01184453.1 1894 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNNNNPTGNESVPTRFRPDCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V93 trdv AJKK01184703.1 11250 SSMAQKVTQDQPTVSSQVGEEVTLNCRYEAPWNTNYLFWYKQPPSGEMTFLIHQDTSKTNAKDGRYSVNSRRGEKSLSLTISALQLEDSAMYFCALQD
Sus scrofa V94 trav AJKK01184703.1 3160 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V95 trav AJKK01184704.1 30424 GTNGDSVNQTEVPVVLPEEAPMTLGCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V96 trdv AJKK01184704.1 26547 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V97 trav AJKK01184704.1 12687 SMIDAQTTQPYSTDCTEGEDVKLPCNHSTISGADYIHWYRKNPNQSPQYIIHGLQSTVNNSMASLTIATDRRSSTLILPRVTMRDTAVYYCILRK
Sus scrofa V98 trav AJKK01184704.1 4958 VRGVDVEQSPPAQSLQEGASSTLWCNFSTTLVSNVQWYRQKSGGRLDHLFFIPSGTKQNGRLNATTVAKERRSSLYISFAQITDSATYLCAG
Sus scrofa V99 trav AJKK01184705.1 4130 GKKGPAAGETESQPLTVQEGDISILNCTYENSAFDYFPWYRQHPGKGPELLIAIRSGSIAKEDGRLRVFLSQSAKHVSLHIKASQPGDSATYFCAASANDLQ
Sus scrofa V100 trgv AJKK01192900.1 33078 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V101 trgv AJKK01192900.1 30419 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDAYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V102 trgv AJKK01192900.1 26629 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V103 trgv AJKK01192900.1 1019 HQEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V104 trav AJKK01218252.1 11086 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V105 trbv AJKK01256981.1 1103 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V106 igkv AJKK01258614.1 1263 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQLLIYYATNRDTGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCLQFKESP
Sus scrofa V109 trbv AJKK01266952.1 25389 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTREKFPISRPNLMFSILTVSNVSSEDSSSYFCSAGDRVL
Sus scrofa V110 trbv AJKK01266953.1 33992 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLQSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V111 trbv AJKK01266953.1 29196 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSE
Sus scrofa V44 igkv AORO02007320.1 377 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V112 trbv AJKK01266953.1 13066 PVEANVTQSPSHRIAETKKTLTMTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V113 trbv AJKK01266953.1 3005 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V114 iglv AJKK01271193.1 16694 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V0 igkv AOCR01000232.1 647 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCHQSIQYP
Sus scrofa V9 trgv AOCR01006132.1 11301 GLSLSRVEQSQVSVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLVYVTSITVPAQNQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDAGIYYCAGWN
Sus scrofa V10 trgv AOCR01006132.1 13103 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDAYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V11 trgv AOCR01006133.1 3391 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V12 trgv AOCR01006135.1 15934 QEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V13 trgv AOCR01006139.1 350 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGSTYYCAVWE
Sus scrofa V39 trav AOCR01016919.1 18780 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V40 trav AOCR01016925.1 685 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V41 trav AOCR01016930.1 4794 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLKITAAQPGDSATYFCATG
Sus scrofa V42 trav AOCR01016930.1 8083 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHITASQPADSATYFCAA
Sus scrofa V43 trav AOCR01016930.1 18414 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V44 trav AOCR01016931.1 6688 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V45 trav AOCR01016933.1 2465 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V46 trav AOCR01016933.1 7188 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V47 trav AOCR01016933.1 15139 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V48 trav AOCR01016934.1 5831 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSSYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V49 trav AOCR01016934.1 10616 FSMAQSVIQDKPTREVPEKEAVTLDCTYDTSYPNYGLFWYKHPSSGGMTFLIHQDSYGQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V51 trdv AOCR01016934.1 27031 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V53 trav AOCR01016934.1 56321 TKSQQKGVEQSPASPPISEGAGSPLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V54 trav AOCR01016934.1 62178 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V55 trav AOCR01016934.1 70390 GVGAQSVTQADGHTDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSAHLSDSAKYFCALS
Sus scrofa V56 trav AOCR01016934.1 72803 TKSQQKGVEQSPASPPIPEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V57 trav AOCR01016934.1 82351 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V58 trav AOCR01016934.1 94081 GTNGDSVNQTEVPVVLPEEAPMTLSCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V59 trav AOCR01016935.1 3416 GTNGDSVNQTEGLVILPEEAPMTLNCTYKTTYSDYFFWYVQYLNKAPQLLLKGSSANPRPKEQGFQATLDTTDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V60 trav AOCR01016935.1 6828 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSTANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V61 trav AOCR01016935.1 8641 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V62 trav AOCR01016937.1 5570 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V63 trav AOCR01016937.1 8113 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V64 trav AOCR01016937.1 12015 VRGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSATYFCAVEHSAPQ
Sus scrofa V65 trav AOCR01016940.1 572 GTNGDSVNQTEVPVVLPEEAPMTLSCAYETLDSAPYLFWYVQYPNRAPQLLMKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V66 trdv AOCR01016940.1 4369 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMTFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTISVLQLEDSAMYFCALQD
Sus scrofa V67 trav AOCR01016942.1 1321 SMIDAQTTQPYSTDCTEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSTVNNSMASLTIATDRRSSTLILPRVTLRDTAVYYCILRK
Sus scrofa V68 trav AOCR01016942.1 8982 VRGVDVEQSPPALSLQEGASSTFWCNFPTTLVSNVQWYRQKSGGHLDHLFFIPSGTKQNGRLNATTVAKERRSSLYISFAQITDSATYLCAG
Sus scrofa V69 trdv AOCR01016942.1 15174 SSMAQKVTQDQPTVSSQVGEEVTLNCRYEAPWNTNYLFWYKQPPSGEMTFLIHQDTSKTNAKDGRYSVNSRRGEKSLSLTISALQLKDSATYFCALRD
Sus scrofa V70 trav AOCR01016942.1 22990 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V71 trav AOCR01016943.1 5717 VKGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSATYFCAVEHSAPQ
Sus scrofa V72 trdv AOCR01016943.1 13217 SSVSQKVTQDQPAVFSQVREPVTLNCSYEIGWNWLKYNLFWYKQPPSGEMTFLIRQYSDSSNARGGRYSINFQKAQKSISLTISALQLKDSATYFCALRD
Sus scrofa V89 trav AOCR01016953.1 11697 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V90 trav AOCR01016959.1 8370 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V91 trav AOCR01016960.1 3164 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAAVYFCAYSA
Sus scrofa V92 trav AOCR01016962.1 22968 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V93 trdv AOCR01016967.1 3207 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYMMYWYRQSSSREMTRIIDIFSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V94 trdv AOCR01016968.1 13832 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V95 trdv AOCR01016969.1 11320 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V102 trbv AOCR01020492.1 1494 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V103 trbv AOCR01020493.1 2896 SVDTGVTQTPRYLVLGTRDNRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNNNNPTGNESVPTRFRPDCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V104 trbv AOCR01020494.1 1915 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V105 trbv AOCR01020495.1 7196 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V106 trbv AOCR01020495.1 12166 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V107 trbv AOCR01020495.1 19333 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHSGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V108 trbv AOCR01020496.1 3038 PLAAGVTQTPRHAIKSTGQTVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPNNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V109 trbv AOCR01020496.1 9231 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNGEPDKLELRNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V110 trbv AOCR01020497.1 4381 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V111 trbv AOCR01020500.1 8420 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNGSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V112 trbv AOCR01020501.1 1984 PMGAMVTQNPRYQLTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V113 trbv AOCR01020503.1 8772 TIDGGITQTPKYLFREEGQEVTLECKQDFDHNAMYWYRQDPGQGLRLIYFSQVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V320 igkv AOCR01114363.1 6222 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V321 igkv AOCR01114363.1 15266 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQSGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V368 trbv AOCR01140792.1 8648 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V369 trbv AOCR01140793.1 4081 CLFLTGFMDAGVHQTPRHCVTGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSGYFCASSK
Sus scrofa V370 trbv AOCR01140795.1 2906 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSI
Sus scrofa V371 trbv AOCR01140796.1 2967 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTREKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V397 trav AOCR01169999.1 75 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V458 iglv AOCR01207990.1 4022 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYQTNSRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V459 iglv AOCR01207994.1 538 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V460 iglv AOCR01207996.1 6049 VDSQTVIQEPAMSVSLGGTVTLSCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V462 iglv AOCR01207997.1 12239 VDSQTVIQEPAMSVSLGGTVTLSCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V463 iglv AOCR01207997.1 25447 VDSQTVIQEPAMSVSLGGTVTLSCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V464 iglv AOCR01208012.1 11401 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V465 iglv AOCR01208015.1 2072 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V466 iglv AOCR01208015.1 7510 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V467 iglv AOCR01208017.1 1024 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V468 iglv AOCR01208018.1 2072 YVASSQLTQVPGVSVSLGGTASIACLGDNFVYAANWYQQKPGQAPILVIYGGSLRPLGIPERFSGSSSGNSATLTISGAQAEDEADYYCQSADSSDN
Sus scrofa V469 iglv AOCR01208018.1 7485 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V539 trdv AOCR01016975.1 15674 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSNPDLYWYRIRPDRTFQLVLYRDNTRSYDAYFARGRFSVQHSLAHKTFHLVISSVTTEDTATYYCALD
Sus scrofa V719 trav AOCR01108113.1 10882 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Sus scrofa V773 trbv AOCR01140800.1 20604 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFYSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V54 igkv AORO02009222.1 255464 MIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSF
Sus scrofa V81 trbv AORO02012298.1 742406 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V109 iglv AORO02016814.1 12570 SWAQAVLTQLLSTSGSLGQRVTLSCTGSSSNIGSGNTVNWSQQLPGKAPRTIIDGNSNRPSGVPDQFSGSKSGSSGTLTITGLQAEDDAEYYCVAWEDSLDG
Sus scrofa V110 iglv AORO02016814.1 23411 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPGWYQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALGKSCTN
Sus scrofa V111 iglv AORO02016814.1 55189 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRLLIYYTNSRPTGVPSCFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V122 trgv AORO02019098.1 27962 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNINYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V130 trav AORO02021239.1 79 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V131 trav AORO02021300.1 206 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKKEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V155 trav AORO02025167.1 7080 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V156 trav AORO02025167.1 13440 ESTQQLEQHPPFLSIQEGEKSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V157 trdv AORO02025167.1 34581 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V158 trav AORO02025167.1 42910 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V159 trav AORO02025167.1 60580 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V160 trav AORO02025167.1 64853 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V161 trav AORO02025167.1 95119 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V162 trav AORO02025167.1 99121 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAAVYFCAYSA
Sus scrofa V163 trav AORO02025167.1 140883 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V164 trdv AORO02025167.1 179282 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRQNSEGRYSVQFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V165 trdv AORO02025167.1 227304 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V166 trdv AORO02025167.1 251124 VMSAVVLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFTYREGGMYGPGFRDNFQGETDYSNNQAVLKFLKASERDEGSYYCAT
Sus scrofa V193 igkv AORO02029473.1 5484 ASCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V257 igkv AORO02038979.1 2143 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V258 iglv AORO02039036.1 1669 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPGWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V274 igkv AORO02041928.1 9862 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V275 igkv AORO02041928.1 20024 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V292 trav AORO02044808.1 4587 VKGVDVEQSPPALSLQEGDSSTLWCSFSTTVNNVQWYRQYRNGSLVHLFSIPSGTKHNGRLNATTVTTERRSSLHISSAQITDSATYLCAVEHSAPQ
Sus scrofa V314 iglv AORO02049352.1 8077 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V315 iglv AORO02049352.1 14201 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V338 trav AORO02052983.1 19394 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V339 trav AORO02052983.1 75882 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V340 trav AORO02052983.1 92536 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V341 trav AORO02052983.1 106354 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V342 trav AORO02052983.1 109632 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V343 trav AORO02052983.1 119976 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V344 trav AORO02052983.1 128490 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V345 trav AORO02052983.1 136003 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V346 trav AORO02052983.1 140991 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKKEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V347 trav AORO02052983.1 148919 SSTAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V348 trdv AORO02052983.1 159432 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V350 trav AORO02052983.1 188749 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKASKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V378 igkv AORO02058318.1 283 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLESYTYYNVLRWYQQKPGQSPQLLIYEATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQFKESP
Sus scrofa V396 trgv AORO02062421.1 4599 QEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V403 trav AORO02063391.1 3955 VRGVDAEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVTTERRSSLYISSAQITDSATYFCTVEHSAPQ
Sus scrofa V487 trbv AORO02001699.1 86379 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V488 trbv AORO02001699.1 81104 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V489 trbv AORO02001699.1 72834 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQTLGQGLEFLTYFQSKEEPDKLELRNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V490 trbv AORO02001699.1 63624 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V491 trbv AORO02001699.1 57441 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNGEQDKLELRNGRFSAKRPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V492 trbv AORO02001699.1 45927 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V493 trbv AORO02001699.1 25659 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNGSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V494 trbv AORO02001699.1 20755 DPSAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V495 trbv AORO02001699.1 18799 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEGLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V496 trbv AORO02001699.1 2734 TVDGGITQTPKYLFREEGQEVTLECKQDFDHNAMYWYRQDPGQGLRLIYFSQVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V534 trav AORO02008475.1 510510 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Sus scrofa V553 trbv AORO02012298.1 846890 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRPDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V554 trbv AORO02012298.1 842079 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V555 trbv AORO02012298.1 820640 PVEANVTQSPSHRIAETKKTLTMTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V556 trbv AORO02012298.1 819532 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V557 trbv AORO02012298.1 809182 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V558 trbv AORO02012298.1 804546 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V584 trav AORO02016884.1 9071 GTRAQTVTQPKDHISVFETSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V602 trav AORO02019584.1 363 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAAVYFCAYSA
Sus scrofa V647 igkv AORO02027082.1 1695 ASCAIQMAQSPASLAASLGDTVSITCRASQSVSNNLAWYQQQAGKAPKLLIYWASALQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLNSAP
Sus scrofa V725 trgv AORO02040986.1 26367 GLSLSRVEQSQVSVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLVYVTSITVPAQNQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDAGIYYCAGWN
Sus scrofa V726 trgv AORO02040986.1 24602 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V727 trgv AORO02040986.1 20833 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V747 trdv AORO02043454.1 33645 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V756 iglv AORO02044665.1 4897 SVFSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V800 igkv AORO02050920.1 13589 SSGAIVLTQTPLSLSVSPGEPASISCRSTQSLRGSYGKNYLNWYQQKPGQSPKLLIYWATNRASGVPDRFSGSRSGTDFTLKIIRLEAEDAGVYYCLQDIQSP
Sus scrofa V801 igkv AORO02050920.1 5149 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V849 trav AORO02060532.1 35132 GTNGDSVNQTEGLVILPEEAPMTLNCTYQTTYSDYFFWYVQYLNKAPQLLLKGSSANPRPKEQGFQATLDTTDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V850 trav AORO02060532.1 31722 ETSGDSVNQTEVPVILSEEATMILNCTYQTTFSDFYVFWYIQYLNQAPQFLLKGSTANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCALR
Sus scrofa V851 trav AORO02060532.1 29915 SIKAQNVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V852 trav AORO02060532.1 11812 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V853 trav AORO02060532.1 7524 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V854 trav AORO02060532.1 2013 VRGVDVMQSPPALSVQEGASPTLWCNFSMNVNSVHWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSAAYFCAGEHSA
Sus scrofa V878 trav AORO02064488.1 1582 VRGMDVDQSPPALSLQEGASSTLWCNFSSSTRSVQWYRLTPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V885 trbv AORO02065879.1 10344 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHINSLEPGDSAVYFCASS
Sus scrofa V897 trav AORO02067141.1 9412 VRGVDVGQRPPVLSLTEGISDTIWCNSSASVLNVLWYRQNPGGRLIELFYIPTGTKQNGRLNATTVTTERRSSLYISSAQITDSATYFCAVQHSAPQ
Sus scrofa V898 trdv AORO02067141.1 456 SGVAQKVTQDQPVVSRQVGEEGTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V0 iglv LUXQ01004047.1 5414 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V1 iglv LUXQ01015433.1 2862976 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYHTNNRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V3 trav LUXQ01027721.1 1026 VRGMDVDQSPPALSLQEGASSTLWCNFSSSTQSVQWYRLTPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSAMYLCAGEHSAPQ
Sus scrofa V4 trav LUXQ01027721.1 6113 VDGQQINQIPKFSILQEGENFTTYCNSSSTLYRFQWYKQRSGGSPVFLMLLTKPGEVKKLNRLTARFGDTGKYSSLHITAAQSADAGTYFCAE
Sus scrofa V5 trdv LUXQ01027721.1 14697 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V6 trav LUXQ01027721.1 27613 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVTTERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V7 trdv LUXQ01027721.1 33718 SSVTQKVIQDQPVVSRQVGEAVTLNCHYETGWVVYILFWYKQLPNGEMTFLIRQESNGLNTKDGRYSTNFQKAQNFISLTISALQPEDSAKYFCALRE
Sus scrofa V9 trdv LUXQ01027721.1 56800 SGVAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V13 trdv LUXQ01043640.1 1238819 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V14 ighv LUXQ01047032.1 1604 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYAVSWVRQAPGKGLEWLAGIYSSGSSTYYADSVKGRFTISKDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V15 iglv LUXQ01049562.1 3095 SWAQAVLTQPPSESGSLGQRVTLSCTGSSTNIGGGNSVNWSQPLPGKAPRSVFTYANLMAIAAPDQISGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V16 iglv LUXQ01049562.1 12493 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V17 igkv LUXQ01055988.1 14413 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V18 igkv LUXQ01055988.1 21516 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V20 trdv LUXQ01076699.1 5413 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSINFQKAQKSISLTISALQLDDSATYFCALRD
Sus scrofa V21 trav LUXQ01076699.1 13120 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAMYYCILRD
Sus scrofa V22 trav LUXQ01076699.1 22680 VRGVDVEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVTTERRSSLYISSAQITDSATYFCTVEHSAPQ
Sus scrofa V23 trdv LUXQ01076699.1 42087 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V24 trgv LUXQ01084103.1 4250 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFQEGTAPQRLLYYDVSSSKVMLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V27 igkv LUXQ01116911.1 5851 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKRLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHNN
Sus scrofa V31 trav LUXQ01002037.1 621 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V32 igkv LUXQ01018440.1 5887 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V33 igkv LUXQ01018440.1 1877 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCHQSIQYP
Sus scrofa V36 trav LUXQ01042820.1 16601 GTGAQSVTQSDSLITVPEGDPLELRCNYSSSFSTYHFWYVQYPNQGLQLLLKYVSGNSLVKGTKGFEAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V37 trav LUXQ01042820.1 12750 VRGVDVMQSPPALSVQEGASPTLWCNFSMNVNSVHWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSAAYFCAGEHSA
Sus scrofa V38 trav LUXQ01043640.1 1576066 IVVDAKTTQLSSMDCAEGEDVKLPCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V39 trav LUXQ01043640.1 1569713 ESTQQLEQHPPFLSIQEGEKSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDTGTYLCAG
Sus scrofa V40 trav LUXQ01043640.1 1562938 LRVQMKVEQSPGILMLQEGKNSTLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V41 trdv LUXQ01043640.1 1548885 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V42 trav LUXQ01043640.1 1541897 IVGDAKTTQPVSVESTEEDAVHLLCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V43 trav LUXQ01043640.1 1524244 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V44 trav LUXQ01043640.1 1519972 RVKADWIRPQETRVSGMEGKTVSLLCNYYTSSTGYIDLFWYRQYPNQAPEYILYRGWGYSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V45 trav LUXQ01043640.1 1491177 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V46 trav LUXQ01043640.1 1487165 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V47 trav LUXQ01043640.1 1445306 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V48 trdv LUXQ01043640.1 1407408 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V49 trdv LUXQ01043640.1 1359832 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V50 trdv LUXQ01043640.1 1336945 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V51 trav LUXQ01055942.1 195719 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V52 trav LUXQ01055942.1 140639 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V53 trav LUXQ01055942.1 123770 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V54 trav LUXQ01055942.1 109968 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V55 trav LUXQ01055942.1 106691 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V56 trav LUXQ01055942.1 96349 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V57 trav LUXQ01055942.1 87918 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V58 trav LUXQ01055942.1 80364 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V59 trav LUXQ01055942.1 75386 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V60 trav LUXQ01055942.1 67440 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V61 trav LUXQ01055942.1 60125 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDAAVYFCAAS
Sus scrofa V62 trav LUXQ01055942.1 55320 FSMAQSVIQDKPTREVPEKEAVTLDCTYDTSYPNYGLFWYKHPSSGGMTFLIHQDSYGQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V64 trav LUXQ01055942.1 42345 VSLGEKVEQSPTLSVQEGNSSVITCTYMDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V65 trdv LUXQ01055942.1 38872 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V67 trav LUXQ01055942.1 9190 TKSQQKGVEQSPASPPISEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V68 trav LUXQ01055942.1 2990 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V69 trav LUXQ01061783.1 4207 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V70 igkv LUXQ01062762.1 8856 MIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSF
Sus scrofa V71 ighv LUXQ01087399.1 6053 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V73 trbv LUXQ01106430.1 9784 TLDTAVFQTPKYLIIHTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V74 igkv LUXQ01110997.1 3958 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V75 igkv LUXQ01113212.1 7145 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQSGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V79 trbv LUXQ01117209.1 22656 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFYSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V81 trbv LUXQ01120728.1 54381 SLDAAVTQIPRNKITNTGKITVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V82 trbv LUXQ01120728.1 49585 CLFLTGFMDAGVHQTPRHCVIGTGKNITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSGYFCASSK
Sus scrofa V83 trbv LUXQ01120728.1 33384 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V85 trbv LUXQ01120728.1 18803 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V86 trbv LUXQ01129801.1 105975 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHDYMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V87 trbv LUXQ01129801.1 99105 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFLCDLKDITENETIPSRFSPKCPESSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V88 trbv LUXQ01129801.1 83007 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V89 trbv LUXQ01129801.1 78007 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQDPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V91 trbv LUXQ01129801.1 70831 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHNGLYWYRQTLGQGLEFLTYFQRNGEQDKLELRNGRFSAKRPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V92 trbv LUXQ01129801.1 61475 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V93 trbv LUXQ01129801.1 55258 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNGEQDKLELRNGRFSAKRPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V94 trbv LUXQ01129801.1 44980 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V95 trbv LUXQ01129801.1 24692 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNRSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V96 trbv LUXQ01129801.1 19919 DLSAGVTQFPSHRVIKKEKAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V97 trbv LUXQ01129801.1 17947 PMGAMVTQNPRYQLTRRGTPVNLSCFQNMNHDTMYWYQQKPSQAPKLLFYYYDDGLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V98 trbv LUXQ01129801.1 2416 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSQVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V99 trgv LUXQ01133090.1 44639 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V100 trgv LUXQ01133090.1 40930 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V101 trgv LUXQ01133090.1 15333 QEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V2 trav LUXR01009133.1 4534 GTNGDSVNQTEVPVVLPEEAPMTLSCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V5 igkv LUXR01025710.1 2063 ARCAIQVTQSLASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V6 igkv LUXR01025710.1 19602 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V8 trav LUXR01043419.1 1122599 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V9 trav LUXR01043419.1 1178027 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V10 trav LUXR01043419.1 1194707 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V11 trav LUXR01043419.1 1208524 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V12 trav LUXR01043419.1 1211802 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V13 trav LUXR01043419.1 1222154 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V14 trav LUXR01043419.1 1230565 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V15 trav LUXR01043419.1 1238132 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V16 trav LUXR01043419.1 1243108 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V17 trav LUXR01043419.1 1251051 SSTAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V18 trav LUXR01043419.1 1258165 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V19 trdv LUXR01043419.1 1261635 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V21 trav LUXR01043419.1 1290953 TKSQQKGVEQSPASPPISEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V22 trav LUXR01043419.1 1296716 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKASKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V23 iglv LUXR01063581.1 5400 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V26 trbv LUXR01070200.1 757433 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V27 trav LUXR01093129.1 79 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCME
Sus scrofa V30 trav LUXR01109342.1 5577 GTNGDSVNQTEGLVVLPEEAPMTLSCTYQTTYSVSGLFWYVQYLNKAPQLLLKGSTANPRAEEQGFQATLDTSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V31 iglv LUXR01118250.1 14853 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V32 trdv LUXR01119509.1 1235807 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSNPDLYWYRIRPDRTFQFVLYRNNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V33 trav LUXR01011612.1 2301 VRGVDVEQSPPAQSLQEGASSTLWCNFSTTLVSNVQWYRQKSGGRLDHLFFIPSGTKQNGRLNATTVVKERRISLYISSAQITDSATYLCAG
Sus scrofa V35 igkv LUXR01013063.1 8862 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V36 igkv LUXR01013310.1 6774 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V37 igkv LUXR01013310.1 692 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V38 trav LUXR01024114.1 17260 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V39 trav LUXR01024114.1 14732 GTGAQSVTQSDSLITVPEGDPLELRCNYSSSFSTYHFWYVQYPNQGLQLLLKYVSGNSLVKGTKGFEAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V40 trav LUXR01024114.1 10545 VRGVDVMQSPPALSVQEGASPTLWCNFSMNVNSVHWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSAAYFCAGEHSA
Sus scrofa V41 igkv LUXR01024449.1 3814 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGGGSGTDFTLTISGLQAEDVATYYCLQHSS
Sus scrofa V42 trav LUXR01025788.1 621 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V43 iglv LUXR01039408.1 130791 VDSQTVIQEPAMSVSLGGTVTLTCAYSSGSVTSSNYPGWFQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSCTN
Sus scrofa V44 iglv LUXR01039408.1 116841 VDSQTVIQEPAMSVSLGGTVTLTCAYSSGSVTSSNYPGWFQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V46 iglv LUXR01039408.1 101290 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYRTNSRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALEKSSAN
Sus scrofa V48 iglv LUXR01039408.1 362 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V49 trbv LUXR01039677.1 10396 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V50 trav LUXR01056232.1 26099 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAMYYCILRD
Sus scrofa V51 trav LUXR01056232.1 16525 VRGVDVEQSPPALSLQEGASSTLWCNFSISTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVAKERHSSLYISSAQITDSATYFCTVEHSAPR
Sus scrofa V52 trgv LUXR01056936.1 212099 GLSLSRVEQSQVSVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLVYVTSITVPAQNQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDAGIYYCAGWN
Sus scrofa V53 trgv LUXR01056936.1 210252 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V54 trgv LUXR01056936.1 206472 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V55 trgv LUXR01056936.1 180506 QEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V56 trav LUXR01058868.1 536 GVGAQSVTQADGHTDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSAHLSDSAKYFCALS
