WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Anguilla rostrata LTYT00000000.1 (LTYT01) 311 71 8 55 140 23 8 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Anguilla rostrata V13 trav LTYT01001671.1 37011 VSSEDVIVQLANPVHALEGSNITLSCSYTGSAYSLHWYLKHPLSKPEFLLLILASTMYVTKAAPPYPRLSTKLNKTTKQVDLEFSSAEVTDSALYYCALQ
Anguilla rostrata V12 trav LTYT01001671.1 35576 TVIQSTQDVIAIEGQSVTLGCTYSTIGTQIDLFWYIQYPNDFLKYMLRRDKFTAGETAPGFKRFDAHLNKTSSSVPLTIQKAQLSDSAVYYCALR
Anguilla rostrata V11 trav LTYT01001671.1 33511 VSSEDVIVQLANPVHALEGSNITLSCSYTGSAYSLHWYLKHPLSKPEFLLLILASTMYVTKAAPPYPRLSTKLNKTTKQVDLEFSSAEVTDSALYYCALQ
Anguilla rostrata V10 trav LTYT01001671.1 32076 TVIQSTQDVIAIEGQSVTLGCTYSTIGTQIDLFWYIQYPNDFLKYMLRRDKFTAGETAPGFKRFDAHLNKTSSSVPLTIQKAQLSDSAVYYCALR
Anguilla rostrata V9 ighv LTYT01001671.1 28720 EVTQEQPSVQKTEEEEVSLKCSFKSTSSNYFIFWYRQYPQSALQYILQRGSQGYSHTADFAKEKFESTVSSSEAFLTISKLTPEDTAVYYCALR
Anguilla rostrata V8 trav LTYT01001671.1 19356 YTFEEMITTATNAVHLMEGANATLSCNYTGSASNLQWYRQYPSSKPEFLILRYTSGKSTEGRFTMKLDENNKHVHLELPSAEVTDSALYYCALQ
Anguilla rostrata V7 trgv LTYT01001296.1 40703 ADAQRRLLQKTISVTATVGDTAVLTCEASGLNSGEYVHWYQKKDGEPFKRVLYINFGSHSKVLDPSHAQKDSFSTEKSNPPYDLRIDSVEMAHAATYYCACWD
Anguilla rostrata V6 trgv LTYT01001296.1 39471 CTLAQITHPKSWLMAKTTRSARIECVVGQNVKLTETHIHWYQHKGDAFQRVLYIAGLAVGKPDDGFQDKFIGALNSKDRKSTLTIRNVNTNDAASYYCAYYD
Anguilla rostrata V5 trgv LTYT01001296.1 31158 CTLAQITHPKSWLMAKKARSARIECVVDKNVNLATTPIHWYQHREGDAFRRVLYIPAGLANGKNDDGFPRFIGSLISKDRKSILTISNVNTNDAASYYCAYYD
Anguilla rostrata V4 trav LTYT01001173.1 40561 VLQQPESKSVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIIYTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSLSDAGTYYCAV
Anguilla rostrata V3 igkv LTYT01001173.1 12976 LQQPESESVQSGHSVTLQCTVHTETCAREHSVYWFRQGSGESPPGIISTHGNRSDECQRSSGEVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V2 igkv LTYT01000187.1 84277 SLGQITVTQTPAVKSALPGDRVTLSCKTSTSSGLDDALSWYQQKAGEAPKLLINYATNLESGISDRFSGSGSGTDFTLTISEVRPEDAGVYYCFAYYSAPD
Anguilla rostrata V1 igkv LTYT01000187.1 83455 SLGQITVTQTPAVKSALPGDRVTLSCKTSTSSGLDDALSWYQQKAGEAPKLLINYATNLESGISDRFSGSGSGTDFTLTISEVRPEDAGVYYCFAYYSAPD
Anguilla rostrata V0 igkv LTYT01000187.1 70849 SLGQITVTQTPAVKSAVPGARVTLSCKTSTSSNLGDDVYWYQQKAGEAPKLLVKKISSRESGISDRFSGSGSGTDFTLTISEARPEDAGVYYCFANFGGAN
Anguilla rostrata V51 ighv LTYT01006741.1 31360 VQGDIVLSQPGQEVKMPGESVKLTCTVSGFSLGGYWTAWLRQKAEKSPEWLGEINGDGGTINYLSSIRGRLTISKDNGKNTLHMELNSLSTEDTAVYYCAR
Anguilla rostrata V50 ighv LTYT01006741.1 22489 IVLSQPGQEVKRPGESVKLTCTVSGFSLGGYWTAWLRQKAEKSPEWLGEINGDGGTINYLSSIRGRLTISKDNGKNTLHMELKSLRTEDTAVYYCAR
Anguilla rostrata V49 ighv LTYT01006741.1 19518 GHCDELIQPGSMAVNPGQPLSVSCKVSYSLGSYATAWIRQPAGKALEWIGAIWTGGSTSYKDSLKSKFTISRDTSSSTVFLKGSSLQTGDTAVYYCAR
Anguilla rostrata V48 ighv LTYT01006741.1 17288 GHCVELTQPGSMAVKPGQPLSVSCKVSGYSLTDSSYATHWIRQPAGKALEWIGYIASGGSTGYKDSLKNKFTITRDTSSSTVTLEGSSLQIGDTAVYYCARR
Anguilla rostrata V47 ighv LTYT01006741.1 16032 GHCVELTQPGSMAVKPGQPLSVSCKVSGYSLTDSSYATHWIRQPAGKALEWIGYIASGGSTGYKDSLKNKFTITRDTSSSTVTLEGSSLQIGDTAVYYCARR
Anguilla rostrata V46 ighv LTYT01006741.1 14247 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSSYYMAWIRQAPGKGLEWLGYQYDSSSVYYAQSIQGRFTISRDNSKNQLYLQMNRLTTEDTAVYYCARD
Anguilla rostrata V45 ighv LTYT01006741.1 12131 SMVLTPGQSLTISCKVAGYSLTDSSYCTFWIRQPAGKALEWVGHICSSGGTAFKDSLKNKFTITRDTSSSTVTLQGSSLQTGDTAVYYCAR
Anguilla rostrata V44 ighv LTYT01006741.1 7688 SMAVKPGESLTISCKVSGYSLTDSSYCTNWIRQPAGKALEWVGYICSSGGTGYQDSLKSKFIITRDTSSSTVTLQGSSLQTGDTAVYYCAR
Anguilla rostrata V43 ighv LTYT01006741.1 5706 GHCVELTQPGSMTVKPGQPLPISCKVSGYSLTDDSYATHWIRQPALEWVAGIWSDGRTAYKDSLKNKFTITREPSSSTVTLKGSRLQTGDTAVYYCARE
Anguilla rostrata V42 ighv LTYT01006741.1 4243 VKSQTLTESEPAVKKPGESYTLTCTASGLTFSGYWMAWIRQAPGKGLEWLGYRYDSSSVYYAQSIQGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCAR
Anguilla rostrata V41 ighv LTYT01006741.1 1469 AHCDITLTESAPQMKKPGDSVRLSCKITGFSLSSYSVHWVRQAPNKGLQWVGYYRGSSDDRFNVTEDSSNSIAYLDITNLQSSDTAVYYCARE
Anguilla rostrata V40 trbv LTYT01005763.1 47528 GVEFEQYPSLIAKPGENREIKCSHSESNYHNMYWYRRALHDRVLVLVVFGHSREKPTYEAQFQTRFHLTREAVNRSSLHISSLTVEDTAVYFCAAS
Anguilla rostrata V39 igkv LTYT01005586.1 60913 SMADILLTQDPAARSVQQGDTVSISCTASQGVYYLNNNLLHWYLQKPGQAPKLLIYYSTSRQTGIPDRFSGSGSGTQFTLKITGVQTEDAGDYYCQQGYRP
Anguilla rostrata V38 igkv LTYT01005586.1 52175 SMADIILTQSPAARSVQPGDTVSISCTASESVRSWLHWYLQKPGQAPNLLIYKATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQGWDSP
Anguilla rostrata V37 igkv LTYT01005586.1 43407 KVLTQDPAARSVQLGETVSISCTASESVSTCLNWYLQKPGQAPKLLIYYATTRQTGTPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQGWDSP
Anguilla rostrata V36 igkv LTYT01005586.1 40726 SMADIVLTQSPAQTAELGDTVSISCTASEFLGISLHWYLQKPGQAPKLLIYHATIPVVGIPDRFRGSVNGTEHTLIITGVQAEDAGDYYCQTADTSDTLP
Anguilla rostrata V35 igkv LTYT01005409.1 63504 SMADIVLTQAPTARSVQLGDTVSISCTVSQSVHGGNNLYWYQQKPGQAPKLLIYAATTRQTGIPDRFSGSGSGTQFTLTITGVQAEDAGDYYCQS
Anguilla rostrata V34 trav LTYT01005228.1 1150 DSFQYGITSIANTVQALESSSVTLSCNYTGVNAGDRLQWYRQYPSSKPEFLILILRNKEREDNNGFTVKHENEKNLVHLEISSAEVTDSALYYCALQ
Anguilla rostrata V33 iglv LTYT01003869.1 4763 LEAVVTLTQEKSVAVSLGSSVKISCISSKSDWHMSWYQKKPGSSPRFLIFDSTRATGLESRFTYSKTDNIYLHIDKVTAEDEAVYYCACADCGA
Anguilla rostrata V32 trav LTYT01002651.1 138619 VSGQKVLTQKPSVLSVNKQQKATMDCNITRDEGNFVYWYKQVPGSAPQYVLYFYYSYSSPTYGAGFSSSRFNSTAQGKTDYQLIITNVEAGDSAVYYCCTR
Anguilla rostrata V31 trav LTYT01002651.1 134118 VNGVTVVTQKPPVLSVSNGDMATVDCNLGTVIGHAIWYKQVPGGVPQYVLRLFKGEHSPDSYGTGFSSSRFTSTRQSNTDSQFIIKNVEAGDSAVYYC
Anguilla rostrata V30 trav LTYT01002651.1 124932 VSGATVVTQKPPVLSVSKGGTATMDCNVGTGGGRALWYKQVPGGVPQFVLRLWEGEDSPDRYGTGFSSNRFTSTRQSNTDSQFIIKNVEAGDSAVYYCATWDSPEYV
Anguilla rostrata V29 trav LTYT01002651.1 119768 VSGQKVLTQKPSVLSVNKQQKATMDCNITRDEGNFVYWYKQVPGSAPQYVLYFYYSYSSPTYGAGFSSSRFNSTAQGKTDYQLIITNVEAGDSAVYYCCTR
Anguilla rostrata V28 trav LTYT01002651.1 115716 VGSQTLLTQKPSMLSLTKGQTATMDCNIGPEDRYAICWYKQVPGSAPQFLLCFYRTDNSPTYGAGFSSSRFNSTAQGKTDYQLIITNAEAGDSAVYYCEKWVSSAS
Anguilla rostrata V27 trav LTYT01002376.1 112187 TVVTQKPPVLSVSKGDTATMDCNLGTVTGSAARWYKQVPGEAPQFVLYFHRTSSSPTYGAGFSSSHFTAKCQTNSDCQLIITNAEARDSAVYYC
Anguilla rostrata V26 trgv LTYT01002376.1 110696 SKGDTATMDCNLGTDNSACWYKQVPGGAPQYVLRFYHSWSSPNYGADFSSPRFTSTHQSTSDYRLIINTVEAGDSAVYYCATWDSSAKEWVSQ
Anguilla rostrata V25 trav LTYT01002376.1 93315 VSGQKVLTQKPSVLSVNKQQKATMDCNIARDENEYVSWYKQVPGSAPQYVLRFRHTDSSPDYYGAGFSSSRFTSSAQSKTDYQLIITNVEAGDSAVYYC
Anguilla rostrata V23 trav LTYT01002376.1 87855 VSGVTVVTQKPPVLSVSKGDTATMDCNLGTVTDRGAWWYKQVPGGAPKFVLFFYHSNKSPTYGAGFSTPRFTSSHQTKSDYRLIIDNTEAGDSAVYYC
Anguilla rostrata V22 trav LTYT01002376.1 85446 TVVTQKPPVLSVSKGDTATMDCNLGTVTNNVAYWYKQVPGGVPQFVLYFHRTSSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V21 trav LTYT01002376.1 83428 VSGATVVTQKPPVLSVSKGDTATMDCNVGTGGGHALWYKQVPGGVPQFVLRLYKGEDSPDRYGTGFSSNRFTSTRQSKTDSQFIIKNVEAGDSAVYYC
Anguilla rostrata V20 trav LTYT01002376.1 75680 TVVTQKPPVLSVRKGDTATMDCNLGAVTDSGAYWYKQVPGSAPQFVLTDYHAWSSPTYGAGSSSSHFTSSHQSKSDYRLRITNVDAGDSAVYYCKTWADSAKGWV
Anguilla rostrata V19 trav LTYT01002376.1 69881 TVVTQKPPVLSVSKGDTATIDCNLGTVTDWAAHWYKQVPGGVPQFVLRFYHSWSSTDYGAGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYYCATWDSSAKEWV
Anguilla rostrata V18 iglv LTYT01002376.1 68173 VSGVTVVTQKPPVLSVSKGDTATMDCNLGTVTDRGAWWYKQVPGGVPQYVLFFYHSHSSPNYGAGFSSPRFTSNSQSTSDYRLIIDNTEAGDSAVYYCYTW
Anguilla rostrata V17 trav LTYT01002376.1 60586 TVVTQKPPVLSVSKGDTATMDCNLGTVTNNVAYWHKQVPGGAPQFVLYFHRTHSSPSYGAGFSSSHFTSKCQTNSDCQLIITNVEAGDSAVYYC
Anguilla rostrata V16 trav LTYT01001671.1 49438 CRAEDTVTQSMGDVIAFEGESVTIDCYYKTRSTAPDFFWYIQNPNGLIKLIMAQNIYGTGVPVAEFKGRFDAHVNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla rostrata V15 trav LTYT01001671.1 46401 CRAEDTVTQSTGDVIAIKGQSVTLGCNYSTSSASPYLFWYRQYPNGFPEYLLRRHPFVTADTKHELKETFEAHLDKSSVPLTIQKAQLSDSAVYYCALR
Anguilla rostrata V14 trdv LTYT01001671.1 40188 GSFQDEITPTSTTVHALEGNNVTLSCNYSGYANNIQWYRQYPRSKPEFLLLILEGAGTVEKATPPDHRLSANIDKNKRIVDLVISSANAADSALYYCALQ
Anguilla rostrata V90 igkv LTYT01013267.1 4986 SMADVVLTQSPAARSVQLGETVSISCASSQSLSSYLHWYLHKPGQAPKLLIYIATTRQTGIPERFSGSGSETQYTLKITGVQAEDAGDYYCQQGYGRP
Anguilla rostrata V89 igkv LTYT01012595.1 22329 SMADIVLTQSPAAQSIQLGDTVSISCTASQSVHTNSNGHYLHWYLQKPGQAPKLLIYWATSRQSGIPDRFSGTGSGTQFTLKITGVQAEDAGDYYCQSFHLISGSWV
Anguilla rostrata V88 igkv LTYT01012595.1 7098 IVLTQSPSTQSVQRGDTVSISCTASQNVHYNDRLHWYLQKPGQAPKLLIHYATRRQSGIPDRFSGSGSETHFTLTITGVQAEDAGDYYCLS
Anguilla rostrata V87 igkv LTYT01012595.1 2273 SMADIVLTQDPAAQSVQLGDTVSISCTTSQSVSYWLHWYLQKPGQAPKFLIYIATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQGYSTP
Anguilla rostrata V86 trav LTYT01011763.1 18607 EDTVTQSTVDAIALEGESVTLGCKYSTSSQSPDLFWYIQYPNGFPKHMLTRSTYGNTKTVERFKERFDAHVNKTSSSVPLTIQKAQLSDSAVYYCALR
Anguilla rostrata V85 trav LTYT01011763.1 13174 CRAEDKVSQSTGDVFAIEGESVTLGCNYSTSDASPYLFWYIQYPNAFPKYMLRRHVYGSKDTAPEFEERFDAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla rostrata V84 ighv LTYT01011673.1 25307 QSLIISCKVSGYSLTDSSYCTDWIRQPAGKALEWVGEVCRDGNTYYRDSLKNKFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARESQ
Anguilla rostrata V83 ighv LTYT01011673.1 19960 VQGEIVLIESEAVLKRPGDSHKLTCTASGFTFNSTWMSWIKQAPGKGLEWVASINEGGGSTYYPNSVEGRFTISKDNSKNQLYLQMNRLAAEDTAVYYCARN
Anguilla rostrata V82 trav LTYT01011673.1 13411 AHCDITLTESAPQMKKSGDSVRLSCKITGFSLSSYSVHWVQQAPNKGLQWVGYYGGSSDDRFKITEDSSNSIAYLDITNLQSSDTAVYYCA
Anguilla rostrata V81 trav LTYT01011673.1 10091 AHCDITLTESAPQMKKSGDSVRLSCKITGFSLSSYSVHWVQQAPNKGLQWVGYYGGSSDDRFKITEDSSNSIAYLDITNLQSSDTAVYYCA
Anguilla rostrata V80 ighv LTYT01011673.1 8158 SNCVELTQPGSMVLKPGETLSVPCKVSYSVTGDRTAWIRQPAGKALEWIGIMWADGGTSYKDSLKSKFTITRDTSSNTVILQGSSLQTGDTAVYYCAR
Anguilla rostrata V79 ighv LTYT01011673.1 6255 GHCVELSQPGSMVLTPGQSLTISCKVSGYSLTDSSYCTHWIRQPAGKALEWVGEVCGSGDTYYKDSLKSKFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARE
Anguilla rostrata V78 ighv LTYT01011673.1 4671 GHCVELTQPGSIVVKPGQSLTISCKVSGYSVTDNSYATGWIRQPAGKALEWIGDMWGGGGLYYKDSLKSKFTITRDTSSSTVTLQGSSLQTGDTAVYYCARY
Anguilla rostrata V77 trav LTYT01010883.1 22070 STGAINVLQSPIAQFVKPGEGMKLTCQHDDSSYERMYWYQKLNGQQALELVGFLYLEDVNQDKEYKGKFNLSGNAKSKGFLTISNLNAEDSGTYFCAAS
Anguilla rostrata V76 trav LTYT01010883.1 19256 AVSQSGVEVIQSPGLLLLKPGQSAVMNCTQSTSQTNMYWYQQKNNGPLQFLFSTVNSEEVTEKSDGVPDRFKVSRKSLPKTELMITGVQPEDSALYYCAAS
Anguilla rostrata V75 trav LTYT01010883.1 10760 YSGAITVEQTPPSLFGNPRDDVQLICKHDDSSYQYMYWYQRVKGQQALELIGHLSFDFVNQDDKYRGKFNLSGHAKERGSLDITSLSVEDSGTYFCAAS
Anguilla rostrata V74 trav LTYT01010883.1 9478 FGWSADVHQTPLQAITNPGVLLNISCFQNDNNLDYMYWYRQQLGKGLQLIAYIITNSDAEFEEDFKKNKERFEIKKPSALSGSFIMKSLTEEDSAVYFCAAS
Anguilla rostrata V73 trbv LTYT01010883.1 7907 ITVEQTPSSLFGIPRDDAQLICKHDDSSYRYMYWYQRIQGQQALELIGFLNYDVVNKEEKYKNKFNLSGHAKQKGYLDISNLSVEDSGTYFCAAS