Sus scrofa V57 trbv LUXR01063738.1 85573 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V58 trbv LUXR01063738.1 80602 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQPFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V59 trbv LUXR01063738.1 73441 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQTLGQGLEFLTYFQSKEEQDKLELRNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V60 trbv LUXR01063738.1 64179 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V61 trbv LUXR01063738.1 57993 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQNEEPDKSKLSNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V62 trbv LUXR01063738.1 47711 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V63 trbv LUXR01063738.1 27524 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNRSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V64 trbv LUXR01063738.1 22690 DLSAGVTQFPSHRVIKKEKAVSMRCDPMSGHEYLFWYQRAVGNEMKFLVSFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V65 trbv LUXR01063738.1 20702 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDTMYWYQQKPSQAPKLLFYYYDDGLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V66 trbv LUXR01063738.1 6369 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V73 trbv LUXR01070200.1 853113 SLDAAVTQIPRNKITNTGKITVLECSQTNDHEYMYWYRPDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V74 trbv LUXR01070200.1 848450 CLFLTGFMDAGVDQTPRHCVIGTGKNITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSGYFCASSK
Sus scrofa V75 trbv LUXR01070200.1 832331 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSI
Sus scrofa V76 trbv LUXR01070200.1 821852 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V77 trbv LUXR01070200.1 817246 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTREKFPISRPNLMFSILTVSNVSSEDSSSYFCSAGDRVL
Sus scrofa V78 trav LUXR01084523.1 3140 VKGVDVEQSPPALSLQEGDSSTLWCSFSTTVNNVQWYRQYRNGSLVHLFFISSGTKQNGRLNATTVTTERRSSLHISSAQITDSATYLCAVEHSAPQ
Sus scrofa V79 igkv LUXR01108601.1 1876 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V80 igkv LUXR01111102.1 15700 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V81 igkv LUXR01111102.1 6611 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V82 iglv LUXR01116833.1 6489 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V83 iglv LUXR01116833.1 356 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V84 trav LUXR01119509.1 1645161 VRGMDVDQSPPALSLQEGASSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V85 trav LUXR01119509.1 1640051 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCME
Sus scrofa V86 trav LUXR01119509.1 1617624 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVTTERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V87 trdv LUXR01119509.1 1611532 SGVAQKVIQDQPVVSRQVGEEGTLNCRYETSQSAYYLLWYKQPPSGEMTFLIRQESNGLNTKDGRYSTNFQKAQNFISLTISALQPEDSAKYFCALWE
Sus scrofa V89 trav LUXR01119509.1 1597631 VRGVDVGQRPPVLSLTEGISDTIWCNSSASVLNVLWYRQNPGGRLIELFYIPTGTKQNGRLNATTVTTERRSSLYISSAQITDSATYFCAVQHSAPQ
Sus scrofa V90 trdv LUXR01119509.1 1588636 SGVAQKVIQDQPVVSRQVGEAVTLNCRYETSWNEYILLWYKQPPSGEMTFLIRQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V91 trav LUXR01119509.1 1572428 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V92 trav LUXR01119509.1 1566068 ESTQQLEQHPPFLSIQEGEKSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V93 trav LUXR01119509.1 1559290 LRVQMKVEQSPGILMLQEGKNSTLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V94 trdv LUXR01119509.1 1544763 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V95 trav LUXR01119509.1 1537461 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V96 trav LUXR01119509.1 1519903 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V97 trav LUXR01119509.1 1515588 RVKADWIRPQETRVSGMEGKTVSLLCNYYTSYTGYIDLFWYRQYPNQAPEYILYRGWGYSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V98 trav LUXR01119509.1 1488582 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V99 trav LUXR01119509.1 1484574 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V100 trav LUXR01119509.1 1443125 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V101 trdv LUXR01119509.1 1405239 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V102 trdv LUXR01119509.1 1357799 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V103 trdv LUXR01119509.1 1333903 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFTYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERNEGSYYCAT
Sus scrofa V2 igkv LUXS01002738.1 3857309 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V3 igkv LUXS01007838.1 9047 ARSAIQLTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHSS
Sus scrofa V4 trgv LUXS01010458.1 4398 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V5 trgv LUXS01012726.1 330400 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V6 trgv LUXS01012726.1 332243 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDAYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V7 trgv LUXS01012726.1 336063 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V8 trgv LUXS01012726.1 361561 HQEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKSDEGLYYCAAWD
Sus scrofa V9 trbv LUXS01019336.1 21654 SLDAAVTQIPRNKITNTGKRTVLECSQTNNHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V10 trbv LUXS01019336.1 26435 CLFLTGFMDAGVHQTPRHCVIGTGKNITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V11 trbv LUXS01019336.1 42337 PVEANVTQSPSHRIAETKKTLTMTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSI
Sus scrofa V12 trbv LUXS01019336.1 52743 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V13 trbv LUXS01019336.1 57337 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V14 iglv LUXS01021777.1 279 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V15 trdv LUXS01024015.1 7313 SSMAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMIFLIYQYSASRNAKDGRYFINFQKEEKSLSLTISALQLQDSATYFCALRE
Sus scrofa V16 trav LUXS01024015.1 16957 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKLNRLTAWFGDTRKDSSLHITAAQSADAGTYFCTE
Sus scrofa V17 trdv LUXS01024263.1 3927 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V19 trav LUXS01026859.1 4224 SMIDAQTTQPYSTDCTEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQYIIHGLQSTVNNSMASLTIATDRRSSTLILPRVTMRDTAVYYCILRK
Sus scrofa V20 trav LUXS01026859.1 11888 VRGVDVEQSPPALSLQEGASSTFWCNFPTTLVSNVQWYRQKSGGHLDHLFFIPSGTKQNGRLNATTVVKERRISLYISSAQITDSATYLCAG
Sus scrofa V21 trav LUXS01029910.1 1115 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V22 trav LUXS01035603.1 37 SIKAQNVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V23 trdv LUXS01039537.1 5956 SSVAQEVTQDQPDVFSQVGEAVTLNCRYEIGWNWIYYNLLWYKQPPSGEMTFLIRQYSDSSNARDGRYSVNFQKAQKSISLTISALQLKDSATYFCALRD
Sus scrofa V24 trdv LUXS01051306.1 1240998 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V25 igkv LUXS01051839.1 2001 ARSATQLTQSPASLAASLGDTVSITCQPSQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V30 trbv LUXS01062480.1 1316275 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V31 trbv LUXS01062480.1 1327834 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPENSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V32 trbv LUXS01062480.1 1334734 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFRPDCPESSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V33 trbv LUXS01062480.1 1350768 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V34 trbv LUXS01062480.1 1355753 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQGPQFLLQYYNMEEREKGNISDRFSGQQFRDNDSELKLLSLELKDSALYLCASSE
Sus scrofa V35 trbv LUXS01062480.1 1362856 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAKRPEGSVSHLTILRVEPQDSAVYLCASSL
Sus scrofa V36 trbv LUXS01062480.1 1372199 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V37 trbv LUXS01062480.1 1377602 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNEEQDKLELRNGRFSVERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V38 trbv LUXS01062480.1 1387890 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMEDFSLILESVVPSRTSVYLCASSN
Sus scrofa V39 trbv LUXS01062480.1 1408077 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHESLYWYRQTPGQGLEFLIYFNNGSPVDKSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V40 trbv LUXS01062480.1 1412896 DLPAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V41 trbv LUXS01062480.1 1414843 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V42 trbv LUXS01062480.1 1429135 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V46 trav LUXS01000947.1 824 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V50 igkv LUXS01004594.1 5059 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V51 trdv LUXS01006719.1 611 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V52 trav LUXS01015763.1 1327 GTNGDSVNQTEVPVVLPEEAPMTLNCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V53 trbv LUXS01019336.1 116697 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPNLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V54 igkv LUXS01032497.1 6888 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQAEDVRTYYCQQ
Sus scrofa V55 igkv LUXS01032497.1 853 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V56 iglv LUXS01040044.1 169154 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V57 iglv LUXS01040044.1 156196 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V58 iglv LUXS01040044.1 150091 SWAQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKVPRSVFTYANLMAIAAPDQFSGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V59 iglv LUXS01040044.1 140968 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V61 iglv LUXS01040044.1 38273 YVASSKLTQPPGVSVSLGGTASITCQGANFGSYYAHWYQQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTITGAQAEDEADYYCQVYDGGYH
Sus scrofa V62 iglv LUXS01040044.1 30300 YVASSKPTQPPGVSVSLGGTASIACQGDNFGSYYAHWYQQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V63 iglv LUXS01040044.1 24837 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSIDN
Sus scrofa V64 iglv LUXS01040044.1 18759 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V65 iglv LUXS01040044.1 12956 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V66 trav LUXS01051306.1 1587064 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKLNRLTAWFGDTKKDSSLHITAAQSADAGTYFCTE
Sus scrofa V67 trav LUXS01051306.1 1578893 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V68 trav LUXS01051306.1 1572533 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V69 trav LUXS01051306.1 1565746 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V70 trdv LUXS01051306.1 1551366 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V71 trav LUXS01051306.1 1544334 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V72 trav LUXS01051306.1 1526578 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V73 trav LUXS01051306.1 1522307 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V74 trav LUXS01051306.1 1495478 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V75 trav LUXS01051306.1 1491476 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V76 trav LUXS01051306.1 1449712 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREVLQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V77 trdv LUXS01051306.1 1410423 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRRNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V78 trdv LUXS01051306.1 1362434 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V79 trdv LUXS01051306.1 1339621 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V80 ighv LUXS01052063.1 436 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDLSDYAFSWVLQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V81 trdv LUXS01052211.1 34322 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V82 trav LUXS01052211.1 27308 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V83 trav LUXS01052211.1 22202 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V84 trdv LUXS01052211.1 13657 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSATYFCALWE
Sus scrofa V85 trav LUXS01054605.1 14514 GTNGDSVNQTEASVVLQEEAPLTLSCTYQTISSDPYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V86 trav LUXS01054605.1 7501 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSGLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V87 trav LUXS01054605.1 1146 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSDYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V88 igkv LUXS01057516.1 6276 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKRLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V89 igkv LUXS01057516.1 2268 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCHQSIQYP
Sus scrofa V90 igkv LUXS01058782.1 17387 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V91 igkv LUXS01058782.1 8479 AMCAIQVTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V96 trdv LUXS01068996.1 5871 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V97 trav LUXS01077352.1 433 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V98 trav LUXS01078971.1 154618 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V99 trav LUXS01078971.1 99546 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V100 trav LUXS01078971.1 82615 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIIPADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V101 trav LUXS01078971.1 68782 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V102 trav LUXS01078971.1 65506 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V103 trav LUXS01078971.1 55166 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V104 trav LUXS01078971.1 46729 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V105 trav LUXS01078971.1 39022 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V106 trav LUXS01078971.1 34045 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSDYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V107 trdv LUXS01078971.1 30574 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V109 trav LUXS01078971.1 1235 TKSQQKGVEQSPASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFAMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V0 igkv LUXT01000384.1 7602 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLGWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHSS
Sus scrofa V3 trav LUXT01014138.1 4018 VRGMDVDQSPPALSLQEGASSTLWCNFSSSTQSVQWYRLTPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V7 ighv LUXT01020300.1 118 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFNLSDYAFSWVLQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V9 iglv LUXT01032687.1 22467 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYRTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSGAT
Sus scrofa V10 iglv LUXT01032687.1 36661 SWPQAVLTQLLSTSGSLGQRVTLSCTGSSSNIGSGNTVNWSQQLPGKAPRTIIDGNSNRPSGVPDQFSGSKSGSSGTLTITGLQAEDDAEYYCVAWEDSLDG
Sus scrofa V11 iglv LUXT01032687.1 64009 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V12 igkv LUXT01032782.1 5299 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V13 ighv LUXT01037884.1 5737 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V15 iglv LUXT01039238.1 93504 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V16 trav LUXT01043760.1 1115 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V17 trdv LUXT01048723.1 5433 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V18 trdv LUXT01049809.1 8124 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTVSVLQLEDSATYFCALRD
Sus scrofa V19 igkv LUXT01051436.1 266261 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V21 igkv LUXT01054532.1 1804 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLVDSDGDSLLHWYLQKPGQSPRLLFYFATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQNKESP
Sus scrofa V22 trbv LUXT01065621.1 119 GYGFGALVSQHPSRAICKSGASVTIQCRTVDLQATTMFWYHQFPEQGPLLIATSNMGSNATYEKGYNSAKFLISHPDQTFSSLVVRSVHPADSSLYLCAAS
Sus scrofa V23 trdv LUXT01071533.1 28 SSVAQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIRQYSDSSNARDGRSSVNFQKAQKSISLTISALQLEDSAKYFCALRD
Sus scrofa V24 ighv LUXT01071611.1 4073 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSTYINWVRQAPGKGLEWLAAISTSGGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V26 trbv LUXT01085870.1 18230 SLDAAVTQIPRNKITNTGKITVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V27 trbv LUXT01085870.1 23011 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKVEHPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V28 trbv LUXT01085870.1 39680 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V29 trbv LUXT01085870.1 50079 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V30 trbv LUXT01085870.1 54679 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V32 igkv LUXT01092308.1 2133 ARCAIQVTQSLASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V33 iglv LUXT01001586.1 621426 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V37 trav LUXT01009987.1 2418 VRGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFISSGTKQNGRLNATTVATERRSSLHVSSAQITDSATYFCAVEHSAP