Anguilla rostrata V72 trav LTYT01010883.1 6250 FGWSADVHQTPLQVITNPEGLLNISCTHNDNTLQHMYWYRQQQGKGIQQIAFIITSSNAEIEEDFKKNKERFEIKKPSALSGSFIMKSLTEEDSAAYFCAASQQ
Anguilla rostrata V71 trbv LTYT01010883.1 5248 VQCQSQQKVSQWPSQTVVTQGSSVELQCNQSGSDTYMYWYRQRSSTGLQLVMLYVYLSKPERGKDISDRFTSTRPKIESITLTISQAEESDTGVYFCAAS
Anguilla rostrata V70 trav LTYT01010883.1 3772 AVPGTIVTQTPRQFMENSEESIEIFCTHSDSNLQYMNWYRQLPGRGIELIANIVTNGDPNFETGFDKRRYSIVYIRSDHFKGSFKISPLKSVDSGTYFCAAT
Anguilla rostrata V69 trav LTYT01010537.1 26370 VSGQKVLTQKPSVLSVNKHQNTSMDCNITRDEKKYVFWYKQVPGSAPQYVLRFYHSHSSPNNYGAGFSSSRFTSTAQSETDYQLIITNVEAGDSAVYYC
Anguilla rostrata V68 trav LTYT01010537.1 24522 VSGVIVVTQKPPVLSVSKGDTATMDCNLGTVDAARWYKQVPGGAPQFVLYFYHTNSAPTYGAGYSSPRFTSNHQTTSDYRLIITTVEAGDSAVYY
Anguilla rostrata V67 trav LTYT01010537.1 22774 VSGVTVVTQMPPALSVSKGDTATMDCNLGTVTGSSARWYKQVPGAAPQFVLRFHRTHSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVDAGDSAVYYC
Anguilla rostrata V66 trav LTYT01010537.1 18610 IVVTQKPPVLSVSKGDTATMDCNLETVTNSAARWYKQVPGGAPQFVLYFHHTLSSPTYGAGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYY
Anguilla rostrata V65 trav LTYT01010537.1 16961 TVVTQKPPVLSVSKGDTATMDCNLGTVTSSRASWYKQVPGGVPQYVLGFYHSWSSPRYGDGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYY
Anguilla rostrata V64 trav LTYT01010537.1 14095 VTQKPPVLSVSKGDTATMDCNVGTGGGSAYWYKQVPGGVPQFVLWLYKGEDSPDRYGTGFSSNRFTSTRQSKSDYRLIIQTVEAGDSAVYYCKTWDDSAKEWV
Anguilla rostrata V62 trav LTYT01009001.1 14713 DSLGQDTIISTSKEEHVLDGSRVTLSCNYSAVSANNLQWYRQHPGSKPELLIPILFFGSEYEKTNKQFTVKHDKKNSRVHLEISSVQVTGSALYYCALQ
Anguilla rostrata V61 trav LTYT01009001.1 6222 ESFQEGITSTANTVHYLEGSRVTLSCNYTMSNAGAYLHWYRQYPGSKPEFLILIDRYKEREEKVGFVVKREKGNNIVHLEISSAEVTDSALYYCALQ
Anguilla rostrata V60 trav LTYT01009001.1 2499 VSFQDEITPTAKEVHVLEGNNVKLSCTYRAAANTLYWYRQYPRSKPEFLILVLGTVNKTDIKGQFTVTNDKDNKHVLLEFTAEVTDSALYYCALR
Anguilla rostrata V59 trav LTYT01009001.1 356 DSLGQDTIISTSKDEHVLDGSRVTLSCNYSSVSGKSLHWYRQHPGSKPEFLVLILILGSEEEKTNKQFTVKHDKKNSRVHLEISSVQVTDSALYYCALQ
Anguilla rostrata V58 trbv LTYT01008576.1 73934 VQCQSQQKVSQWPSQMVVTQGSSVELQCNQSSSDTYMYWYRQQSTTGLQLVMLSAYLSKPERGENISDRFTISRPKTESITLTISQAEESDTGVYFCAASPTAVSAV
Anguilla rostrata V57 trbv LTYT01008576.1 72611 VPGTIVTQTPRQCVKNSEESIEIFCTHSDINLQYMNWYRQLPGKGIELIANIVTNGDPNFETGFDERRYSIVYTSSGDFKGSFKISPLKSVDSGTYFCAAT
Anguilla rostrata V56 trav LTYT01008576.1 68664 AVPGTIVTQTPRQFMDNSEESIEIFCTHSDSNLQYMNWYRQLPGRGIELIANIVTNGDPNFETGFDERRYSIVYTRSDHFKGSFKISPLKSVDSGTYFCAAT
Anguilla rostrata V55 igkv LTYT01008557.1 7901 TSADIILTQSPTVESVTVGGSVTLNCRSSSSSFTSSLAWYLKRPGETHKLLIYSANSRATGTPTRFTGSRSGTNFMLQISGVLAEDAGDYYCQQYYEI
Anguilla rostrata V54 trav LTYT01007864.1 29326 STGAINVQQSPIAQFVKPGEGMKLICQHDDSKYDRMYWYQQLNGQQALELVGFLYYEDVNQDKEYERKFNLSGNAKSKGFLTISNMNAEDSGTYFCAAS
Anguilla rostrata V53 ighv LTYT01006741.1 39745 VKSQTLTESEPALKKPGESHTLTCTASGFTFSSYSMHWIRQAPGKGLEWVAYIRYNGGTIYYSQSVKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla rostrata V129 igkv LTYT01021373.1 2586 SMAEIVLTQDPAAQSVQLGNTVSISCTVSQSVYNGNYLSWYLQKPGQAPKLLIYWATTRQSGIPDRFSGSGSGTQFTLKITGVQTEDAGDYYCQS
Anguilla rostrata V128 trav LTYT01020879.1 6665 TVVTQKPPVLTVKEGDTAIMDCNLGTVTGSGARWYKQVPGGAPQFVLYFYHPNSAPTYGDGYSSPRFTSNHQTKSDYRLIINNLDAGDSAVYYCQTWDSSAKEYV
Anguilla rostrata V127 trav LTYT01020580.1 9203 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIIYTHGNRSDESQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V126 igkv LTYT01019726.1 22753 TKADVVLTQDPAARPFQQGDTVSINCTASQSVYHSGVNKDLLSWYLQKPGQAPKLLIYYATTRQTGIPDRFSGSGSETQFTLKITGVQAEDAGDYYCQQGNYIP
Anguilla rostrata V125 igkv LTYT01019726.1 20143 SMADIVLTQDPATRSVQQGDTVSISCTASQSVSNYLGWYLQKPGQAPKLLIYDATNRHTGIHDRFSGSGSGTQFTLKITGVQAEDAGDYYC
Anguilla rostrata V124 igkv LTYT01019726.1 18245 TKADVVLTQDPAARPFQQGDTVSINCTASQSVYHSGVNKDLLSWYLQKPGQAPKLLIYYATTRQTGIPDRFSGSGSETQFTLKITGVQAEDAGDYYCQQGNYIP
Anguilla rostrata V123 igkv LTYT01019726.1 16193 GFLTQSPAAQSVQLGDTVSISCTSSWSIYSSGASKSLLSWYLQKPGQAPKLLIYYATTRQSGIPDRFTGSESGNQFTLKITRVQAEDAGDYYCQSLHFISGSGV
Anguilla rostrata V122 igkv LTYT01019726.1 603 SMADIVLTQSPAAQSVQLGVTVSISCTTSQSVSSSYLHWYQQKPGQAPKLLIYRATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V121 iglv LTYT01018226.1 3741 QTLLTQKPSMLSLTKGQTATMDCNIGPEDTNNIYWYKQVPGSAPQFLLYFYRTHSSPTYGAGFSSSRFTSTAQSNTDYQLIITNVEAGDSAVYYCEKWVSSASDYV
Anguilla rostrata V120 trav LTYT01018226.1 1043 ASGLSVVTQKPPVLTVSKGDTATMDCNTGINGNIASWYKQVPGSAPQFVLYFHRTLSSPNLGAGFSSSHFTSKCQTYSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V119 trav LTYT01018010.1 12784 GVSGQKVLTQKPTMLSLTKGQKATMDCNIARHDGYVVSWHKQVPGSAPQFVLYFYYSHSSPTYGAGFSSSRFTSTAQGNTDYQLIITNVEAGDSAVYYC
Anguilla rostrata V118 trav LTYT01018010.1 9481 ASGLTVVTQKPPVLTVSKGDTATMDCSTGINENTAWWYKQVPGSAPQFLLYFHLTHSSPTLGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYCK
Anguilla rostrata V117 trav LTYT01018010.1 6923 VSGVTIVTQKPPVLSVSKGDTATMDCNVGTGGGSALWYKQVPGGVPQFVLRLFIGEHSPDTYGTGFSSNRFTSTRQSNTDSQFIIKNVEAGDSAVYYC
Anguilla rostrata V116 igkv LTYT01018010.1 125 VSGQKVLTQKPSVLSVNKQQKATMDCNIARDEGNYVYWYKQVPGSAPQYVLRFYHSWSSPDNYGAGFSSSRFTSTAQSKTDYQLIITNVESGESAVYYC
Anguilla rostrata V115 trav LTYT01017912.1 12115 VSGQKFLTQKPSVLSVNEQQQATMDCNIVRDDNQYVFWYKQVPGSAPQYVLRFYHSHSSPDNYGAGFSSSRFTSKAESKTDYQLIITNVEAGDSAVYYC
Anguilla rostrata V114 trav LTYT01017912.1 10692 VSGVTVLTQKPPVLSVSKGETATMDCNLGTVNNTAAWWYKQVPVGVPQFVLYFYHPNSAPTYGAGFSSPRFTSNHQSKSDYRLIIKSVEAGDSAVYYCKTH
Anguilla rostrata V113 trav LTYT01017912.1 8039 TVVTQKPPVLSVSKGDTATMDCNLGTVTNNVAYWYKQVPGGLPQFVLHFHRTSSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V112 trav LTYT01017912.1 6608 TAVTQKPPVLSVSKGDTATMDCNLGTVTNDAARWYKQVPGSAPQFVLVDYHGYSSPTYGAGFSSPQFISNHQSKSDYRLIIKTVEAGDSAVYYC
Anguilla rostrata V111 trav LTYT01017912.1 2637 TVVTQKPPVLSVSKRDTATMDCNLGTVTDNSAWWYKQVPGGAPQHVLRFYHSWSSPEYGAGFSSSHFTSIFQTNSDCQLIINTVEAGDSAVYYC
Anguilla rostrata V110 trav LTYT01017912.1 592 IVVTQKPPVLTVSKGDPATMDCNLGTVTDSGAWWYKQVPGGVPQYVILFYHGDSSPFFGAGFSATRFTSNHQSKSGYRLIISNVEAGDSAVYYC
Anguilla rostrata V109 trav LTYT01017631.1 6653 SMAVKPGESLTISCKVSRYSLTAYCTHWFRQPAGKALEWVGSTCGNGGTAYKDSLKNKFTVSKDTSSSTVSLKGSSLQTGDTAVYYCAHDSQ
Anguilla rostrata V108 trbv LTYT01017602.1 4053 LSDATTVTQKKAVVRREGDSVHIKCEQDGTDQQMYWYRQGHQNGLELIFFSRMEGVDTEKLVVEDRFTATRENRQRFHLNGTKLQPQDSAVYFCASS
Anguilla rostrata V107 trav LTYT01014524.1 55 VLQQPESESVQSGDSVTLQCTLHTETCAGEHSVYWFRKGSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYNFSKRNLSPSDAGTYYCAV
Anguilla rostrata V106 ighv LTYT01014106.1 38875 AHCDITLTESAPKMKKRGDSVRLSCRITGFSLSSYSVHWVRQAPNKGLQWVGYYDGSSDDRFKVTEDSSNNIAYLDITNLQSSDTAVYYCARQ
Anguilla rostrata V105 ighv LTYT01014106.1 35067 VKSQTLTESEPAVKKPGESHKLTCTASGFTFSDYWMAWIRQAPGKGLEWVANIRGDSSSINYATSVKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCAR
Anguilla rostrata V104 ighv LTYT01014106.1 30282 VQGEIVLTESEAVVKRPGDSHTLTCTASGFTFSSYWMGWIRQAPGKGLEWLGHQYNSSNVRYAQSIQGRFTISRDNSKNQLYLQMNRLAAEDTAVYYCA
Anguilla rostrata V103 ighv LTYT01014106.1 27623 QSLTISCKVSGYSLTDSSYCTDWIRQPAGKALEWVGEVCGSGNIYYKDSLKNKFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARQPQ
Anguilla rostrata V102 ighv LTYT01013851.1 19303 VKSQTLTESEPAVKQPGESHKLTCTASGFTFSDYYMAWIREAPGKALEWVASISDGSSYIYYATSVKGRFTISRDNSKNQLYLQMNGLTAEDTALYYCARD
Anguilla rostrata V101 ighv LTYT01013851.1 17231 CYCVELTQPGSIVVKPGQSLTISCKVSGCSLTDSSYATGWIRQPAGKALEWIGHMWGGGSLYYKDSLKSKFTITKDTSSSTVTLQGSSLQTGDTAVYYCARR
Anguilla rostrata V100 ighv LTYT01013851.1 15526 GFCVELTQPGSMAVKPGEPLSVSCKVSYSVSSDGTAWIRQPAGKALEWIGVVWSGGSTAYKDSLKHKFTIFRDTSSNTVLLQGSSLQTGDTAVYYCARD
Anguilla rostrata V99 ighv LTYT01013851.1 12481 PTSPASVQGEIVLTKSEAVLKRRDSHKLTCTASGFTFSSYWMGWIRQAHGKGLEWVACISCGSSYIYHANSVKGRFTISRDNSKNQLNLQMNRLTAEDTAVYYCARD
Anguilla rostrata V98 igkv LTYT01013747.1 6291 MADIVLTQDPAAQSVQLGDTVSISCKVSQSVHGGNYLSWYLQNPGQAPKLLIYYTTTRQSGIPDRFSGTGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V97 igkv LTYT01013267.1 48686 SMADKVLTQDTAARSFQLGETVSISCTASESVSDYLYWYLQKPGQAPKLLIYRATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQHSYLP
Anguilla rostrata V96 igkv LTYT01013267.1 42895 SMADIVLTQSPVARSVQLGETVSISCTASEDVITNLHWYLQKPGQAPKLLIYQATTRQTGIPDRFSGSGSGTQYTLKITGVQDEDAGDYYCQQSWESP
Anguilla rostrata V95 igkv LTYT01013267.1 40802 SMADVVLTQSPAARSVQLGETVSISCTISESVSSYLHWYLHKPDQAPKLLIYDDTTRQSGIPDRFSGSGSGTQYTLKITGVQAEDAGDYYCQQRYSLP
Anguilla rostrata V93 igkv LTYT01013267.1 32080 TVLTQTPAAQSVQPGDTVSISCTASQSFDYGCYFPQYGSGPCFHWYLQIPDQAPKLLILGAKYRLTGIPDRFSGSESGTQFTLKITGVQAEDAGDYYCQQGWETP
Anguilla rostrata V92 igkv LTYT01013267.1 28371 SMADIILTLQYPAARSVQLGDTVSINCTVSQSVGSYLNWYLQKPGQAPKLLIYWATNRQSGIPDRFSGSGSETRFTLKITGVQAEDAGDYYCQQGKSLP
Anguilla rostrata V168 trav LTYT01001776.1 29667 DSFQYGITSATNAVHAMEGSNVTLSCNYTGANSGDSLQWYRQYSSSKPEFLILIYSSKEREVKDGFTVINEKEKNLVHLEFSSAEVTDSALYYCALR
Anguilla rostrata V167 trav LTYT01001776.1 32741 DSLQEGITSAANAVHDLEGSRVTLSCNYTTAVIAGGSLHWYRQYPNSKPEFLILILGSRVNEVKNEFTVEHEKANNFVHLEISSAKVADSALYYCALQ
Anguilla rostrata V166 ighv LTYT01064257.1 176 SMVLTPGQSLTISCKVSGYSLTDSSYCTSWIRQPAGKALEWVGHICSSGGTTFKDSLKNKFTITRDTSSSTVTLQGSSLQTGDTAVYYCARESQ
Anguilla rostrata V165 trgv LTYT01042284.1 597 WIYGFNTRACKVSGYSLTDSSYCTQWIRQSAGKALEWVGCVCGDGNTYYKDSLKNTFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARESQ
Anguilla rostrata V164 ighv LTYT01039578.1 222 QSLTISCKVSGYSLTDSSYCTHWIRQPAGKALEWVGCVCGDGNTYYKDSLKSTFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARESQ
Anguilla rostrata V163 trav LTYT01037712.1 1785 AVPGTIVTQTPRQFMDNSEESIEIFCTHSDSNLQYMNWYRQLPGRGIELIANIVTNGDPNFETGFDERRYSIVYTRSDHFKGSFKISPLKSVDSGTYFCAAT
Anguilla rostrata V162 ighv LTYT01033094.1 2993 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSSSWMHWIRQAPGKGLEWVASIYGGDSDSTYYATSVKGRFTISRDSSKNQLYLQMNRLAAEDTAVYYCARD
Anguilla rostrata V161 ighv LTYT01031238.1 2887 SMVLTPGQSLTISCKVSGYSLTDSSYCTFWIRQPAGKALEWVGHIGSSGGTAHKDSLKSKFTITRDTSSSTVTLQGSSLQTGDTAVYYCVR
Anguilla rostrata V160 ighv LTYT01030917.1 341 VCCVELTQPGSMVVKPGETLSVLCKVSYSVSSEHTAWIRQPAGKALEWIGYITTSGGTAYKDSLKNKFTITRDTSSNTVFLQGSSLQPGDTAVYYCAR
Anguilla rostrata V159 trav LTYT01030035.1 3950 IVVTQKPPVLSVSKGDTATMDCNLGTVTTSAARWYKQVPGGVPQFVLFFYHPNSAPTYGAGFSSPRFTSNHQSKSDYRLIINNVETGDSAVYY
Anguilla rostrata V158 trav LTYT01030035.1 2823 VSSQKVLTQKPSVLSVNKHQNTSMDCNIARDEKKYVYWYKQVPGSAPQYVLRFHHTLNSPDNYGAGFSSSRFTSTAQTETDYQLIITNVEAGDSAVYYC
Anguilla rostrata V157 trav LTYT01029053.1 12098 VLQQPESESVHSGDSVTLQCTVHTETCAGHHSVYWFRQGSGESPPGIISTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V156 ighv LTYT01028887.1 2208 SVVVKPGQSLTISCKVSGYSVTDNNYATGCIRQPAGNALEWIGHMWGGGDLYYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCARR
Anguilla rostrata V155 trav LTYT01028649.1 7672 TVTQSTQDVIAIEAQSVTLRCTYSTIGTQIDLFWYIKYPNDFLKYMLRRDKFTAGETAPGFKRFDAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla rostrata V154 ighv LTYT01028649.1 4646 EVTQEQPSVQKTEEEEVSLKCSFKSTSSAYYILWYRQYPQSALQYILQRGSQGYSHTADFAEGKFESTVSSSEAFLTISKLTPEDTAGYYCALRPTVIY
Anguilla rostrata V153 trav LTYT01028348.1 1516 DSFQYGITSATNAVHALEGSSVTLSCNYTVANTGDSLQWYRQYPSSKPEFLILIYSSKEREAKDGFTVINVKEKNHVHLELSSAEVTDSALYYCALR
Anguilla rostrata V152 trav LTYT01027661.1 4557 VLQQPESESVQPGDSVTLQCSVRTEACAGEHSVYWFRQGSGESPPGIIYTHGNRSDECQRSSVAVTPSQSCVYNFPKRNLSLSDAGTYYCAV
Anguilla rostrata V151 trbv LTYT01027655.1 735 VQCQSQQKVSQWPSQKVVTQGSSVELQCNQSGSDNYMYWYRQQSSTGLQLVILSVHMSEPEKGENISSRFTSTRPKRENISLTISQVEESDTGVYFCAAS
Anguilla rostrata V150 trdv LTYT01027146.1 2871 VWSNVAITPRILWGNSGDPAQMNCSHTLGATYDRMYWYKQNPPEGIQLIVYTNPYTNPEFGNFSKDRYVAEKAAAERGSLRVKKLEAEDSGTYFCAVS
Anguilla rostrata V149 trav LTYT01026559.1 2516 IVVTQKPPVLSVSKGGTATMDCNLGTVTGSAACWYKQVPGGAPQFVLYFHHALSSPTLGAGFSSSHFTSKCQTNSDCQLIIKTVEAGDSAVYYCQTWDSSASENV
Anguilla rostrata V148 igkv LTYT01026454.1 2799 SMADIVLTQDQAAQSVQLGDAVTISCTTSQSAGSNLHWYLQKPGQAPKLLVYYATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQGYSTP
Anguilla rostrata V147 igkv LTYT01025114.1 3884 LTQSPSAQSVQLRDIVSISCTASQSVYITSNGELLHWYLQKPGQAPKLLIYLATKRQAGIPDRFSGSGSGTQFTLKITGVQTEDAGDYYCQS
Anguilla rostrata V146 igkv LTYT01025114.1 794 SMADIVLTQNPAAQSVQLGDTVSISCTTSQGIYSSPYHYLHWYLQKPGQAPKLLIYLATSRQSGIPDRFSGSGSGTQFTMKITGVQAEDAGDYYCQQYNSYP
Anguilla rostrata V145 trav LTYT01024471.1 1932 ASGQNVLTQKPSVLSVNKQQKAIMDCNIARDEGYISWHKQVPGSAPQFVLRFYHTDSTPDNYGAGFSSSRFTSTAQGNTDYQLIINTVEAGDSAVYYC
Anguilla rostrata V144 trav LTYT01023731.1 4248 GVSGQKVLTQKPTMLSLTKGQKATMDCNIARDDGYYVSWHKQVPGSAPQFVLYFYHSYSSPTYGAGFSSSRFTSTAQGNTDYQLIITNVEAGDSAVYYC
Anguilla rostrata V143 trav LTYT01023731.1 596 VSGATVVTQKPPVLSVSKGDTATMDCNVGTGDGRALWYKQVPGGVPQFVLRLYKGEHSPDIYGTGFSSSRFTSTRQSNTDSQFIIKNVEAGDSAVYYCATWDIPEYV
Anguilla rostrata V142 trav LTYT01023482.1 7448 IVVTQKPPVLSVSKGDTATMDCNLGTETGYGAWWYKQVPGGVPQYVLYFHHSYNAPKYGDGFSSPRFTSNHQTKSDYRLIINTVEAGDSAVYYCKTWDSSAKEYV
Anguilla rostrata V141 iglv LTYT01023482.1 5692 VSGVTVVTQKPPVLSVSKGDTATMDCNLGTVTNWAARWYKQVPGGVPQYVLGFHHSWSSPSYGAGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYYCHTWDNSAE
Anguilla rostrata V140 trav LTYT01023482.1 3932 IVVTQKPPVLSVSKGDTATMDCNLGTVTDRGAWWYKQVPGGVPQFVLFFYHSNSAPTYGAGFSSPQFTSNHQSKSDYRLIIKTVEVGDSAVYYCETYDSSAKEYV
Anguilla rostrata V139 trav LTYT01023482.1 170 VSGVTVLTQKPPVLSVRKGDTATMDCNLGTVTNMPAEWYKQVPGGAPQFVLKFRHTSSSPTYGAGFSSSHFSSKCQTNSDCQLIIKTVEAGDSAVYYC
Anguilla rostrata V138 trav LTYT01022509.1 8652 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYNFSKRNLSPSDAGTYYCAV
Anguilla rostrata V136 trav LTYT01021452.1 322 VLQQPESESVQSGDSVTLQCTLHTETCAGEHDVYWFRQGSGESPPGIMYTHGNRSDECQRSSGAMSPTQSCVYNFSKRNLSPSDAGTYYCAV
Anguilla rostrata V135 trav LTYT01021386.1 11806 VNGVTVVTQKPPVLSVRKGETATMDCNLGTVTDSAARWCKQVPGSAPQYVLGVYHSHSSPTYGAGFSSPRFTSNHQSKSDYRLIIKTVEAGDSAVYY
Anguilla rostrata V134 trav LTYT01021386.1 8817 VNGVILVTQKPPALSVSKRDTATMDCNLETVTDTGARWYKQVPGNAPLFVLYFYHSWGSSTYGAGFSSSRFTSTAQSKTDYQLIITNVEAGDSAVYNCQTWDSSAK
Anguilla rostrata V133 trav LTYT01021386.1 6602 VSGVTIVTQKPPVLSVSKGDMATMDCNLGTNWAAHWYKQVPGGLPQFVLYFHHSHSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V132 trav LTYT01021386.1 3646 VSAVTVLTQKPPVLSVSKGDMATMDCNLGTNWAAHWYKQVPGGLPQFVLYFHHSHSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V131 iglv LTYT01021386.1 2082 TVVTQKPPVLSVSKGDTATMDCNLGTVTDSSVHWYKQVPGGVPQFVLYFFYSHTSPTYGDGYSSPRFTSNHQTKSDYRLIINTVEAGDSAVYYCQAWDNSAKEWV
Anguilla rostrata V207 trbv LTYT01008442.1 27776 VQCQSQQKVSQWPSQTVVTQGSSVELQCSQSSSDQNMYWYRQQSSTGLQLVILSVHMSDPEKGENISSRFTSTRPKRENISLAISQVEESDTGVYFCAAS
Anguilla rostrata V206 trav LTYT01008442.1 30018 ITVQQSPSSLFGNISDHVQLTCQHDDSNYNRMYWYQQVKGKQSLELVGFLNYNNVNQDEKYVRKFNLTGNGDKKGSLFISTLNAEDSGTYFCAAS
Anguilla rostrata V205 trbv LTYT01008442.1 32073 VQCQSQQKVSQWPSQTVVTQGSSVELQCNQSSSESYMYWYRQQSTTGLQLVMLSVYMNEPERGENISDRFTSTRPKTESITLTISQAEESDTGVYFCAAS
Anguilla rostrata V204 trbv LTYT01008442.1 33257 AITVQQTPSSLFRKLNDDVQLTCQHDDSNYYRMFWYQQAKGKQSLELVGFLVHAEVTQDEKYKGKFNLTGNGNKRGSLLISQLSAEDRGTYFCAAS
Anguilla rostrata V203 trav LTYT01008442.1 34761 FTAAINVQQSPASLFGSLHKTTLLTCKHDDSNYQCMFWYRQVKGQQHLELVGFLFLKNVNQDKEYEGKFNLSGNAQESGSLLISGLKAEDSGMYFCAAS
Anguilla rostrata V202 trbv LTYT01008396.1 39622 STSGVSVQQKRPEVFTGAGTKSETLHCGHDDDSYYRMFWYRQDSGRGMRLIAYSPGQGDATIEPPFNASKYAMERPEVKKSSLQIKDLAVGDSAVYFCASSI
Anguilla rostrata V201 trbv LTYT01008396.1 39622 STSGVSVQQKRPEVFTGAGTKSETLHCGHDDDSYYRMFWYRQDSGRGMRLIAYSPGQGDATIEPPFNASKYAMERPEVKKSSLQIKDLAVGDSAVYFCASSI
Anguilla rostrata V200 ighv LTYT01007526.1 4586 VKSQTLTETEPAVKKPGESHTLTCTASEYPYHIYWMAWVRQAPGKGLEWVGGIRFDVGYIIDASTLRGRFTISRDNSKNQLYLQMNRLTAEDTAVYYCAIC
Anguilla rostrata V199 trbv LTYT01006087.1 2866 SVVCITVLQSPPELVLHRGEAVTLTCSHDDKNFDKLYWYKQTDGAGLELQGYLSFKQPYTEVGSFNVSGDGEKEGFLKSSAVTAEESGVYFCAVSK
Anguilla rostrata V198 trbv LTYT01006087.1 5367 LALSNKVNQSPPALLTAPGESVQLNCSHSIQKYDTILWYQQPQQGNGMKLLGRVYYKNVEMEVEKINVSGNGERQAFLHIDRLALTDSAVYLCAAWI
Anguilla rostrata V197 trav LTYT01006087.1 6389 ELSQSVNVQLLPVKLLKNPGESSALSCSCDDPSYVRMFWYQQPEGVGRLKLIGSLYRDRFTPGDLFSDKFQISGDATKTGTLEISNLTSEDAAVYFCAMSI
Anguilla rostrata V196 trdv LTYT01006087.1 7325 VQSNVAITPKILWGNLGDLALMNCNHTLGAAYNRMYWYKQNPPEGIQLIVFTLPNTNPEFGDFSKDRYVAEKAVAERGSLTVKKLEAEDSGTYFCAVS