Sus scrofa V38 trbv LUXT01015997.1 81220 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVSWYLQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V39 trbv LUXT01015997.1 76236 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQGPQFLLQYYNMEEREKGNISDRFSGQQFRDNDSELKLLSLELKDSALYLCASSE
Sus scrofa V41 trbv LUXT01015997.1 68984 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAKRPEGSVSHLTILRVEPQDSAVYLCASSL
Sus scrofa V42 trbv LUXT01015997.1 59896 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVSWYLQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V43 trbv LUXT01015997.1 53673 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHSGLYWYRQTLGQGLEFLTYFQRNEEQDKLELRNGRFSAERPEGSVSHLKILRVEPQDSAVYLCASSL
Sus scrofa V44 trbv LUXT01015997.1 43398 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V45 trbv LUXT01015997.1 18560 DPSAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFLVSFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V46 trbv LUXT01015997.1 16594 PMGAMVTQNPRYQLTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V48 trbv LUXT01017231.1 21007 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V54 trgv LUXT01028515.1 4532 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V56 trav LUXT01032822.1 444 VRGVDVEQSPPAQSLQEGASSTLWCNFSTTLVSNVQWYRQKSGGRLDHLFFIPSGTKQNGRLNATTVVKERRISLYISSAQITDSATYLCAG
Sus scrofa V57 igkv LUXT01034829.1 29358 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGYGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V58 igkv LUXT01034829.1 4000 ARSATQLTQSPASLAASLGDTVSITCRASQSVSSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSGTDYTLTISGLQAEDVATYYCMQHNSA
Sus scrofa V59 trav LUXT01035706.1 650 SIKAQNVTQDQPEMSVLEKEAVTLDCAYESSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V60 trav LUXT01037193.1 181531 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V61 trav LUXT01037193.1 126040 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYSFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V62 trav LUXT01037193.1 109054 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIIPADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V63 trav LUXT01037193.1 95220 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V64 trav LUXT01037193.1 91942 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V65 trav LUXT01037193.1 81258 DARAQSVTQPDKHVTVSEEGLLELKCNYSYSGAPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V66 trav LUXT01037193.1 72601 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V67 trav LUXT01037193.1 64911 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V68 trav LUXT01037193.1 59958 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V69 trav LUXT01037193.1 52029 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V70 trav LUXT01037193.1 44905 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V71 trdv LUXT01037193.1 41435 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V73 trav LUXT01037193.1 11758 SRREWSRVLHLRLFQREPNASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V74 trav LUXT01037193.1 3613 GVGAQSVTQADGHTDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFPLRKTSAHLSDSAKYFCAVS
Sus scrofa V75 trav LUXT01037193.1 1222 TKSQQKGVEQSPASPPIPEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKEDGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V76 igkv LUXT01037882.1 16490 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V77 igkv LUXT01037882.1 7649 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V78 trav LUXT01038432.1 787 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V79 trgv LUXT01044992.1 1125671 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRMNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V80 trgv LUXT01044992.1 1123837 GLGMLRLEQPEISVTAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V81 trgv LUXT01044992.1 1120056 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V82 trgv LUXT01044992.1 1094384 QEIRLVQLPVIVSRVGNSVTMPCRINTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V83 trav LUXT01048723.1 338441 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V84 trav LUXT01048723.1 332080 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V85 trav LUXT01048723.1 325316 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V86 trdv LUXT01048723.1 310742 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFFIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V87 trav LUXT01048723.1 303716 IVGDAKTTQPVSVESTEEDAVHLLCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V88 trav LUXT01048723.1 285656 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V89 trav LUXT01048723.1 281384 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V90 trav LUXT01048723.1 258163 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V91 trav LUXT01048723.1 254156 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V93 trdv LUXT01048723.1 175279 PSKTESVDISTDVVYEEEGQSVTLECKFTVSFAYYMMYWYRRSSSREMTGIIDIFSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V94 trdv LUXT01048723.1 127691 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V95 trdv LUXT01048723.1 103923 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFTYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERNEGSYYCAT
Sus scrofa V97 trdv LUXT01053480.1 520 SGVAQKVTQDQSVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSDSSNARDGRYSVNFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V98 iglv LUXT01055857.1 7501 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V99 iglv LUXT01055857.1 1367 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V102 trbv LUXT01077307.1 14973 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V103 trbv LUXT01077307.1 3307 SVDTGVTQTPRYLVLGTRDNRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNNNNPTGNESVPTRFRPDCPERSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V104 igkv LUXT01081261.1 6953 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V105 igkv LUXT01081261.1 852 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V106 trbv LUXT01090214.1 1313 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V1 trdv LUXU01019128.1 966 SSMAQKVTQDQPTVSSQVGEEVTLNCRYEAPWNTNYLFWYKQPPSGEMTFLIHQDTSKTNAKDGRYSVNSRRGEKSLSLTISALQLKDSATYFCALRD
Sus scrofa V2 trgv LUXU01022512.1 1487033 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRMNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V3 trgv LUXU01022512.1 1488867 GLGMLRLEQPEISVTAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V4 trgv LUXU01022512.1 1492651 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V5 trgv LUXU01022512.1 1518566 QEIRLVQLPVIVSRVGNSVTMPCRINTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V9 trbv LUXU01037238.1 2380499 TLDTAVFQTPKYLIIHTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V10 trbv LUXU01037238.1 2391662 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHDYMYWYKQSPQNPIELMFTCNNKEPTRNESVPSRFRLDCPESSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V11 trbv LUXU01037238.1 2407723 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V12 trbv LUXU01037238.1 2412728 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQDPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V13 trbv LUXU01037238.1 2419904 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHSGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V14 trbv LUXU01037238.1 2429195 PLAAGVTQTPRHAIKSTGQTVTLRCSPVSGHLSVSWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPNNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V15 trbv LUXU01037238.1 2435402 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQNEEPDKSKLSNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V16 trbv LUXU01037238.1 2446014 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V17 trbv LUXU01037238.1 2466255 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNGSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V18 trbv LUXU01037238.1 2471058 DLSAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFLVSFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V19 trbv LUXU01037238.1 2472999 PMGAMVTQNPRYQLTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V20 trbv LUXU01037238.1 2487222 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSQVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V21 trbv LUXU01037238.1 2492801 GYGFGALVSQHPSRAICKSGASVTIQCRTVDLQATTMFWYHQFPEQGPLLIATSNMGSNATYEKGFNSAKFLISHPDQTFSSLVVRSVHPADSSLYFCGAS
Sus scrofa V25 ighv LUXU01045763.1 112 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDLSDYAFSWVCQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNPAYLQMNSLRTEDTARYYCAT
Sus scrofa V26 trdv LUXU01047037.1 5016 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V27 trdv LUXU01047547.1 14567 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V28 trav LUXU01047547.1 21581 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V29 igkv LUXU01047635.1 1139 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V30 iglv LUXU01048865.1 1718287 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAGDEADYYCQVYDGGYH
Sus scrofa V31 trav LUXU01050196.1 37 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V32 trav LUXU01058603.1 4870 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V33 trav LUXU01058603.1 13248 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V34 trav LUXU01058603.1 19608 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V35 trav LUXU01058603.1 26396 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V36 trdv LUXU01058603.1 40784 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V37 trav LUXU01058603.1 47808 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V38 trav LUXU01058603.1 65568 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V39 trav LUXU01058603.1 69843 RVKADWIRPQETRVSGMEGKTVSLLCNYYTSSTGYIDLFWYRQYSNQAPEYILYRGWGYSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V40 trav LUXU01058603.1 93206 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V41 trav LUXU01058603.1 97213 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V43 trdv LUXU01058603.1 176247 PSKTESVDISTDVVYEEEGQSVTLECKFTVSFAYYMMYWYRRSSSREMTGIIDIFSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V44 trdv LUXU01058603.1 224285 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V45 trdv LUXU01058603.1 247087 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V47 iglv LUXU01062288.1 410 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V48 iglv LUXU01062288.1 6157 SVFSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V50 ighv LUXU01065538.1 8882 VQGEVKLVECGGGLVQPGGSLRLSCVGSGYTFSSYGMSWVRQAPGKGLEWLAGIDSGSYSGSSYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAG
Sus scrofa V53 trbv LUXU01067610.1 2938882 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V54 trav LUXU01072486.1 1116 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V55 trav LUXU01078908.1 2001 GTNGDSVNQTEVPVVLPEEAPMTLSCAYETLDSAPYLFWYVQYLNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V56 trav LUXU01078908.1 8998 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSGLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V57 trav LUXU01078908.1 15792 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSDYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V58 trav LUXU01082224.1 57 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAIYYCALS
Sus scrofa V60 trdv LUXU01087306.1 780 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V63 trav LUXU01021824.1 169861 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V64 trav LUXU01021824.1 114449 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V65 trav LUXU01021824.1 97518 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIIPADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V66 trav LUXU01021824.1 83693 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V67 trav LUXU01021824.1 80417 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V68 trav LUXU01021824.1 70087 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V69 trav LUXU01021824.1 61685 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V70 trav LUXU01021824.1 53969 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V71 trav LUXU01021824.1 48992 VSLGEKVEQSPTLSVQEGNSSVITCTYMDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V72 trav LUXU01021824.1 34021 VSLGEKVEQSPTLSVQEGNSSVITCTYMDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V73 trdv LUXU01021824.1 30550 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V75 trav LUXU01021824.1 1235 TKSQQKGVEQSPASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFAMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V77 igkv LUXU01023615.1 7231 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLFIYKASSLQSGVPSRFKGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V78 igkv LUXU01023615.1 975 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V81 igkv LUXU01048262.1 3960 ARCAIQVTQSPASLAASLGDTVSITCRASQSVSSNLDWYQQQPGKAPKLLIYKASSLQSGVPSRFKGSGSCTDFTLTISGLQHEDAAKYYCVQGMVFL
Sus scrofa V82 trav LUXU01049540.1 1915 GTNGDSVNQTEVPVVLPEEAPMTLNCAYETLDSDPYLFWYVQYPNRAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V83 trav LUXU01050592.1 433 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V84 igkv LUXU01052056.1 21851 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V85 igkv LUXU01052056.1 13074 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V86 iglv LUXU01054005.1 13242 SWPQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKAPRSVFTYANLMAIAAPDQISGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V87 iglv LUXU01054005.1 4295 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWFQQTPGQPPRTVIYRTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSGAT
Sus scrofa V88 trdv LUXU01058603.1 345668 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V89 trdv LUXU01061165.1 43439 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQSAYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V90 trav LUXU01061165.1 29895 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V91 trdv LUXU01061165.1 23799 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V93 trdv LUXU01061165.1 1033 SSMAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKEEKSLSLTISALQLQDSATYFCALRE
Sus scrofa V96 igkv LUXU01063750.1 9172 MIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSF
Sus scrofa V97 iglv LUXU01065634.1 20123 SWPQAVLTQPPSESGSLGQRVTLSCTGSSSNIGSGNTVNWSQQLPGKAPRTIIDGNSNRPSGVPDQFSGSKSGSSGTLTITGLQAEDDAEYYCVAWEDSLDG
Sus scrofa V99 trbv LUXU01067610.1 3035869 SLDAAVTQIPRNKITNTGKITVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V100 trbv LUXU01067610.1 3031073 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSE
Sus scrofa V101 trbv LUXU01067610.1 3014978 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V103 trbv LUXU01067610.1 2999729 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V105 trgv LUXU01071000.1 7583 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V106 igkv LUXU01077525.1 5545 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V107 iglv LUXU01080080.1 604 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V109 ighv LUXU01083158.1 3422 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFNFSSYGVGWVRQAPGKGLESLASIGSGSYIGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V0 igkv LUXV01002673.1 1683 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHSS
Sus scrofa V1 trav LUXV01014489.1 3221 GTIGDSVNQTEASVVLQEEAPLTLSCTYQTISSDPYLFWYVKYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V2 trav LUXV01014489.1 9950 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V3 trav LUXV01014489.1 16276 GTNGDSVNQTEGLVILPEEAPMTLNCTYQTTYSDYFFWYVQYLNKAPQLLLKGSSANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V4 trav LUXV01014489.1 19683 ETSGDSVNQTEVPVILSEEVTMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSTANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCALR
Sus scrofa V5 igkv LUXV01017105.1 2066 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V8 trav LUXV01051302.1 1122 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V9 trbv LUXV01055569.1 21739 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLELASPNHSALYFCASSY
Sus scrofa V10 trbv LUXV01055569.1 26588 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSE
Sus scrofa V11 trbv LUXV01055569.1 42769 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V12 trbv LUXV01055569.1 53052 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V13 trbv LUXV01055569.1 57646 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVDRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V14 trgv LUXV01059582.1 179545 GLSLSRVEQSQVSVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLVYVTSITVPAQNQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDAGIYYCAGWN
Sus scrofa V15 trgv LUXV01059582.1 181381 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V16 trgv LUXV01059582.1 185162 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V17 trgv LUXV01059582.1 210695 HQEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V18 trav LUXV01064461.1 12508 VRGVDVEQSPPALGLQEEASSTLWCNFSLSTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVTTERRSSLYISSAQITDSATYFCTVEHSAPQ
Sus scrofa V19 trdv LUXV01064461.1 31407 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSDDWNAKEDRYSVNFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V20 trav LUXV01064461.1 38462 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V21 trav LUXV01064461.1 43275 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V22 trav LUXV01064461.1 65203 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V23 trdv LUXV01064461.1 71298 SGVAQKVIQDQPVASGQVGEEGTLNCRYETSQRYYYLFWYKQPPSGEMTFLIRQESNGLNTKDGRYSTNFQKAQNFISLTISALQPEDSAKYFCALRE
Sus scrofa V25 trav LUXV01064461.1 84354 VRGVDVGQRPPVLSLTEGISDTIWCNSSASVLNVLWYRQNPGGRLIELFYIPTGTKQNGRLNATTVTTERRSSLYISSAQITDSATYFCAVQHSAP
Sus scrofa V26 trdv LUXV01064461.1 93251 SGVAQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V27 trav LUXV01064461.1 101413 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCME
Sus scrofa V28 trav LUXV01064461.1 109698 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V29 trav LUXV01064461.1 116058 ESTQQLEQHPPFLSIQEGEKSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V30 trav LUXV01064461.1 122834 LRVQMKVEQSPGILMLQEGKNSTLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V31 trdv LUXV01064461.1 137351 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V32 trav LUXV01064461.1 144387 IVGDAKTTQPVSVESTEEDAVHLLCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEMDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V33 trav LUXV01064461.1 161933 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V34 trav LUXV01064461.1 166202 RVKADWIRPQETRVSGMEGKTVSLLCNYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGIGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V35 trav LUXV01064461.1 193274 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAAVYFCAYSA
Sus scrofa V36 trav LUXV01064461.1 235135 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V37 trdv LUXV01064461.1 272757 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRQNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCA
Sus scrofa V38 trdv LUXV01064461.1 320331 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V39 trdv LUXV01064461.1 343236 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFTYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V41 iglv LUXV01073638.1 5408 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYHCAVADGKGS
Sus scrofa V42 trbv LUXV01091175.1 3994 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHDYMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFSPKCPKNSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V43 trbv LUXV01091175.1 20592 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V44 trbv LUXV01091175.1 24875 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V45 trbv LUXV01091175.1 31996 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQNEEPDKSKLSNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V46 trbv LUXV01091175.1 41729 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYNQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V47 trbv LUXV01091175.1 47915 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQNEEPDKSKLSNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V48 trbv LUXV01091175.1 58511 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V49 trbv LUXV01091175.1 78545 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNRSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V50 trbv LUXV01091175.1 83380 DLSAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFLVSFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V51 trbv LUXV01091175.1 85352 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDTMYWYQQKPSQAPKLLFYYYDDGLNSEKDTSDNFKGSRPNTSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V52 trbv LUXV01091175.1 99609 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V56 igkv LUXV01124655.1 976329 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSF
Sus scrofa V57 iglv LUXV01126813.1 11503 SWAQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKVPRSVFTYANLMAIAAPDQISGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V58 trav LUXV01013331.1 491 DARAQSVTQPDKHVTVSEEGLLELKCNYSYSGAPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V59 igkv LUXV01015108.1 18434 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V60 trav LUXV01021526.1 363 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V62 trav LUXV01029982.1 73871 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V63 trav LUXV01029982.1 71333 GTGAQSVTQSDSLITVPEGDPLELRCNYSSSFSTYLFWYVQYPNQGLQLLLKYVSGNSLVKGTKGFEAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V64 trav LUXV01029982.1 67482 VRGVDVMQSPPALSVQEGASPTLWCNFSMNVNSVHWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSAAYFCAGEHSA
Sus scrofa V65 trdv LUXV01029982.1 51890 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQNTYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTISVLQLEDSAMYFCVLRD
Sus scrofa V66 trav LUXV01029982.1 38083 SMIDAQTTQPYSTDCAEGEDVKLPCNHSTISGNDYIHWYRQNPNQSPQYIIHGLQSTVNNSMASLTIATDRRSSTLILPRVTLRDTAVYYCILRK
Sus scrofa V67 trav LUXV01029982.1 30411 VRGVDVEQSPPAQSLQEGASSTLWCNFSTTLVSNVQWYRQKSGGRLDHLFFIPSGTKQNGRLNATTVVKERRISLYISSAQITDSATYLCAG
Sus scrofa V68 trdv LUXV01029982.1 24469 SSMAQKVTQDQPTVSSQVGEEVTLNCRYEAPWNTNYLFWYKQPPSGEMTFLIRQDTSKTNAKDDRYSVNSRRGEKSLSLTISALQLEDSATYFCALRD
Sus scrofa V69 trav LUXV01029982.1 15883 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V70 trav LUXV01029982.1 8854 VRGVDVEQSPPALSLQEGDSSTLWCSFSTTVNNVQWYRQYRNGSLVHLFFIPSGTKQNGRLNATTVTTERRSSLHISSAQITDSATYLCAVEHSAPQ
Sus scrofa V71 trdv LUXV01029982.1 1540 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIRQYSDSSNARDGRYSVNFQKAQKSISLTISALQLKDSATYFCALRD
Sus scrofa V72 ighv LUXV01046863.1 6512 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V73 trbv LUXV01050970.1 4187 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V74 iglv LUXV01056771.1 8107 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V75 iglv LUXV01056771.1 1979 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V76 trdv LUXV01064461.1 442673 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSNPDLYWYRIRPDRTFQLVLYRDNTRSYDAYFARGRFSVQHSLAHKTFHLVISSVTTEDTATYYCALD
Sus scrofa V77 trbv LUXV01089459.1 19261 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V79 iglv LUXV01093660.1 101888 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRLLIYSTNSRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V80 iglv LUXV01093660.1 88957 VDSQTVIQEPVMSVSLGGTVTLTCAFSSGSVTTSNYPSWYQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V81 iglv LUXV01093660.1 362 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAGDEADYYCQVYDGGYH
Sus scrofa V82 trbv LUXV01101178.1 1291 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V84 igkv LUXV01110316.1 19235 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V87 trav LUXV01120850.1 191461 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSQSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V88 trav LUXV01120850.1 136114 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V89 trav LUXV01120850.1 119477 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V90 trav LUXV01120850.1 105658 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V91 trav LUXV01120850.1 102380 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V92 trav LUXV01120850.1 75868 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V93 trav LUXV01120850.1 70971 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V94 trav LUXV01120850.1 63022 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V95 trav LUXV01120850.1 55976 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTVKHFSLHIAVTQPEDAAVYFCAAS
Sus scrofa V96 trav LUXV01120850.1 51195 FSMAQSVIQDKPTREVPEKEAVTLDCTYDTSYPNYGLFWYKHPSSGGMTFLIHQDSYGQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V98 trav LUXV01120850.1 38215 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSSYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V99 trdv LUXV01120850.1 34742 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V101 trav LUXV01120850.1 5434 TKSQQKGVEQSPASPPIPEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V102 igkv LUXV01126881.1 6520 ASCAIRVTQSPASLGASLGDTVSITCRASQSVSSELAWYQQQPGKAPKLLIDAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V103 igkv LUXV01126881.1 413 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGTSLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V104 iglv LUXV01126930.1 46165 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V105 iglv LUXV01126930.1 31704 SWAQAVLTQPPSESGSLGQRVTLSCTGSSSNIGSGNTVNWSQQLPGKAPRTIIDGNSNRPSGVPDQFSGSKSGSSGTLTITGLQAEDDAEYYCVAWEDSLDG
Sus scrofa V106 iglv LUXV01126930.1 20835 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRLLIYYTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V107 iglv LUXV01126930.1 3151 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V108 igkv LUXV01128660.1 15743 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V109 igkv LUXV01128660.1 6739 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V110 trgv LUXV01129152.1 3883 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V0 igkv LUXW01007912.1 1844 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLVDSDGDSLLHWYLQKPGQSPRLLFYFATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQNKESP
Sus scrofa V1 trav LUXW01022703.1 1114 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V2 iglv LUXW01025516.1 1712846 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYQTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSSAN
Sus scrofa V3 iglv LUXW01025516.1 1736898 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V4 iglv LUXW01025516.1 1753657 VDSQTVIQEPAMSVSLGGTVTLTCAYSSGSVTSSNYPGWFQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSSAN
Sus scrofa V5 iglv LUXW01025516.1 1766635 VDSQTVIQEPAMSVSLGGTVTLTCAYSSGSVTSSNYPGWFQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V7 iglv LUXW01025516.1 1782176 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSSAN
Sus scrofa V9 iglv LUXW01025516.1 1882903 AGYVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V10 igkv LUXW01034532.1 17157 ASCAIQVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQAEDVRTYYCQQ
Sus scrofa V11 igkv LUXW01034532.1 23252 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V12 trgv LUXW01040912.1 269568 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRMNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V13 trgv LUXW01040912.1 271402 GLGMLRLEQPEISVTAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V14 trgv LUXW01040912.1 275182 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V15 trgv LUXW01040912.1 300746 HQEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V16 trav LUXW01045418.1 13110 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V17 trav LUXW01045418.1 19470 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V18 trav LUXW01045418.1 26257 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V19 trdv LUXW01045418.1 40632 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V20 trav LUXW01045418.1 47658 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V21 trav LUXW01045418.1 65588 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V22 trav LUXW01045418.1 69860 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V23 trav LUXW01045418.1 96743 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V24 trav LUXW01045418.1 100745 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V25 trav LUXW01045418.1 142410 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREVLQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V26 trdv LUXW01045418.1 181603 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRRNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V27 trdv LUXW01045418.1 229652 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V28 trdv LUXW01045418.1 252490 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V31 igkv LUXW01051785.1 972182 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V32 trav LUXW01054397.1 5839 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSGLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V33 igkv LUXW01056493.1 2984 ARCAIQVTQSLASLAASLGDTVSITCWASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V34 igkv LUXW01056493.1 21959 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V35 trbv LUXW01063201.1 15878 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVSWYLQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V36 trbv LUXW01063201.1 20871 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQGPQFLLQYYNMEEREKGNISDRFSGQQFRDNDSELKLLSLELKDSALYLCASSE
Sus scrofa V37 trbv LUXW01063201.1 37945 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVSWYLQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V38 trbv LUXW01063201.1 44772 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNEEQDKLELRNGRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V39 trbv LUXW01063201.1 55092 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V40 trbv LUXW01063201.1 76223 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHESLYWYRQTPGQGLEFLIYFNNGSPVDKSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V41 trbv LUXW01063201.1 81060 DPSAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V42 trbv LUXW01063201.1 83026 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEGLNSEKDTSDNFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V43 trbv LUXW01063201.1 97361 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V44 trdv LUXW01066131.1 5091 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V46 iglv LUXW01066136.1 5405 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V48 trbv LUXW01075304.1 1722278 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V51 trav LUXW01082632.1 37 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V52 ighv LUXW01086186.1 6331 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V53 ighv LUXW01086186.1 15983 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDFSDYAFSWVLQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V60 trdv LUXW01001573.1 48976 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQSAYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V61 trav LUXW01001573.1 35186 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V62 trdv LUXW01001573.1 29096 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V64 trdv LUXW01001573.1 5623 SSMAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V65 trav LUXW01001993.1 1782 GTNGDSVNQTEASVVLQEEAPLTLSCTYQTISSDPYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V66 trav LUXW01009705.1 918 VRGVDVEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGHLDHLFSIPSGTKRNGRLNATTVAKDRCSSLYISSAQITDSATYFCAVEHSA
Sus scrofa V67 trav LUXW01014646.1 10531 VRGVDVMQSPSALSVQEGASPTLWCNFSKNVNSVQWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSLLYISSAQITDSATYFCAGEHSAPQ
Sus scrofa V68 trdv LUXW01038601.1 2701 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V69 igkv LUXW01039267.1 22116 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V70 igkv LUXW01039267.1 13000 AMCAIQVTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V71 trdv LUXW01045418.1 351072 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V72 trbv LUXW01048619.1 6393 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQNPIELMFTCNNKEPTRNESVPSRFRLDCPESSSLYLHVDALKPEDSAVYLCASSR
Sus scrofa V75 trbv LUXW01063953.1 70078 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSRKEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V76 trbv LUXW01063953.1 65301 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V77 trbv LUXW01063953.1 49127 PVEANVTQSPSHRIAETKKTLTMTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSI
Sus scrofa V78 trbv LUXW01063953.1 38698 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V79 trbv LUXW01063953.1 34098 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V80 trav LUXW01070703.1 824 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V81 trav LUXW01072828.1 155519 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V82 trav LUXW01072828.1 100452 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V83 trav LUXW01072828.1 83494 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIIPADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V84 trav LUXW01072828.1 69668 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V85 trav LUXW01072828.1 66392 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V86 trav LUXW01072828.1 56052 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V87 trav LUXW01072828.1 47641 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V88 trav LUXW01072828.1 39938 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V89 trav LUXW01072828.1 34959 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSDYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V90 trdv LUXW01072828.1 31488 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V92 trav LUXW01072828.1 2192 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFAMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V95 trbv LUXW01077740.1 19061 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V98 trav LUXW01082742.1 1939 GTNGDSVNQTEAPVVLPEEAPMTLSCAYETLDSAPYLFWYVQYLNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V99 trbv LUXW01087825.1 1314 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHNAMYWYRQDPGQGLRLIYFSQVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V0 igkv LUXX01006658.1 6328 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V1 igkv LUXX01006658.1 10330 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V2 iglv LUXX01011540.1 16244 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSGAT
Sus scrofa V3 trav LUXX01017698.1 57 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V4 trav LUXX01019935.1 1183 GTNGDSVNQTEASVVLPEEAPLTLSCTYQTTYSDPYLFWYVHYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V7 iglv LUXX01043482.1 5134 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V9 trbv LUXX01051209.1 2290037 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V10 trbv LUXX01051209.1 2307666 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFLCNLKDITENETIPSRFSPKCPESSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V11 trbv LUXX01051209.1 2323781 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V12 trbv LUXX01051209.1 2328766 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGQGPQFLLQYYNMEEREKGNISDRFSGQQFRDNDSELKLLSLELKDSALYLCASSE
Sus scrofa V13 trbv LUXX01051209.1 2335924 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAKRPEGSVSHLTILRVEPQDSAVYLCASSL
Sus scrofa V14 trbv LUXX01051209.1 2345173 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V15 trbv LUXX01051209.1 2361693 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMEDFSLILESVVPSRTSVYLCASSN
Sus scrofa V16 trbv LUXX01051209.1 2381840 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHESLYWYRQTPGQGLEFLIYFNNGSPVDKSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V17 trbv LUXX01051209.1 2386659 DLPAGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V18 trbv LUXX01051209.1 2388606 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V19 trbv LUXX01051209.1 2402889 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V23 igkv LUXX01056691.1 5936 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHNS
Sus scrofa V24 iglv LUXX01060838.1 5261 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V25 igkv LUXX01061321.1 2221 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLEKYGSNVLRWYQQKPGQSPQLLIYEATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQFKEFP
Sus scrofa V28 trav LUXX01071215.1 376 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V29 trdv LUXX01080342.1 6230 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V30 iglv LUXX01093074.1 14761 VDSQTVIQEPAMSVSLGGTVTLTCAYSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALGKSGGT
Sus scrofa V31 iglv LUXX01093074.1 28471 VDSQTVIQEPAMSVSLGGTVTRSCAFSSGSVTSSNYPNWHQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V32 iglv LUXX01093074.1 34691 SWPQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKAPRSVFTYANLMAIAAPDQISGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V33 iglv LUXX01093074.1 44078 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSGAT
Sus scrofa V34 trav LUXX01093852.1 10590 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V35 trav LUXX01093852.1 16948 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V36 trav LUXX01093852.1 23724 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V37 trdv LUXX01093852.1 38111 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V38 trav LUXX01093852.1 45076 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V39 trav LUXX01093852.1 62656 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V40 trav LUXX01093852.1 66934 RVKADWIRPQETRVSGMEGKTVSLLCKYYTSSTGYIDLFWYRQYPNQALEYILYRGWRHSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V41 trav LUXX01093852.1 93838 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V42 trav LUXX01093852.1 97850 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V43 trav LUXX01093852.1 139618 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREVLQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V44 trdv LUXX01093852.1 180025 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRRNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V45 trdv LUXX01093852.1 228161 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V46 trdv LUXX01093852.1 250976 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V48 iglv LUXX01094440.1 96941 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V49 igkv LUXX01101817.1 1354 ARCAIQVTQSLASLAASLGDTVSITCWASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V50 trgv LUXX01101931.1 3163120 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRMNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V51 trgv LUXX01101931.1 3164954 GLGMLRLEQPEISVTAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V52 trgv LUXX01101931.1 3168736 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V53 trgv LUXX01101931.1 3194277 QEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V54 trav LUXX01102171.1 79 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCTE
Sus scrofa V55 trbv LUXX01002789.1 884 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V56 igkv LUXX01006570.1 17573 ARSATQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V57 trav LUXX01017207.1 709 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V58 igkv LUXX01018570.1 6957 ASCAIQVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V59 igkv LUXX01018570.1 853 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V60 trbv LUXX01020392.1 69991 SLDAAVTQIPRNKITNTGKITVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V61 trbv LUXX01020392.1 65375 CLFLTGFMDAGVHQTPRHCVIGTGKNITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V62 trbv LUXX01020392.1 49438 PVEANVTQSPSHHIAETKKTLTMTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSI
Sus scrofa V63 trbv LUXX01020392.1 38796 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V64 trbv LUXX01020392.1 34397 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V65 trav LUXX01029054.1 5638 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V66 igkv LUXX01031419.1 8991 MIVSSGEIVLTQSAAPKAVSQEESVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V67 trav LUXX01036634.1 5066 VRGVDVEQSPPALSLQEEASSTLWCNFSISTQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVTTERRSSLHISSAQITDSATYFCAVEHSA
Sus scrofa V69 igkv LUXX01040909.1 17024 SSGAIVLTQTPLSLSVSPGDPTSVSCRSSQSLLHSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V70 igkv LUXX01040909.1 7414 AMCAIQVTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V71 trbv LUXX01043869.1 19321 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFHSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V73 trdv LUXX01057515.1 12079 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V74 trav LUXX01057515.1 5067 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V78 trav LUXX01080082.1 178078 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V79 trav LUXX01080082.1 122957 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V80 trav LUXX01080082.1 105427 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V81 trav LUXX01080082.1 91563 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V82 trav LUXX01080082.1 88287 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V83 trav LUXX01080082.1 77937 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V84 trav LUXX01080082.1 69555 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V85 trav LUXX01080082.1 62058 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V86 trav LUXX01080082.1 57072 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKKEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V87 trav LUXX01080082.1 49144 SSTAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V88 trav LUXX01080082.1 42101 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKKEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V89 trdv LUXX01080082.1 38631 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V91 trav LUXX01080082.1 9278 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKEDGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V92 trdv LUXX01092661.1 308 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V93 trdv LUXX01093852.1 349524 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V0 igkv LUXY01010710.1 1138 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V1 igkv LUXY01010710.1 5267 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCQQSIQY
Sus scrofa V2 trav LUXY01016410.1 2497 VDGQQINQIPKFSLLQEGENFTTYCNSSRTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKLNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V3 trav LUXY01016410.1 10647 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V4 trav LUXY01016410.1 17007 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V5 trav LUXY01016410.1 23781 LRVQMKVEQSPGILMLQEGKNSTLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V6 trdv LUXY01016410.1 38057 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V7 trav LUXY01016410.1 45384 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V8 trav LUXY01016410.1 62841 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V9 trav LUXY01016410.1 67110 RVKADWIRPQETRVSGMEGKTVSLLCNYYTSSTGYIDLFWYRQYPNQAPEYILYRGWGYSGKGFASFATEKFYSENTANTTILYIRKVVPADAALYHCALR
Sus scrofa V10 trav LUXY01016410.1 93125 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V11 trav LUXY01016410.1 97137 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V12 trav LUXY01016410.1 138586 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREELQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V13 trdv LUXY01016410.1 176578 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRRNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V14 trdv LUXY01016410.1 224228 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V15 trdv LUXY01016410.1 247048 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V16 trav LUXY01023830.1 79 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYRFQWYKQMSGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V19 trbv LUXY01030824.1 1313491 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDCMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V20 iglv LUXY01030893.1 4200 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V23 igkv LUXY01035112.1 972088 MIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWYQLKTGAPPRLLIYSTSSLAFWVPTRFSGSGSGTSYSRTISSVAAQDAADYYCQQSSSF
Sus scrofa V26 igkv LUXY01045406.1 1125 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V28 trav LUXY01054125.1 413 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V30 trgv LUXY01079246.1 1722422 GLSLSRVEQSQVSVSAEVKKSVDINCKIESTNFPTEAVHWYRQRTNQALEHLVYVTSITVPAQNQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDAGIYYCAGWN
Sus scrofa V31 trgv LUXY01079246.1 1724266 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDTYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V32 trgv LUXY01079246.1 1728036 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V33 trgv LUXY01079246.1 1753901 HQEIRLVQLPVIVSRVGNSVTMPCRITTSVSYIHWYRQLEGQAPERLLYLATSQRDVQWDSVLQGNKVTAKKGNDDKSCTLSLMKLEKGDEGLYYCAAWD
Sus scrofa V36 trav LUXY01097111.1 116 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVTTERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V37 trav LUXY01102374.1 3495 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYRFQWYKQMSGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V38 trdv LUXY01102374.1 12047 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V39 trav LUXY01102374.1 25699 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVTTERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V40 trdv LUXY01102374.1 31792 SGVAQKVIQDQPVASGQVGEEGTLNCRYETSQRYYYLFWYKQPPSGEMTFLIRQESNGLNTKDGRYSTNFQKAQNFISLTISALQPEDSAKYFCALRE
Sus scrofa V42 trbv LUXY01113854.1 226 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYRQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V43 iglv LUXY01001079.1 8760 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V44 iglv LUXY01001079.1 2633 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTDTLTISGAQAGDEANYYCQSYDDSYT
Sus scrofa V45 trbv LUXY01005823.1 19145 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFYSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V48 trdv LUXY01016410.1 345676 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V49 trbv LUXY01016548.1 60904 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLQSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V50 trbv LUXY01016548.1 56364 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSK
Sus scrofa V51 trbv LUXY01016548.1 40174 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V52 trbv LUXY01016548.1 25174 SGFGVLLSQKPSRDICQRGTSVTIQCQVDSEFTYMYWYRQLLGQSLTLMAAVDRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V53 trgv LUXY01024250.1 5933 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFQEGTAPQRLLYYDVSSSKVMLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V54 trav LUXY01025856.1 621 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V55 trbv LUXY01030505.1 83219 RADSGVTQTPRHLIKARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V56 trbv LUXY01030505.1 78236 LVDSGVIQTPKYLIKSRKQQMTLRCSPVSGHLSVFWYQQALGKGPQFLLQYYNMEEREKGNISDRFSGQQFRDNHSELKLLSLELKDSALYLCASSE
Sus scrofa V57 trbv LUXY01030505.1 71053 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHSGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V58 trbv LUXY01030505.1 61765 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V59 trbv LUXY01030505.1 55561 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNGEQDKLELRNGRFSAKRPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V60 trbv LUXY01030505.1 45272 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMKDFSLILESVVPSRTSVYLCASSN
Sus scrofa V61 trbv LUXY01030505.1 25082 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHQSLYWYRQTPGQGPEFLIYFNNRSPVDDSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V62 trbv LUXY01030505.1 20248 DLSAGVTQFPSHRVIKKEKAVSMRCDPMSGHEYLFWYQRAVGNEMKFLVSFLESSVQDESGMPRERFSAERTEGTSSVLQVHSVKLEDSGDYFCASAQ
Sus scrofa V63 trbv LUXY01030505.1 18287 PMGAMVTQNPRYQLTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V64 trbv LUXY01030505.1 4004 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V66 igkv LUXY01032556.1 877 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLVDSDGDSLLHWYLQKPGQSPRLLFYFATNRASWVPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQYKEFP
Sus scrofa V67 trdv LUXY01039763.1 28097 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSINFQKAQKSISLTISALQLDDSATYFCALRD
Sus scrofa V68 trav LUXY01039763.1 20467 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAMYYCILRD
Sus scrofa V69 trav LUXY01039763.1 10898 VRGVDVEQSPPALSLQEGASSTLSCNFSISIQNVYWYRQKNGGRLDHLFSIPSGTKRNGRLNATTVSKDRRSSLYISSAQITDSATYFCAVEH
Sus scrofa V70 iglv LUXY01041307.1 118508 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTTSNYPGWYQQTPGQPPRTVIYNTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V71 iglv LUXY01041307.1 112407 SWAQAVLTQPPSESGSLGQRVTLSCTGSSTNIGGGNSVNWSQPLPGKAPRSVFTYANLMAIAAPDQISGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V72 iglv LUXY01041307.1 102996 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V73 iglv LUXY01041307.1 89571 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V74 iglv LUXY01041307.1 353 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYKQKPGQSPMLVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAGDEADYYCQVYDGGYH
Sus scrofa V75 trdv LUXY01049139.1 336 SGVAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V76 igkv LUXY01049725.1 3960 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQREDAAKYYCVQGMVFL
Sus scrofa V77 trav LUXY01056855.1 15136 GTGAQSVTQSDSLITVPEGDPLELRCNYSSSFSTYHFWYVQYPNQGLQLLLKYVSGNSLVKGTKGFEAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V78 trav LUXY01056855.1 11285 VRGVDVMQSPPALSVQEGASPTLWCNFSMNVNSVHWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSSLYISSAQITDSAAYFCAGEHSA
Sus scrofa V79 trav LUXY01068458.1 20221 GTNGDSVNQTEVPVVLPEEAPLTLSCTYQTTYPDPYLFWYVHYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V80 trav LUXY01068458.1 15089 GTIGDSVNQTEASVVLQEEAPLTLSCTYQTISSDPYLFWYVKYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V81 trav LUXY01068458.1 8361 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSYFFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V82 trav LUXY01068458.1 1241 GTNGDSVNQTEGLVILPEEAPMTLNCTYQTTYSDYFFWYVQYLNKAPQLLLKGSSANPRPKEQGFQATLDTTDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V83 trav LUXY01073893.1 177269 TVGGGIEQPSELTAMEGASVQVNCTYQTFGFNGQYWYQHHDGGIPLFLIYNVLDGWERRGHFSSYLSHSVAYSYLLVKELHMKDSALYLCAVR
Sus scrofa V84 trav LUXY01073893.1 121937 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYSFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V85 trav LUXY01073893.1 105098 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIISADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V86 trav LUXY01073893.1 91279 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V87 trav LUXY01073893.1 88001 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLVFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V88 trav LUXY01073893.1 77647 DARAQSVTQPDKQVTISEEGLLELKCNYSYSGTPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V89 trav LUXY01073893.1 69271 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V90 trav LUXY01073893.1 61742 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V91 trav LUXY01073893.1 48843 SSTAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V92 trdv LUXY01073893.1 38330 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V94 trav LUXY01073893.1 9016 TKSQQKGVEQSPASPPISEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKASKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V95 trav LUXY01073893.1 3154 TKSQQKGVEQSLASLPISEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V96 ighv LUXY01081432.1 12897 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V97 ighv LUXY01081432.1 3206 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDLSDYAFSWVCQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNPAYLQMNSLRTEDTARYYCAT
Sus scrofa V101 igkv LUXY01097723.1 7056 ASCAIRVTQSPASLGASLGDTVSITCRASQSVSSELAWYQQQPGTAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V102 igkv LUXY01097723.1 975 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V103 iglv LUXY01107932.1 19988 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V104 iglv LUXY01107932.1 3138 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALGKSGGT
Sus scrofa V105 igkv LUXY01109445.1 15561 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLHSNGYSYLNWYQQKPGQSLKLLIYYATSRATAVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V106 igkv LUXY01109445.1 6257 AMCAIQLTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V107 igkv LUXY01110465.1 5859 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHNS
Sus scrofa V727 trav AEMK02000057.1 501855 TLSLAKTIQPIFVDSYEGQEVNISCSHTNITTNEYIFWYRQFPNQGPQFVIQGYKTNVANEVASLIIPADRKSSTLILPWATLKDTAVYYCILG
Sus scrofa V728 trav AEMK02000057.1 488033 MRGENVEQHPSFLRTWEGDTWVINCTYTDSASTDFYWYKQEPGKGLQLLIHSFSSEAKKQEQRLTVLLDKKEKHLFLNITAAQPGDSATYFCATG
Sus scrofa V729 trav AEMK02000057.1 484759 VSSQKMEQNPPSLSIQEGGKAMLICNYTNYSPAFIQWYRQDPGRGLLFLLLIRENEHEKQTGRLSTTFDTRVKQTAFHIAASQPADSATYFCAA
Sus scrofa V772 trav AEMK02000057.1 113053 TRSQQKGVEQSPASLPIPEGANASLNCTYSDSASRYFTWYRHYPGKGPELLLYMASYEPKEDGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V84 igkv AEMK02000020.1 13491131 SSGAIVLTQTPLSLSVSPGDPASVSCRSSQSLLLSNGYNYLNWYQQKPGQSLKLLICYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSIQTR
Sus scrofa V85 igkv AEMK02000020.1 13500156 AMCAIQVTQSPASLAASLGDTVSITCQASQSISRELSWYQQQPGKAHKLLIYSASTFQTGVPSQFKGSGSGTDFTLTISSLQAENFATYYCQHDYG
Sus scrofa V86 igkv AEMK02000020.1 13573591 SCGAIVLTQTPLSLSVSPGEPASISCRSSQSLEEYGKNWLSWYQQKPGQSPRLLIYQATNRASWVPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQYKEFP
Sus scrofa V87 igkv AEMK02000020.1 13581031 ARSAIQLTQSPASLAASLGDTVSITCRAHQTISSYLAWYQQQPGKPPKLLLCDACTLQSGVPCGFKGSGSGTHFTLTISGLQAEDVATYYCQQLNN
Sus scrofa V88 igkv AEMK02000020.1 13587066 SSGAIVLTQSPLSLSVSPGAPASISCRSSQSLESYSYNFLSWYQQKPGQSPRLLIYFATNKASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQNKESL
Sus scrofa V89 igkv AEMK02000020.1 13592931 SSGAIVLTQTPLSLSVSPGEPASISCRSTQSLRGSYGKNYLNWYQQKPGQSPKLLIYWATNRASGVPDRFSGSRSGTDFTLKIIRLEAEDAGVYYCLQDIQSP
Sus scrofa V90 igkv AEMK02000020.1 13601371 ASCAIQLTQSPASLAASLGDTVSITCRASQSINKWLVWYQQQPGKAPKLLIYSASTLQSGVPCGFKGSGSGTDFTLTISGLQAEDVATYYCQQHHS
Sus scrofa V91 igkv AEMK02000020.1 13607511 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQLLIYYATNRDTGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCFQALQSP
Sus scrofa V92 igkv AEMK02000020.1 13620254 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLVDSDGDSLLHWYLQKPGQSPRLLFYFATNRASWVPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQYKEFP
Sus scrofa V93 igkv AEMK02000020.1 13629077 ARSAIQLTQSPASLAASLGDTVSITCRARQSISSYLAWYQQQPGKPPKLLLCDACTLQSGVPCGFKGSGSGTHFTVTISGLQAEDVATYYCQQLNN
Sus scrofa V193 trdv AEMK02000056.1 29379734 KGVLCNKVTQTSLEEVVVSGSKVTLPCTFETSHSDPDLYWYRIRPDRTFQLVLYRDNTRSYDADFARGRFSVQHSLAHKTFHLVISSVTTKDTATYYCALD
Sus scrofa V337 iglv AEMK02000096.1 42769181 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPGWYQQTPGQPPRQLIYQTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALEKSSAN
Sus scrofa V338 iglv AEMK02000096.1 42809527 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPGWFQQTPGQPPRTVIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKSCTN
Sus scrofa V339 iglv AEMK02000096.1 42822514 VDSQTVIQEPAMSVSLGGTVTLTCAFSSGSVTSSNYPSWYQQTPGQPPRQLIYSTNSRPTGVPSRFSGAISGNKATLTITGAQAEDEADYFCALYKGSGT
Sus scrofa V340 iglv AEMK02000096.1 42828618 SWAQAVLTQPPSESGSLGQRVTLSCTGSSSNIGGGNSVNWSQPLPGKVPRSVFTYANLMAIAAPDQFSGFKSGSSGTLTITGLQAEDDAEYYCTAGGDSLDG
Sus scrofa V341 iglv AEMK02000096.1 42838030 VDSQTVIQEPAMSVSPGGTVTLTCAFSSGSVTTSNYPSWFQQTPGQPPRQLIYSTNNRPTGVPSRFSGAISGNKAALTITGAQAEDEADYFCALYKSSAN
Sus scrofa V344 iglv AEMK02000096.1 42939198 YVASSQLTQPPGVSVSLGGTASITCQGANFGSYYAHWYQQKPGQSPELVIYEYPEIFLGFLERFSVSRTGDTATLTISGAQAEDEADYYCQVYDGGYH
Sus scrofa V345 iglv AEMK02000096.1 42947167 YVASSKLTQPPGVSVSLGGTASIACQGDNFGSYYAHWYQQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V346 iglv AEMK02000096.1 42952632 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTQWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSIDN
Sus scrofa V347 iglv AEMK02000096.1 42958733 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V348 iglv AEMK02000096.1 42966725 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V349 iglv AEMK02000096.1 42972186 SVASYELTQPSSESVALGNTAKITCSGDLLDEKYTRWYQQKPGQAPLLLIYKDSERPSGIPERFSGSSSGKTATLTITGAQAEDEADYYCQSADSSDN
Sus scrofa V350 iglv AEMK02000096.1 42978316 SVASYEVTQPPSVSVNPGQRASITCEGNNIGRKDIQWYQQKPGQAPVLFIYEDTNRPSGIPERFSASKSGNTATLTISGAQAEDEADYYCQSYDDSYT
Sus scrofa V351 iglv AEMK02000096.1 42986297 YVASSQLTQPPGVSVSLGGTASITCQGGNFGSYYAHWYKQKPGQSPMLVIYEYNKRASGIPDRFSGSKSGNTATLTISGAQAEDEADYYCQSSDDSYT
Sus scrofa V352 iglv AEMK02000096.1 42991764 YVASSQLTQVPGVSVSLGGTASIACLGDNFVYAANWYQQKPGQAPILVIYGGSLRPLGIPERFSGSSSGNSATLTISGAQAEDEADYYCQSADSSDN
Sus scrofa V353 iglv AEMK02000096.1 42997194 SVVSCELTQPPSLSVSLGQMARITCGGNNIGYKHTFWYQQKVGQAPVLVMYSDSHQLSGIPELFSGSTLTISRARAEDEEDYYCAVADGKGS
Sus scrofa V446 trbv AEMK02000111.1 7398179 VIAQTIHQWPATRVQLVGSALSLECTVKGVSSPSLYWYRQATGGGDLQLLFYSIGVDQKDPEKLQNFNASRPQDGLFILSSTKLLLSNSGFYLCAWS
Sus scrofa V476 igkv AEMK02000207.1 10075 ARSAIQLTQSPASLAASLGDTVSITCRAHQTISSYLAWYQQQPGKPPKLLLCDACTLQSGVPCGFKGSGSGTHFTLTISGLQAEDVATYYCQQLNN
Sus scrofa V477 igkv AEMK02000207.1 16113 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLESYSYNFLSWYQQKPGQSPRLLIYFATNKASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQFKESP
Sus scrofa V478 igkv AEMK02000207.1 31036 ARCAIQLTQSPASLAASLGDTVSITCRASQSINKWLAWYQQQPGKAPKLLIYSASTLQSGVPCGFKGSGSGTDFTLTISGLQAEDVATYYCQQHHS
Sus scrofa V479 igkv AEMK02000207.1 37212 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQRLIYQATNRDTGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQFKESN
Sus scrofa V480 igkv AEMK02000207.1 48064 ASCAIQLTQSPASLAASLGDTVSITCRASQSISNNLAWYQQQAGKAPKLLIYWASVLQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLNS
Sus scrofa V481 igkv AEMK02000207.1 60090 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQRLIYYATNRDTGVPDRFTGSGSGTDFTVKISRVEAEDVGVYYCLQALQSP
Sus scrofa V490 igkv AEMK02000525.1 263921 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLAWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQNNN
Sus scrofa V491 igkv AEMK02000525.1 269871 SSGAIVLTQTPLSLSVSTGEPTSISCRSSLSLNSYEYTFLCWYLKKPGQSPQLLIYLASNWTSGVPDKFTSNGSETDVFLKISREDAGVYYCHQSIQYP
Sus scrofa V492 igkv AEMK02000525.1 298791 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V493 igkv AEMK02000528.1 13466 ASCAIQMAQSPASLAASLGDTVSITCRASQSVSNNLAWYQQQAGKAPKLLIYWASALQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLNSAP
Sus scrofa V494 igkv AEMK02000528.1 25482 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLVDSDGDSLLHWYLQKPGQSPQLLIYFATNRATGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQALQSP
Sus scrofa V495 igkv AEMK02000528.1 29038 ASCAIQMTQSPASLAASLGDTVSITCRASQSVSNNLAWYQQQAGKAPKLLIYWASALQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLNSAP
Sus scrofa V496 igkv AEMK02000528.1 38184 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLESYTYYNVLRWYQQKPGQSPQLLIYEATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQLKESP
Sus scrofa V497 igkv AEMK02000528.1 45631 ARSAIQLTQSPASLAASLGDTVSITCRARQSISSYLAWYQQQPGKPPKLLLCDACTLQSGVPCGFKGSGSGTHFTVTISGLQAEDVATYYCQQLNN
Sus scrofa V498 igkv AEMK02000528.1 51652 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLEEYGSNLLSWYQQKPGQSPQLLIYEATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQFKEFP
Sus scrofa V499 igkv AEMK02000528.1 64734 SSGAIVLTQTPLSLSVSPGEPASISCRSTQSLRGSYGKNYLNWYLQKPGQSPKLLIYWATNRASGVPGRFSGSRSGTDFTLKIIRLEAEDAGVYYCLQDIQSP
Sus scrofa V500 igkv AEMK02000528.1 73121 ARSAIQLTQSPASLAASLGDTVSITCRARQSINKWLAWYQQQPGKAPKLLIYSASTLQSGVPCGFKGSGSGTDFTLTISGLQAEDVATYYCQQHHS
Sus scrofa V501 igkv AEMK02000528.1 79291 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQLLIYYATNRDTGVPDRFSGSGSGTDFTLKISRVEAEDAVVYYCLQFKESP
Sus scrofa V502 igkv AEMK02000528.1 90118 ASCAIQLTQSPASLAASLGDTVSITCQASQSISNNLAWYQQQAGKSPKLLIYWASALQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYYCQQLKS
Sus scrofa V503 igkv AEMK02000528.1 96121 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLEEYGKNLLSWYQQKPGQSPRLLIYQATTRASGVPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQYKEFP
Sus scrofa V504 igkv AEMK02000546.1 11778 SSGAIVLTQTPLSLSVSPGEPTSISCRSSQSHEKYGKNLLSWYQQKPGQSPQLLIYQATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQHKESL
Sus scrofa V505 igkv AEMK02000551.1 9527 ARSATQLTQSPASLAASLGDTVSITCRASQSVSSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSGTDYTLTISCLQAEDVATYYCMQHNSA
Sus scrofa V506 trav AEMK02000555.1 15453 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSSANLRGEHQGFQATVVKSDRTFHLQKLSVQTSDSAVYYCALR
Sus scrofa V507 trav AEMK02000555.1 34867 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V508 trav AEMK02000555.1 37403 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVAPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V593 igkv AEMK02000020.1 13550747 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V594 igkv AEMK02000020.1 13544640 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V595 igkv AEMK02000020.1 13516316 ARSATQLTQSPASLAASLGDTVSITCRASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V695 trav AEMK02000056.1 29781934 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V696 trdv AEMK02000056.1 29773393 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQSAYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSAMYFCALWE
Sus scrofa V697 trav AEMK02000056.1 29759090 VRGMDVEQRPPVLSLQEGASSTLWCNFSKATQYVHWYQQSRGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V698 trdv AEMK02000056.1 29752998 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V700 trdv AEMK02000056.1 29730071 SGVAQKVTQDQPVVSRQVGEEGTLNCRYETSWNEYTIFWYKQPPSGEMIFLIYQYSASRNAKDGRYFINFQKEEKSLSLTISALQLQDSATYFCALRE
Sus scrofa V701 trav AEMK02000056.1 29721558 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKLNRLTAWFGDTKKDSSLHITAAQSADAGTYFCME
Sus scrofa V702 trav AEMK02000056.1 29713388 IVVDAKTTQLSSMDCAEGEDVKLSCNHSTVSGSDYILWYRQNPNQSPQYIIHGLQNTVTNSMGSLTIASDRKSSTLVLPKLTLRDTAVYYCALR
Sus scrofa V703 trav AEMK02000056.1 29707028 ESTQQLEQHPPFLSIQEGENSTMYCNSSSIFTNFQWYRQKPGEGPVFLMMLTKAGDRKEQERLKGQFGEERKDSFLLITAAQPGDAGTYLCAG
Sus scrofa V704 trav AEMK02000056.1 29700241 LRVQMKVEQSPGILMLQEGKNSSLTCNFSVSMTSVQWFQQNPGGHITSLLYIASGIQQKGRLKSTVSTRERYSHLYIRDAQPGDSATYFCAVE
Sus scrofa V705 trdv AEMK02000056.1 29685862 PNMAAEVTQAQTTITAQEGKAVTMDCTYETSSTAYTLYWFKQPPSGGITFLIYQDDNEPNAREDRFSVNFQKEKKSISFTISSLQLADSARYFCAFWD
Sus scrofa V706 trav AEMK02000056.1 29678847 IVGDAKTTQPVSVESTEEDAVHLRCNHSTISGSEFIYWYRQLPHQGPEYMIHGLKGNVNNKMASLNIEIDRKSSTLVLPHVMLRDTAVYYCILRD
Sus scrofa V707 trav AEMK02000056.1 29661068 VSSDDEVIQSLASLVVHEGTNATFNCTYKVTNFQSLHWYKQEEKALTFLFLLIATGTEKKSGRHRGTLDGKELSIFHITATETGDSATYLCAVE
Sus scrofa V708 trav AEMK02000056.1 29633573 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V709 trav AEMK02000056.1 29629566 SSLAQTVTQPQWEVPGQEAETVTLDCTYTTSESDYYLFWYKQLPNGEMIFIIRQEAYKQQNATNNRYSVNFQKAAKSFGLRISASQLEDAGVYFCAYSA
Sus scrofa V710 trav AEMK02000056.1 29588138 VTGKNGAEQSRQYLSAQEGDFVTINCSYSERMTTLQWLQQKPEGGIVSLFILSLNMKKKGRLSATVNREVLQSSLHITAAQPRDSAVYLCAVE
Sus scrofa V711 trdv AEMK02000056.1 29549209 PSKIESVDISTDVVYEEEGQSVTLECKFTVSFAYYIMYWYRQSSSREMTRIIDIYSQNRRNSEGRYSVEFYKESQTLKLTISSLTLSDSDVYFCAVRE
Sus scrofa V712 trdv AEMK02000056.1 29501165 VSLDVILEPETKTLTVLLGEPVTFRCNVTGGDLKNYQGSWYKKNEDHSLTLVYRLNSSNENVRSHFKGKIDTLKSQYILDIEKATTKDAGTYHCAS
Sus scrofa V713 trdv AEMK02000056.1 29478344 VMSAVMLVPQDQKVNAFMGESVTFRCSMKGGSFRNYYNFWYRKTLGSTLTFVYREGGMYGPGFWDNFQGETDYSNNQAVLKILKASERDEGSYYCAT
Sus scrofa V726 trav AEMK02000057.1 520535 GLRAQSVTQPEDRVPVTEGDPVTVKCTYSVSGTPYLFWYVQHPNQGLQFLLKYIGGDNLVKGSYGFEAEFNKSQTSFHLKKPAVLGSDSAVYFCAVR
Sus scrofa V730 trav AEMK02000057.1 474206 DARAQSVTQPDKHVTVSEEGLLELKCNYSYSGAPYLFWYVQYPSQGLQLLLKYLSGPPLVEGIKGFKAEFKKDETSFYLRKTSALWSDSAKYFCVLG
Sus scrofa V731 trav AEMK02000057.1 465557 GSNGDSVTQIEGQMTLIEGDSLTVNCSYETTQYPALFWYVQYPEEGPQLLLRASKVNDKRSNKGFEATYNQENTSFHLKKALVQDSDSALYYCALE
Sus scrofa V732 trav AEMK02000057.1 457858 DARAQTVTQPDDHVLVSEGKSLELRCNYSYGATPYLFWYVQYPSQGLQLLLKYFSGDTFVRGIKGFQAEFKKSESSFNLKKPSAHWSDSAGYFCAVS
Sus scrofa V733 trav AEMK02000057.1 452884 VSLGEKVEQSPTLSVQEGNSSVITCTYTDSTSDYFPWYKQEPGKGLRLLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V734 trav AEMK02000057.1 444951 SSIAQKVTQAQPPKFTQEKETVNLDCTYDTSDPTYSLFWYKQPSSGVMILLIRQDTYSQENATEGRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V735 trav AEMK02000057.1 437897 VSLGEKVEQSPTLSVQEGNSSVITCSYTDSTSDYFPWYKQEPGKGLQFLTYIRANGVKQEEERLTVSLNKTAKHFSLHIAVTQPEDSAVYFCAAS
Sus scrofa V736 trdv AEMK02000057.1 434427 FSMAQSVTQDQLPVKMPEKDTVTLNCTYETSSFSYSLFWYKQPSSGAVILLIHQDSYSQENATEDRYSLNFQKANKSIQLVISDAQVEDSAVYFCALSE
Sus scrofa V738 trav AEMK02000057.1 405102 TKSQQKGVEQSPASPPISEGANASLNCNYSDSASNYFLWYRQYPGKGPELLLYTASNEPKADGRFAMQVNKTSKHVSLLIRDSQPSDSATYLCAVR
Sus scrofa V739 trav AEMK02000057.1 397326 GVGAQSVTQADGHTDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFPLRKTSAHLSDSAKYFCALS
Sus scrofa V740 trav AEMK02000057.1 394919 TKSQQKGVEQSLASLPIPEGANASLNCNYSDSASRYFTWYRQYPGKGPELLLYMASYEPKEDGRFTMQVNKTSKHVSLLIRDSQPSDSATYLCAV
Sus scrofa V741 trav AEMK02000057.1 385367 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAVYYCALS
Sus scrofa V742 trav AEMK02000057.1 370384 GTNGDSVNQTEASVVLPEEAPLTLSCTYQTTYPDPYLFWYVHYPNRAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V743 trav AEMK02000057.1 358312 GTNGDSVNQTEVPVVLPEEAPLTLRCTYQTTYLDSYLFWYVHYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAMS
Sus scrofa V744 trav AEMK02000057.1 351989 GTNGDSVNQTENLVILPEEAPMTLNCTYQTTYSDYFFWYVQYLNKAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAMS
Sus scrofa V745 trav AEMK02000057.1 348633 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSSANLRGEHQGFQATVVKSDRTFHLQKLSVQTSDSAVYYCALR
Sus scrofa V746 trav AEMK02000057.1 346817 SIKAQNVTQDQPEMSVLEKEAVTLDCAYESSSYSYYLFWYKPPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V747 trav AEMK02000057.1 328854 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V748 trav AEMK02000057.1 326310 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVAPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V749 trav AEMK02000057.1 322121 VRGVDVMQSPSALSVQEGASPTLWCNFSKNVNSVQWYLQYRGGSLVHLFFIPSGTKRNGRLNATTVAKERRSLLYISSAQITDSATYFCAGEHSAPQ
Sus scrofa V750 trav AEMK02000057.1 305425 GTNGDSVNQTEVPVVLPEEAPMTLGCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCTLS
Sus scrofa V751 trdv AEMK02000057.1 301613 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V752 trav AEMK02000057.1 287759 SMIDAQTTQPYSTDCAEGEDVKLPCNHSTISGTDYIHWYRQNPNQSPQYIIHGLQSTVNNSMASLTIATDRRSSTLILPRVTMRDTAVYYCILRK
Sus scrofa V753 trav AEMK02000057.1 280103 VRGVDVEQSPPALSLQEGASSTFWCNFPTTLVSNVQWYRQKSGGHLDHLFFIPSGTKQNGRLNATTVAKERRSSLYISFAQITDSATYLCAG
Sus scrofa V754 trdv AEMK02000057.1 273650 SSMAQKVTQDQPTVSSQVGEEVTLNCRYEAPWNTNYLFWYKQPPSGEMTFLIHQDTSKTNAKDGRYSVNSRRGEKSLSLTISALQLKDSATYFCALRD
Sus scrofa V755 trav AEMK02000057.1 265829 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V756 trav AEMK02000057.1 258368 VKGVDVEQSPPALSLQEGDSSTLWCSFSTTVNNVQWYRQYRNGSLVHLFFISSGTKQNGRLNATTVTTERRSSLHISSAQITDSATYLCAVEHSAPQ
Sus scrofa V757 trdv AEMK02000057.1 250975 SGVTQEVTQDQPAVFSQVGEAVTLNCRYEIGWTWIYYNLFWYKQPPSGEMTFLIHQYSDSSNARDGRYSVNFQKAQNFISLTISALQLDDSATYFCALRD
Sus scrofa V758 trav AEMK02000057.1 243055 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWYRQNPNQSPQHIIHGLQSNVTNSMASLTIASDRKSSTLILPRVTLRDTAVYYCILRD
Sus scrofa V759 trav AEMK02000057.1 235588 VKGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFISSGTKQNGRLNATTVTTERRSSLHISSAQITDSATYLCAGEHSAPQ
Sus scrofa V760 trdv AEMK02000057.1 228094 SSVAQEVTQDQPDVFSQVGEAVTLNCRYEIGWNWIYYNLLWYKQPPSGEMTFLIRQYSDSSNARDGRYSVNFQKAQKSISLTISALQLKDSATYFCALRD
Sus scrofa V761 trav AEMK02000057.1 220173 TMIDAQTTQPNSKDCAEGEDVKLPCNHSTISGADYIHWNRQNPNQSPQYIIHGLQSNVTNSMASLTIASDRKSSTLVLPRVTLRDTAVYYCILRD
Sus scrofa V762 trav AEMK02000057.1 210295 VRGVDVEQSPPALSLQEGASSTLWCNFSISTQSVYWYRQTNGGRLDHLFSIPSGTKRNGRLNATTVAKDRCSSLYISSAQITDSATYFCAVEHSA
Sus scrofa V763 trdv AEMK02000057.1 190787 SGVSQKVTQDQPVVSRQVGEEGTLNCRYETSQRDYYLLWYKQPPSGEMTFLIRQYSTGWNAKEDRYSINFQKAQKSISLTISALQMKDSATYFCALWE
Sus scrofa V764 trav AEMK02000057.1 183736 VRGMDVDQSPPALSLQEGVSSTLWCNFSSSTRSVQWYRLAPGGHLSHLFTIPAGTQKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V765 trav AEMK02000057.1 178630 VDGQQINQIPKFSLLQEGENFTTYCNSSSTLYSFQWYKQRPGGSPVFLMLLTKPGEVKKPNRLTARFGDTGKDSSLHITAAQSADAGTYFCAE
Sus scrofa V766 trdv AEMK02000057.1 170086 SSVTQKVIQDQPVVPSQVGESVTLNCQCETSQRDYYLFWYKQPPSGEMIYLNLWDSSRQNTKDGHYSINFQKAQKSSSLTISALQLNDSATYFCALWE
Sus scrofa V767 trav AEMK02000057.1 156370 VRGMDVEQRPPVLSLQEGASSTLWCNFSKGTQYVHWYQQSQGGRLVHLFSIPSGTKKNGRLNATTVATERRSSLYISSAQTTDSATYLCAGEHSAPQ
Sus scrofa V768 trdv AEMK02000057.1 150276 SGVTQKVTQDQPVVSRQVGEEVTLNCRYETSWNEYILFWYKQPPSGEMTFLIRQESKGLNTKDGRYSTNFQKAQNFISLTISALQLQDSAKYFCALRE
Sus scrofa V770 trdv AEMK02000057.1 127331 SSMAQKVTQDQPVVSRQVGEAVTLNCRYETSWNEYTIFWYKQPPSGEMTFLIYQYSASRNAKDGRYFINFQKAQKSLSLTISALQLQDSATYFCALW
Sus scrofa V771 trav AEMK02000057.1 117845 VDGQQISQIPKFSLLQEGENFTTYCNSSSTLNRFQWYKQRPGGSPVFLMLLTKPGEVKKLNRLTAWFGDTRKDSSLHITAAQSADAGTYFCTE
Sus scrofa V773 trav AEMK02000057.1 105267 GVGAQSVTQADGHMDTAVPEGDPVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFPLRKTSAHLSDSAKYFCALS
Sus scrofa V774 trav AEMK02000057.1 93391 GTRAQTVTQPEDHISVFERSPVQVKCNYSYSGSPVLFWYVQYPKQHLQLLLKHISRESIRGFTAHLDKKEASFHLKKPSAQEEDSAIYYCALS
Sus scrofa V775 trav AEMK02000057.1 81280 GTNGDSVNQTEVPVVLPEEAPMTLNCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V776 trav AEMK02000057.1 76251 GTNGDSVNQTEASVVLQEEAPLTLSCTYQTISSDPYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V777 trav AEMK02000057.1 69519 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSVSGLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCAVS
Sus scrofa V778 trav AEMK02000057.1 63168 GTNGDSVNQTEVPVVLPEEAPMTLNCTYQTTYSDYLFWYVQYLNKAPQLLLKGSTANPRPKEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V779 trav AEMK02000057.1 59792 ETSGDSVNQTEVPVILSEEATMILNCTYQTTYSDFYVFWYIQYLNQAPQFLLKGSTANLRGEHQGFQATVVKSDRTFHLQKRSVQTSDSAVYYCALR
Sus scrofa V780 trav AEMK02000057.1 57972 SIKAQDVTQDQPEMSVLEKEAVTLDCAYEGSSYSYYLFWYKQPPSGEMIFLLHQESYNELNKTEGRYFLNFRKKASSISLTITASQLEDSAVYFCALR
Sus scrofa V781 trav AEMK02000057.1 40134 VSSKQHVNQSHEALSVREGDGLVLNCSYTDSAIYFLQWFRQYPGKGLTSLLLIQANQGEQISGRIKASLDKSSRNSVFYIAASQPSDSATYFCAV
Sus scrofa V782 trav AEMK02000057.1 37593 GTGAQSVTQPDSLITVPEGDAVELRCKYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNSFVSGIRGFGAEFRKNETSFHLRKTSVHLSDSAKYFCALS
Sus scrofa V783 trav AEMK02000057.1 33711 VRGVDVKQSPPALSLQEGASSTLWCNFSTTVNNVQWYRQYRNGSLVHLFFISSGTKWNGRLNATTVTKERRSSLYISSAQITDSATYFCAGEHSAPQ
Sus scrofa V784 trav AEMK02000057.1 17035 GTNGDSVNQTEVPVVLPEEAPMTLNCAYETLDSAPYLFWYVQYPNRAPQLLLKGSTANPRAEEQGFQATLVKSDKTFHLQKRSVQTSDSAVYYCALS
Sus scrofa V785 trdv AEMK02000057.1 13222 SGMAQKVTQDQSAVSRRMGEAVTLNCWYETSQSAYYLFWYKQPPSGEMNFLIHQYSSKQNKRDGRYSVNFQKAQNFISLTVSVLQLEDSAMYFCALRD
Sus scrofa V808 trgv AEMK02000070.1 102899593 GLSLSRVEQSQISVSAEVKKSVDINCKIESTNFPTEAVHWYRQRMNQALEHLIFVSSVTVPAQSQIGGKSNKVVARKNSQTFTSTLTVNFIEKEDEGIYYCAGWN
Sus scrofa V809 trgv AEMK02000070.1 102897761 GLGMLRLEQPEISITAARQKSALIACKVSSENFNDAYIHWYRHKSDQGMEHLMYHVTVFTLSHLGEKKNKLEARKIASTSTATLKINFLEQEDEATYYCASWFY
Sus scrofa V810 trgv AEMK02000070.1 102893975 TSGDILTTHPVASITKKRGNTAFLECQIKTDTLKRNVYTHWYRQKPDQPLKRILYISSNENIVYEQGISEEKYEARKWLSNSLVNLRIHGVTEEDTGLYYCACWN
Sus scrofa V811 trgv AEMK02000070.1 102835331 TQVSSNVEGDKMSVTRATGSSLVITCDLTQNTNYIHWYRFREGTVPQRLLYYDVSSSKVTLESGISPGRYHAYQSAGKSYQFVISNLEESDSGTYYCAVWE
Sus scrofa V821 trav AEMK02000070.1 40955637 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Sus scrofa V981 trbv AEMK02000111.1 7669332 TLDTAVFQTPKYLIIQTRNKRSLKCEQKLSHDSMYWYKQGFKQLLEIMFIYNNKELILNETVPRRFLPESPDKAHLYLHIDSLEPGDSAVYFCASS
Sus scrofa V982 trbv AEMK02000111.1 7658555 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQNPIELMFTCNNKEPTRNESVPSRFRLDCPESSSLYLHVDALKPEDSAVYLCASSR
Sus scrofa V983 trbv AEMK02000111.1 7646079 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFSPKCPENSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V984 trbv AEMK02000111.1 7640150 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFTCNYEDRTGNESVPSRFSPKCPENSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V985 trbv AEMK02000111.1 7633264 SVDTGVTQTPRYLVLGTRDKRSLTCEQDLGHNAMYWYKQSAQKPPELMFLCNLKDITENETIPSRFSPKCPESSPLYLHVDALKPEDSAVYLCASSR
Sus scrofa V986 trbv AEMK02000111.1 7617434 RADSGVTQTPRHLIQARGQQVTLRCSPVSGHLSVYWYQQALNQGPQFLFEFYDQKQSAKGNFSDRFSAQHFSNSLNELTVKFLELRDSALYLCASSL
Sus scrofa V987 trbv AEMK02000111.1 7605283 FVSTGHAGAGVSQSPRHRVTGRNQSIALRCDPVSGHNGLYWYRQALGQGLEFLTYFQSKEEPDKLELRNDRFSAKRPEGSVSHLTILRVEPQDSAVYLCASSL
Sus scrofa V988 trbv AEMK02000111.1 7596048 PLAAGVTQTPRHVIKSTGQTVTLRCSPVSGHLSVSWYLQALNQGPQFLFEFYDQMPRAKGNVSDRFSVQQPSNSLSELTVKFSELTDSSLYLCASSL
Sus scrofa V989 trbv AEMK02000111.1 7590630 FVSTGHAGAGVSQSPRHRVTGRNQTIALRCDPVSGHVYLYWYRQTLGQGLEFLTYFQRNEEQDKLELRNGRFSVERPEGSVSHLKIQRVEPQDSAVYLCASSL
Sus scrofa V990 trbv AEMK02000111.1 7580360 HAEAWITQSPRYEITVTGETVALQCYQTYNHDCVYWYQQDQGHGLRLIFYTCDVGILNKEEVPNGYNVSRPSMEDFSLILESVVPSRTSVYLCASSN
Sus scrofa V991 trbv AEMK02000111.1 7560234 SADVGVTQTPRHEVTKVGQEVTLDCQPISGHESLYWYRQTPGQGLEFLIYFNNGSPVDKSGMPKGRFSADMPNASFSILKIQTTEPRDSATYLCASSI
Sus scrofa V992 trbv AEMK02000111.1 7555415 DLPVGVTQFPSHRVIKKEEAVSMRCDPMSGHEYLFWYQRAVGNEMKFFKYFLESSVQDESGMPRERFSAERTEGTSSVLQVHSAKLEDSGDYFCASAQ
Sus scrofa V993 trbv AEMK02000111.1 7553468 PMGAMVTQNPRYQVTRRGTPVNLSCFQNMNHDAMYWYQQKPSQAPKLLFYYYDEVLNSEKDTSENFKGSRPNPSFCSLGIRSPDLGDSAVYLCASSR
Sus scrofa V994 trbv AEMK02000111.1 7539187 TIDGGITQTPKYLFKEEGQEVTLECKQDFNHDAMYWYRQDPGQGLRLIYFSLVVPDVQKADIASGYNASREKKAFFPLTVTLTQKNQTSLYLCASSI
Sus scrofa V995 trbv AEMK02000111.1 7533610 GYGFGALVSQHPSRAICKSGASVTIQCRTVDFQTTTMFWYHQFPEQGPLLIATSNMGSNATYEKGFNSTKFLISHPDLTFSSLVVRRVHPADSSLYLCGAS
Sus scrofa V996 trbv AEMK02000111.1 7525333 GYGFGALVSQHPSRAICKSGASVTIQCRTVDLQAITMFWYHQFPEQGPLLIATSNMGSNATYEKGYNSAKFLISHPDQTFSSLVVRSVHPADSSLYLCAAS
Sus scrofa V997 trbv AEMK02000111.1 7516963 GYGFGALVSQHPGRAICKSGASVTIQCRTVDLQATTMFWYHQFPEQGPLLIATSNMGSNATYEKGYNSAKFLISHPNQRFSSLVVRSVHPADSSLYFCGAS
Sus scrofa V998 trbv AEMK02000111.1 7494945 SLDAAVTQIPRNKITNTGKRTVLECSQTNDHEYMYWYRQDPGEGLRSIYYSYDIKSFNQGEVASGYNVSREEKERFFLYLESASPNHSALYFCASSY
Sus scrofa V999 trbv AEMK02000111.1 7490168 CLFLTGFMDAGVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDLGMELQLIHYSYGVNSTEKGERPSESTVSRLRKDHFSLTLMATSPSQTSRYFCASSE
Sus scrofa V1000 trbv AEMK02000111.1 7473966 PVEANVTQSPSHRIAETKKTLTMTCSQNMDHDAMYWYRQDPGLGPKLIYFSRNVDLVEKGDIPDGYNVSRKEKPNFPLILESASANQTSLYLCASSV
Sus scrofa V1001 trbv AEMK02000111.1 7463313 LMDAKVTQTPGYLVKRMGEKVLIECVPDMNHERMFWYLQDPALGLQLLHLSYDANLVEKGDASYGYSVSRKKREGFLLTLESASTNQTSVYLCTSSESI
Sus scrofa V1002 trbv AEMK02000111.1 7458739 SGFGVLLSQKPSRDICQRGTSVMIQCQVDSEFTYMYWYRQLLGQSLTLMAAVGRDFEATYESGFTKEKFPISRPNLMFSILTVSNVSSEDSSSYFCSAG
Sus scrofa V1022 ighv AEMK02000151.1 15241 EAGGVWRRPGAAWGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1023 ighv AEMK02000151.1 5791 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDLSDYAFSWVCQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1024 igkv AEMK02000155.1 22610 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQLLIYYATNRDTGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCFQALQSP
Sus scrofa V1025 ighv AEMK02000188.1 64360 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYEISWVRQAPGKGLEWLAAIGCGSYSGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1026 ighv AEMK02000188.1 57971 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYPIGWVRQAPGKGLESLASIGSGSYSGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1027 ighv AEMK02000188.1 51596 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYAVSWVRQAPGKGLEWLAGIYSSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1028 ighv AEMK02000188.1 33806 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYPIGWVRQAPGKGLEWLADICSGGSTYYADSVKGRFTISKDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1029 ighv AEMK02000188.1 24587 VQGEEKLVESGGGLVQPGGSLRLSCVGSGITFSRYALSWVRQAPGKGLEWLAGIDSGSYTGSTYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAG
Sus scrofa V1030 ighv AEMK02000188.1 18176 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDFSDYAFSWVCQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1036 ighv AEMK02000452.1 3841155 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSTYINWVRQAPGKGLEWLAAISTSGGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1037 ighv AEMK02000452.1 3831940 VQGEVKLVECGGGLVQPGGSLRLSCVGSGYTFSSYGMSWVRQAPGKGLEWLAGIDSGSYSGSSYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1042 igkv AEMK02000525.1 235073 ARCAIQVTQSPASLAASLGDTVSITCRASQSISSNLDWYQQQPGKAPKLLIYKASTLQSGVPSRFKGSGSCTDFTLTISGLQPEDAAKYYCVQGMVFL
Sus scrofa V1043 igkv AEMK02000525.1 214889 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V1044 igkv AEMK02000525.1 188883 ARSATQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPRKAPKLLIYKASTLQSGVPSRFKGSGSGTDYTLTISGLQAEDVATYYCMQHNSA
Sus scrofa V1045 igkv AEMK02000525.1 174696 LATMLTQTPLSLSVSPGEPASISCRSTQSLQGSYGNKYLSWYQQKPRQSPQLLIFYASNKSSGVPDRYRGIGSGTDFPLKISRVEAKDAGVYYCQQHKESP
Sus scrofa V1046 igkv AEMK02000525.1 167686 ARCAIQLTQSPASLAASLGDTVSITCRASQSISSYLGWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHNS
Sus scrofa V1047 igkv AEMK02000525.1 142132 ASCAIRVTQSPASLGASLRDTVSITCRASQSVSSELAWYQQQPGKAPKLLIHAASTLQSGVPSQFRGSGSGTDFTLTISGLQTEDVRTYYCQQ
Sus scrofa V1048 igkv AEMK02000525.1 136018 SSGAIVLTQSPLSLSVSPGEPASISCRSSQSLLHSDGASLLYWYQQKPGQSPRLLIYYATNRATGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQI
Sus scrofa V1049 igkv AEMK02000525.1 107598 ARSAIQLTQSPASLAASLGDTVSITCQASQSVSSNLDWYQQQPGKAHKLLIYYAFTLYSGVPSQFKDSGSGTDFTLTISGLQAEDVGTYYCQQEYS
Sus scrofa V1050 igkv AEMK02000525.1 85084 ARSATQLTQSPASLAASLGDTVSITCRASQSVSSNLDWYQQQPGKAPKLLIYKASSLQSGVPSRFKGSGSGTDYTLTISGLQAEDVATYYCMQHNSA
Sus scrofa V1051 igkv AEMK02000525.1 73580 LATVLTQTPLSLSVSPGEPASISCRSTQSLQGSYGNKYLSWYQQKPRQSPQLLIFYASNKSSGVPDRYRGIGSGTDFPLKISRVEAKDAGVYYCQQHKESP
Sus scrofa V1052 igkv AEMK02000525.1 57370 ARSAIQLTQSPASLAASLGDTVSITCRASQSISSYLDWYQQQPGKAPKLLIYAASSLQSGVPSRFKGSGSGTDFTLTISGLQAEDVATYYCLQHSS
Sus scrofa V1053 igkv AEMK02000525.1 32888 ARSAIQLTQSPASLAASLGDTVSITCRASQSINKWLAWYQQQPGKAPKLLIYSASTLQSGVPCGFKGSGSGTDFTLTISGLQAEDVAAYYCLQHHS
Sus scrofa V1054 igkv AEMK02000525.1 26717 SDGAIVLTQTPLSLSVSPGEPASISCRSSQSLLHTDGKNYLNWYLQKPGQSPQLLIYYATNRASGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQFKESP
Sus scrofa V1055 igkv AEMK02000525.1 8846 SSGAIVLTQTPLSLSVSPGEPASISCRSSQSLEKYGSNLLSWYQQKPGQSPQLLIYEATNRASGVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCQQNKESP
Sus scrofa V1056 ighv AEMK02000566.1 173422 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1057 ighv AEMK02000566.1 162130 FQGEVKLVESGGGLVQPGGSLRLSCVGSGYTFSSYPIGWVRQAPGKGLEWLAAISTSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1058 ighv AEMK02000566.1 155453 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYPIGWVRQAPGKGLESLASIGSGSYSGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1059 ighv AEMK02000566.1 149069 EAGGVWRRPGAAWGSLRLSCVGSGFTFSSYSMSWVRQAPGKGLEWLAGIYSSGSSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1060 ighv AEMK02000566.1 143377 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYSMSWVRQAPGKGLEWLAGIYSSGSSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1061 ighv AEMK02000566.1 137792 VQGEEKLVESGGGLVQPGGSLRLSCVGSGYTFSSYGIGWVRQAPGKGLEWLAGIYSGGSTYYADSVKGRFTISKDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1062 ighv AEMK02000566.1 128817 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYSMSWVRQAPGKGLEWLAGIYSSGSSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1063 ighv AEMK02000566.1 122542 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYEISWVRQAPGKGLEWLAAISTSGGSTYYADSVKGRFTISKDDSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1064 ighv AEMK02000566.1 116170 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDFSDYAFSWVRQAPGKGLEWVAAIASSDYDGSTYYADSVKGRFTISSDDSQNMVYLQMNSLRTEDTARYYCAI
Sus scrofa V1065 ighv AEMK02000566.1 104218 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDFSSYGVGWVRQAPGKGLESLASIGSGSYIGSTYYADSVKGRFTISSDDSQNTVYLQMNSLRTEDTARYYCAR
Sus scrofa V1066 ighv AEMK02000566.1 97601 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSTYINWVRQAPGKGLEWLAAISTSGGSTYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1067 ighv AEMK02000566.1 89695 VQGEEKLVESGGGLVQPGGSLRLSCVGSGITFSSYAVSWVRQAPGKGLEWLAGIDSGSYSGSTYYADSVKGRFTISRDDSQNTAYLQMTSLRTEDTARYYCAG
Sus scrofa V1068 ighv AEMK02000566.1 81971 VQGEEKLVESGGGLVQPGGSLRLSCVGSGITFSSYAVSWVRQAPGKGLEWLAGIDSGSYSGSTYYADSVKGRFTISRDDSQNTAYLQMTSLRTEDTARYYCAG
Sus scrofa V1069 ighv AEMK02000566.1 75597 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFDFSDNAFSWVRQAPGKGLEWVAAIASSDYDGSTYYADSVKGRFTISSDDSQNTVYLQMNSLRTEDTARYYCAI
Sus scrofa V1070 ighv AEMK02000566.1 63927 VQGEEKLVESGRGLVQPGGSLRLSCVGSGFDFRSYGVGWVRQAPGKGLESLASIGSGSYIGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1071 ighv AEMK02000566.1 57315 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSTYINWVRQAPGKGLEWLAAISTSGGSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1072 ighv AEMK02000566.1 47774 VQGEVKLVESGGGLVQPGGSLKLSCVGSGYTFSSYGMSWVRQAPGKGLEWLACIYSSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLKTEDTARYYCAR
Sus scrofa V1073 ighv AEMK02000566.1 41412 VQGEEKLVESGGGLVQPGGSLRLSCVGSGFTFSSYSMSWVRQAPGKGLEWLACIYSSGSSTYYADSVKGRFTISRDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1074 ighv AEMK02000566.1 30123 VQGEEKLVESGGGLVQTGGSLRLSCVGSGFDFSSYGVGWVRQAPGKGLESLASIGSGSYIGSTYYADSVKGRFTISSDDSQNMVYLQMNSLRTEDTARYYCAR
Sus scrofa V1075 ighv AEMK02000566.1 23861 VQGEVKLVESGGGLVQPGGSLRLSCIGSVFDFSSYAVSWVRQAPGKGLEWLAAIYSGGSSYYADSVKGRFTISKDNSQNTAYLQMNSLRTEDTARYYCAT
Sus scrofa V1076 ighv AEMK02000566.1 15956 VQGEVKLVECGGGLVQPGGSLRLSCVGSGYTFSSYGMSWVRQAPGKGLEWLAGIDSGSYSGSSYYADSVKGRFTISRDDSQNTAYLQMNSLRTEDTARYYCAR
Sus scrofa V1081 ighv AEMK02000599.1 518 VQGEVKLVESGGGLVQPGGSLRLSCVGSGFTFSSYNMIWVRQAPGKGLEWLAYITSSGGSTYYADSVKGRFTISSDNSQNTAYLQMNSLRTEDTARYYCAR