Anguilla rostrata V195 trbv LTYT01006087.1 9168 LSRSINVQLLPVRLLKNPGQSSALSCRCDDPSYTYMFWYQQPEGKGRLKLIGTLYRQSLTSGDHFSDRFRISGDATKKGTLEISNLTSEDAAVYFCAMSI
Anguilla rostrata V194 trav LTYT01006087.1 10110 VQTNVIMTPKIIWSRIGDLAQMNCSHNLGASYYQMYWYKQNPPEGIQLIVFTTVGESPEFGDFSKDRYVAEKAVAERGSLRVKKLEAEDSGTYFCAVS
Anguilla rostrata V193 trav LTYT01006087.1 10890 LSFGNSVQQSPSTLLRDPGESVQLNCSHNIPSYDTILWYQQPQQGNGMKLLGRVTYKNVEMEDEKGFSVSGDGKRQAFLHIDRLALTDSAVYLCAAWL
Anguilla rostrata V192 trav LTYT01006087.1 15822 VQSKVIMAPRILWGNLGDPAQMNCNHTLGGAYTQMYWYKQNPPEGIQLIVFTLPYTSPEFGNFSKDRYVAEKAVAERGSLRVKKLEAEDSGTYFCAAG
Anguilla rostrata V191 trdv LTYT01006087.1 21492 LALSNTVNQSPAELMRDSGGSMQLNCSHIIPSQYTILWYHRAPGESALTLMGYVYYMDPTVETLYKDHCSLSGDGTEAASLQVPKVNSTDSGMYFCAVS
Anguilla rostrata V190 trbv LTYT01006087.1 23290 LALSNKVNQSPAELMIDSGGSMQLNCSHAIPSYKSILWYHRAAGESALTLMAYTYYKAATIETAFKDRCNLSGDGSAAASLRVHEVRPADSGVYLCAASY
Anguilla rostrata V189 trav LTYT01006087.1 24717 VQTNVIMDPKIIWSRMGDPAQMNCSHTLGVSYYQMYWYKQNPPEGIQLIVFTTSSGNPEFGNFSKDRYVAEKTVAERGSLRVKKLEAEDSGTYFCAAG
Anguilla rostrata V188 trav LTYT01006042.1 1253 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGQSPPGIIYTHRTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V187 igkv LTYT01004784.1 11948 SMADIVLTQSPSTQSVQLGDTVSISCTASQSVYYSSVSKSLLSWYLQKPGQAPKLLIYYATGRPSGISDRFSGRGSGTQYTLKITGVQAEDAGDYYCQQGLSTP
Anguilla rostrata V186 igkv LTYT01004784.1 27868 SMADIVLTQDPEAQSVQLGDTVSISCTVSQSVYNGDNLSWYLQKPGQAPKLLIYYATSRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V185 igkv LTYT01004784.1 29405 SMADIVLTQSPSAQSVQLGDTVSISCTVSQSVYGGSYLNWYLQKPGQARKLLIYYATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQSLHYISSNV
Anguilla rostrata V184 igkv LTYT01004784.1 33679 SMADVVLTQSPAAQSLQQGNTVSISCTASQSVFTDSSGGRLSWYQQKPGQAPKLLIYYAVTRQSGISDRFSGSGSGTQFTLKITGVQGEDAGDYYCQS
Anguilla rostrata V183 igkv LTYT01004784.1 37870 KVLTQDPAARSVQLGETVSISCTASQSVGTCLNWYLQKPGQAPKLLIYAATYRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQCSSYP
Anguilla rostrata V182 igkv LTYT01004784.1 56661 SMADIVLTQNPAAQSVQLGDTVSISCTASQSVIFGSSHYLHWYLQKPGQAPKLLIYWATSRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V181 igkv LTYT01004784.1 58556 SMADIVLTQDPAAQSVQLGDTVSISCTTSQSVFSNNLHWYQQKPGQAPKGLIYYITTVQPGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V180 igkv LTYT01004784.1 62415 SMADVVLTQDPAARSVQQGNTVSISCTASQSVYDGNYFHWYQLKPGQAPKLLIYKATRRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V179 igkv LTYT01004784.1 73032 MADIVLTQDPTAQSVQLGDTVSISCTVSQSVHGGNWLHWYQQKLGQAPKNLIYLATIRQTGIPDRFSGSGSGTQFTLKITGVQADDAGDYYCQS
Anguilla rostrata V178 ighv LTYT01002188.1 17402 LEAVLILTQEKSLSVSPGSNVKISCISSDSDYYISWYQKKPGSSPRFLVVDSTRGTGVSSRFTSPKTDNNNYLHINEVTAEDEAVYYCGCAGCGE
Anguilla rostrata V177 trav LTYT01001776.1 1744 DSFQDGITSVANAVHALEGSSVALSCNYTASLTGGSLHWYRQYPRSKPEFLILIIRTEEREEKDGRIVNHDKAGNHVDLELSSVKVTDSALYYCALQ
Anguilla rostrata V176 trav LTYT01001776.1 3580 NTQGDSVLQYPSVFLTENEKSSLYCQYETTGTTPYLFWYIQRENKSPELILGNYNVRGNGYKEGLAADNEKSNKTYNLTIAAAVLSDSATYYCALR
Anguilla rostrata V175 trav LTYT01001776.1 6256 DSLGQDAITSTSEEEHVLVGSGVTLSCNYSADRVNSLHWYRQHPGSKPEFLILVYAEPKTDKRFTAKHDKMNKTVVLEISSVQVKDSALYYCALE
Anguilla rostrata V174 trav LTYT01001776.1 11743 DSFQDGITSVANAVHALEGSSVALSCNYTASLTGGSLHWYRQYPRSKPEFLILIIRTEERVEKDGRIVNHDKAGNHVDLELSSVKVTDSALYYCALQ
Anguilla rostrata V173 trav LTYT01001776.1 14594 NTQGDPVLQYPSVFLTENEKSSLYCQYETTGITPYLFWYIQRENKSPELILGNYNVRGNGYKEGLAADNEKSNKTYNLTIAAAVLSDSATYYCALR
Anguilla rostrata V171 ighv LTYT01001776.1 18317 ISSGEVKLQTIAEEGQVSMECTFSTSSLSSNTFYWYRQYPGSALEFILRRGSYTGTSDFAKERFDATADTSSGKTILTIKKLIPEDTAFYYCALR
Anguilla rostrata V170 trav LTYT01001776.1 20777 DSFQDEIAPEAKEVHVLEGNNVKLSCTYRAAADYLYWYRQYPRSKPEFLILVLATVNKKEKKGQFTVTNDKDNKHVHLEFSSAKVTDSALYYCALR
Anguilla rostrata V246 trgv LTYT01013332.1 20229 EVKQEEAFKSAREEHEVSLECPFRTSSTNYLIYWYRQYPGSALQFILFHRYKDYKEDFASVRFSSVVNDSKSVLTISTLIPEDTAIYYCALQ
Anguilla rostrata V245 trdv LTYT01013332.1 26653 EDTVAQSIGDVIALEAQSVTLGCKYSTSNPSPDLFWYIQYPNGFPKHMLTRSTYGNTKTVAEFKERFDADVNKTSSSVPLTIQKVQLSDSSVYYCALR
Anguilla rostrata V244 trav LTYT01013332.1 35027 SIMAINNTVHALGESNVALSCIYSSTASAKYLHWYRQYPSSKPEFLVLVVDASGTEPKKRAGRFYAKVDKENSRVDLEISSAEVTDSALYYCALQ
Anguilla rostrata V243 ighv LTYT01009955.1 19995 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSSHSMHWIRQAPGKGLEWVAYIRYNGDTIYYSQSVKGRFTISRDNSKNQLYLQMNRLTAEDIAVYYCA
Anguilla rostrata V242 ighv LTYT01009955.1 19995 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSSHSMHWIRQAPGKGLEWVAYIRYNGDTIYYSQSVKGRFTISRDNSKNQLYLQMNRLTAEDIAVYYCA
Anguilla rostrata V241 ighv LTYT01009955.1 23071 IVLSQPGQEVKRPGESVKLTCTVSGFSLGGYWTAWLRQKAEKSPEWLGEINGDGGTINYLSSIRGRLTISKDNGQNTLHMELKSLRTEDTAVYYCAR
Anguilla rostrata V240 ighv LTYT01009955.1 23071 IVLSQPGQEVKRPGESVKLTCTVSGFSLGGYWTAWLRQKAEKSPEWLGEINGDGGTINYLSSIRGRLTISKDNGQNTLHMELKSLRTEDTAVYYCAR
Anguilla rostrata V239 ighv LTYT01009955.1 26633 SMAVKPGESLTISCKVSGYSLTDSCCCTHWIRQPAGKALEWIGYFCYEGSTAYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCA
Anguilla rostrata V238 ighv LTYT01009955.1 27899 VQGEIVLTESEAVVKRPGESHTLTCTASGFTFSSYWMGWIRQAPGKGLEWISIIENDSDRKFYSKSVQGRFTNTRDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla rostrata V237 igkv LTYT01009955.1 32484 GHCVELTQPGSMAVNPGQSLTISCKVSGYSLTDSSYATGWIRQPAGKALEWIGYMWGGGSLYYKDTLKSKFTISRDTSSSTVTLQGSSLQTADTAVYYCTRY
Anguilla rostrata V236 ighv LTYT01009955.1 34950 VQGEIVLTESEAVVRRPGESHKLTCTSSGFTFSDYWMAWIRQAPGKGLEWVASNYGGDSGSTYYATSVKGRFAISRDSSKNQLYLQMNRLAAEDTAVYYCARD
Anguilla rostrata V235 ighv LTYT01009955.1 36525 VKSQTLTESEPAVKKPGESHKLTCTASGFTFSSYYMHWIRQAPGKGLEWVAQIDYGGGSTWYANSFKGRFTISRVNSKNQLYLQMNRLTAEDTAVYCCA
Anguilla rostrata V234 ighv LTYT01009955.1 43229 GHCVELTQPGSMVVKPGESLTISCKVSGYSVTDNSYATGWIRQPTGKALEWIGNMWGGGSLYYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCARV
Anguilla rostrata V233 ighv LTYT01009955.1 54253 SMAVKPGESLTISCKVSGYSLTDSYCTAWIRQPAGKALEWIGVFCYDGSTAYKDSLKSKFTISRDTSSSTMSLQGSNLQTGDTAVYYCARQ
Anguilla rostrata V232 ighv LTYT01009955.1 56054 IKCQTLTESEPAVKKPGESHKLTCTASGFTFSSHDMHWIRQAPGKGLEWVAEISSGGGSTYYATSVKGRFTITRDNSKNQLYLQMNSLTAEDTAVYYCAR
Anguilla rostrata V231 ighv LTYT01009955.1 57503 GHCVELTQPGSVVVKPGQPLTISCKVSGYSVTDSSYATGWIRQPTGKALEWIGRMWGDGVLEYKDSLKSKFTISRDTSSSTVTLQGSSLQPGDTAVYYCARY
Anguilla rostrata V230 ighv LTYT01009955.1 70523 VKCQTLTESEPAVKKPGESHTLTCTASGFTFSSYDMHWIRQAPGKGLEWVAEISSDGRSYIRYATSVKGRFTISRDNSKNQLYLQMNSLTAEDTAVYYCARE
Anguilla rostrata V229 ighv LTYT01009955.1 72572 SHCVELTQPGSVVVKPGQSLAISCKVSGYSVTDNSYATGWIRQPTGKALEWIGNMWGGGSLYYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCARE
Anguilla rostrata V228 trav LTYT01009248.1 24785 GLLGKNIVQPHSLMTAQLGDTVTLPCFDAKDDVLWHIWLKQPLGQKPEKLLMIKNSAPYSIVFNDFINSARLSAKAAKGSSNLTVSQVEPSDSATYYCAV
Anguilla rostrata V227 trav LTYT01009248.1 26496 VLQQPESESVHSGDSVTLQCSVHTETCAGEHSVYWFRQGSGESPPGIIYTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V226 trdv LTYT01009248.1 27272 GLLGKNIVQPDVLVTAQLGDTVTLSCFYAKDDVQWYRWLKQPFGQKPEQLLKIFNSAPYTIYFNEFINSARLSAKAAKGTSNLTVSKVEPSDSATYYCAILLYND
Anguilla rostrata V225 trav LTYT01009248.1 56699 VLQPKSQSVQPGDSATLQCTVRTETCAGEHSVYWFRQSSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDTGTYYCAV
Anguilla rostrata V224 trav LTYT01009248.1 57535 GLLGNIIQPDALVRAQLGDTVTLPCFYPTEDGPSVSWYKQPLGQKPQLMVIKMNSVSDAIFFDQFKNSTRFSAKAAKGTANLTVSRVEPSDSATYYCAI
Anguilla rostrata V223 trav LTYT01009248.1 63255 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIISTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V222 trav LTYT01009248.1 71897 VLQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGEFPPGIIYTHGNRSDECQRSSGAVSPTQSCVYNFPKRNLSLSDAGTYYCAV
Anguilla rostrata V221 trav LTYT01009248.1 78344 VLQQPESESAQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIIYSHGTRSDECQRSSGAVSPTQSCVYNFSKRNLSPSDAGTYYCAV
Anguilla rostrata V220 trav LTYT01008614.1 5178 LQQPESESVQPGDSVTLQCSVHTETCAGEHSVYWIRQGSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYSFPKRNLSPSDAGTYYCAV
Anguilla rostrata V219 trav LTYT01008614.1 5178 LQQPESESVQPGDSVTLQCSVHTETCAGEHSVYWIRQGSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYSFPKRNLSPSDAGTYYCAV
Anguilla rostrata V218 trav LTYT01008614.1 6296 GLFGENVLQPDGLVTAQLGETVMLPCFFTVQVASNFSWYKQPLGQKPQLLARIWSYESDPTFYNEFKNSKRFSAKAAKGSFNLTVSRVELSDSATYYCAI
Anguilla rostrata V217 trav LTYT01008614.1 13036 VLQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIIYTHGNRSDECQRSSGAVSPTQSCVYNFPKRNLSLSDAGTYYCAV
Anguilla rostrata V216 trav LTYT01008614.1 17145 VLQQPESESMKPGDSVTLQCTVHTETCAGEHSVYWFRQSTGESPLGIIYTHGNRSDECQRSSGAVSPTQSCVYNFPKKNLSHSDAGTYYCAV
Anguilla rostrata V215 trav LTYT01008442.1 10556 DVIQTPKQAVMKTGESVEISCSHKDNNLQYLYWYWQLPGKGIELIAYILTNQKETFEKDFNDRTERYEIKKPEVLSGSFRIKVLQISDSAVYFCAAT
Anguilla rostrata V214 trbv LTYT01008442.1 11679 VQCQSQQKVSQWPSQTVVTQGSSVELQCSQSGSDQNMYWYRQQSSTGLQLVIFSVYMNDPEKGENISDRFTSTRLKMENISLTISQAEESDTGVYFCAAS
Anguilla rostrata V213 trav LTYT01008442.1 14269 ITVQQSPSSLFGKLNDDVQLTCLHDDSSYYTMLWYQQAKGKQSLDLIGFLNYDRVNQDEKYERKFKLTGNGDKKGSLFISTLNAEDSGTYFCAAS
Anguilla rostrata V212 trav LTYT01008442.1 18123 LSEAITVQQSPSSLFGKLSDDVQLTCQHDDSNYNTMLWYQQVKGQQDLELVGLLLYAAVTQDEKYKGKFNLTGNGDKKGFLLISKLSAEDRGTYFCAAS
Anguilla rostrata V211 trbv LTYT01008442.1 22785 ITVQQSPSSLFGKLSDDVQFTCQHDDSSYYRMYWYQQVKGKQSLELVGFLEYKNVNQEDEKHRRKFNLTGNGDKKGTLFISKLNAEDSGSYFCAAS
Anguilla rostrata V210 trbv LTYT01008442.1 24180 VQCQSQQKVSQWPSQTVVTQGSSVELQCSQSGSDQNMYWYRQQSSTGLQLVMLSVYMNEPEKGENISDRFTSTRLKKENISLTISQAEESDTGVYFCAAS
Anguilla rostrata V209 trav LTYT01008442.1 25938 AITVQQSPSSLFRKLNDDVQLTCQHDDSTYYTMLWYQQAKGKQSLELVGFLVHAEVTQDEKYKGKFNLKGNGDKRGSLLISQLSVEDRGTYFCAAS
Anguilla rostrata V285 trav LTYT01023822.1 1312 TVVTQKPPALSVSKGDTATMDCNLGTVTDRGAWWYKQVPGGVPQYVLYFSHSYSSPNYGAGFSSPQFTSNHQSKSDYRLIIKTVEVGDSAVYYC
Anguilla rostrata V284 trav LTYT01023822.1 4663 VSGVTVVTQKPPVLSVSKGDTATMDCNLGTVINTARWYKQVPGGAPQYVLGFYHSWSSPSYGAGFSSPHFTSNHQSKSDYRLIINNVEAGDSAVYYC
Anguilla rostrata V283 ighv LTYT01023773.1 680 VKSQTLIESEPAVKMPGESHKLTCTASGFTFSSYWMAWIRQAPGKGLEWVASDGGGSSTYYASTLKGRFTISRDNSKNQLYLQMNRLTAEDTAVYYCARD
Anguilla rostrata V282 ighv LTYT01023773.1 3780 GHCVELTQPGSVVAKPEQSLTISCKVSGYSVTDDSYATGWIRQPEGKTLEWIGHMWGGGGLSYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCARY
Anguilla rostrata V281 trbv LTYT01023773.1 6626 VKCQTLIESEPAVKKPGESHKLTCTASGFTFSSYYMHWIRQAPGKGLEWVAEISSDGRSYIRYATSVKGRFTISRDNSKNQLYLQMNRLTAEDTAVYFCARRD
Anguilla rostrata V280 igkv LTYT01023377.1 4091 IILTQSPAARSVQLGETVSISCKASQHVGTEFDWYLLRPGQAPKLLIYAATSRQTGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQQDYSLP
Anguilla rostrata V279 ighv LTYT01022280.1 4253 VKSQTLTESEPAVKQPGESHTLTCTASGFTFSSYWMAWIRQAPGKGLEWVARINSGGGSTYYATSVQGRFTISRDNSKNQLYLQMNSLTAEDTAVYYCARD
Anguilla rostrata V278 ighv LTYT01022280.1 8480 AHCDITLTESAPQMKKPGDSVRLTCKITGFSLSSYSVHWVRQAPNKGLQWVGYYSGSSDNRFKVTEDSSNSIAYLDITNLQSSDTAVYYCARQ
Anguilla rostrata V277 trav LTYT01022033.1 7512 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIISTHGNRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V276 trav LTYT01022033.1 7512 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQGSGESPPGIISTHGNRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V275 igkv LTYT01021974.1 7863 AHCVELTQPGSVVVKPGQSLTISCKVSGYSVTDSSYATGWIRQPAGKALEWIGYIGTGGGTDYKDSLKNKFTISRVTSSSTVTLQGSSLQTGDIAVYY
Anguilla rostrata V274 ighv LTYT01021486.1 9398 VKSQTLTESEPAVKKPGESHKLTCTASGFTFSDYRMNWIRQAPGKGLEWVAFIHTQSSHIYYSKSVEGRFIISRDDSNSKLYLQMNRLTAEDSAVYYCARD
Anguilla rostrata V273 igkv LTYT01021198.1 9707 IVLTQDPAARSVQQGDTVSISCTASESVYTLLHWYLQKPGQAPKLLIYASTTRQTGIPDRFSGSGSETQYTLKITGVQAEDAGDYYCQQGFSEP
Anguilla rostrata V272 igkv LTYT01021198.1 10355 IVLTQDPAARSVQQGDTVSISCTASESVYTLLHWYLQKPGQAPKLLIYASTTRQTGIPDRFSGSGSETQYTLKITGVQAEDAGDYYCQQGFSEP
Anguilla rostrata V271 trav LTYT01018729.1 16249 VSGVTVVTQKPTVLSVSKGDTATMDCNTGINENTVWWYKQVPGGAPQFVLYFHRTFSSPTYGAGFSSSHFTSKCQTDSDCQLIISNVEAGDSAVYYC
Anguilla rostrata V270 iglv LTYT01018729.1 19572 VSGVTVVTQKPPVLSVSKGDTATMDCNLGTVTGHAARWYKQVPGGVPQFVLYFHLTHSSPTYGAGFSSSHFTAKCQTNSDCQLIITNVEAGDSAVYYCNTWD
Anguilla rostrata V269 trav LTYT01018450.1 17 ESFQDEITPAAKEVHGLEGNSVSLSCTYTAAVNSLYWYRQYPRSTLEYLVSVVSTDRTEGPFTAKHDKNSKTVHLEISSVEVKDSALYYCALQ
Anguilla rostrata V268 trav LTYT01018450.1 13667 DSLGQDTIISTSKEEHVLDGSRVTLSCNYSSVSGKSLHWYRQHPGSKPEFLLLILILGSEEEKTNKQFTVKHDKKNSRVHLEISSVQVTDSALYYCALQ
Anguilla rostrata V267 trgv LTYT01018450.1 20060 ITTGEVKLLNMREEQQVSMECTFSTSSSSYNRFYWYRQYPGSALQYILHRGYDSGTSDFAKERFDATAEQSSGKTTLTISKLNPEDTAMYYCALW
Anguilla rostrata V266 trav LTYT01018450.1 25626 DSLGQDTIISTSEEAHVLNGSSVTLSCNYSSADVKSLHWYRQHRGSKPEFLILILFFGSEEEKTDKQFTVKLDKTNSRVHLEISSAEVTDSALYYCALQ
Anguilla rostrata V265 trgv LTYT01018450.1 32749 ISSGEVKLLNMREEQQVSMECTFSTSSSSFYAFYWYRQYPGSALQYILHRGDYTGTSDFAKERFDATADKSSGKTILTISKLIPEDSALYYCALL
Anguilla rostrata V264 trbv LTYT01016487.1 17843 SSDGVTVLQKQTEMFTGTESETLHCEHDDANHYNMYWYRQDSGRGMRLIAYSFGKDDVNIEPPFNASKYAMERPEVKKSSLQIKDLAVGDSAVYFCASSI
Anguilla rostrata V263 trbv LTYT01016487.1 20519 SASGVSVLQKRPEVFTRTGTETLHCEHDDALYFNMYWYRQDSGRGMRLIAYSPGQGTVNIEPPFNASKYAMERPEVKKSSLQIKDLAVGDSAVYFCASSI
Anguilla rostrata V262 ighv LTYT01014904.1 24295 IKCQTLTESEPAVKKPGESHKLTCTASGFTFSSYYMSWIRQAPGKGLEWVASIDSGGGSTWYASTLKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla rostrata V261 ighv LTYT01014904.1 24295 IKCQTLTESEPAVKKPGESHKLTCTASGFTFSSYYMSWIRQAPGKGLEWVASIDSGGGSTWYASTLKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla rostrata V260 trav LTYT01014524.1 16330 VLQQPESESVQPGDSATLQCTVHTETCAGEHSVYWFRQGSGESPPGIISTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V259 trav LTYT01014019.1 1524 DSFQDGITSAADAVHALEDGSVTLSCNYTTSSSTGGSLHWYRQYPRSKPEFLILVIRSKEGAEKDRWIVKHNRTSNLVHLEISSAEVTDSALYYCALQ
Anguilla rostrata V258 trav LTYT01014019.1 4358 DSFQDEITPAAKEVHVLEGNNVTLSCTYTAAANYLHWYRQYAQSKPEFLILVAGTLSKKDKKGRFIVTNDKESKHVDLEFSSAEVTDSALYYCALQ
Anguilla rostrata V257 trav LTYT01014019.1 10825 DSFQDGIISSTNAVHALEGSSVTLSCSYTISVSGAYLHWYRQYPNSKPKFIIFINTFQEQVEKGVFAVKHEKANSHVHLELSNTEVADSALYCCALQ
Anguilla rostrata V255 ighv LTYT01013388.1 8658 VNCQTLTESEPVVKKPGESHKLICTASGFTFSSYSMHWIRQAPGKRLEWVSVISSSGGTIYYSQSVQGRFTISRDNSKNQLYLQMNRLTAEDTAVYYCARD
Anguilla rostrata V254 ighv LTYT01013388.1 12741 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSSSWMAWIRQAPGKGLEWVAEISDGGGSTYYATSVKGRFTISRDNSKKQLYLQMNSLTAEDTAVYYCARD
Anguilla rostrata V253 trbv LTYT01013388.1 14999 SMVLTPGQSLTISCKVSGYSLTDGNYCTHWIRQPAEKALEWVGCVCGGGSTYYKDSLKNRFTVSRDTSSSTVSLKGSSLQTGDTAVYFCARE
Anguilla rostrata V252 ighv LTYT01013388.1 16606 GHCVELTQPGPMAVNPGQPLSISCKVSGYSLTDSSYCTFWIRQPAGKALEWVGYICSSGSTAYKDSLKRKFTTSRDTSSSTVFLQGSNLQTGDTAVYYCAR
Anguilla rostrata V251 igkv LTYT01013332.1 7869 CRAEDAVTQSAGDVFALEGHSVKLGCNYSTSDTSPYLFWYIQYPNAFPKYMLRRYVYGSKDTALEFKERFDAHLNKTSSSVPLTIQKAQLSDSAVYYC
Anguilla rostrata V250 trav LTYT01013332.1 10440 EDAVTQSAGDVFALEGHSVKLGCNYSTSDTSPYLFWYIQYPNAFPKYMLRRYVYGSKDTAPEFKERFDAHLNKTSSSVPLTIQKVQLSDSAVYHCALR
Anguilla rostrata V249 trav LTYT01013332.1 11905 NSFEDAVTPIANAVHALEGSSVMLSCNYTGSANNLQWYRQFTRSKPEFLLLIVESSKYVIEADPPYPRLSIELDKTTKQVHLELASAEVTDSALYYCALQ
Anguilla rostrata V248 trav LTYT01013332.1 14408 EDTVTQPMGDMIALEGESVTLGCNYSTSYTPYLFWYIQHPNGFPKYILRRDTLTAGETVPGFERFDAQLNKASSSVPLTIPKVQLSDSAVYYCALR
Anguilla rostrata V309 trav LTYT01045984.1 911 LQQPESESVQPGDSVTLQCTVHTETCAGEHSVYWFRQDSGESRPGIIYTHGTRSDECQRSSGAVSPTQSCVYNFPKRNLSPSDAGTYYCAV
Anguilla rostrata V308 trav LTYT01045409.1 800 CRAEDKVSQSTGDVFATEGESVTLDCNYSTSDASPYFFWYIQYPNAFPKYMLRRHVYGSKDTAPEFEERFDAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla rostrata V307 igkv LTYT01041616.1 233 SMADIILTQSPAARSVQLGDTVSISCAVSQSVYTDSNGNWLHWYLQKPGQAPKLLIYIATRRQSGIPDRFSGSGSGTQFTLKITGVQTEDAGDYYCQS
Anguilla rostrata V306 igkv LTYT01037784.1 477 SMADIVLTQSPAAQSFQPGDTVSISCTASEGVSNWLHWYLQKPGQAPKLLIHGATTRQTGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQHSKSLP
Anguilla rostrata V305 trav LTYT01037078.1 1750 VSGQKVLTQKPSVLSVNKQQKATMDCNIARDDNRYVSWYKQVPGSAPQYVLCFHHTGSSPDNYGAGFSSSRFTSTAQGNTDYQLIISSVEAGDSAVYYC
Anguilla rostrata V304 trav LTYT01034933.1 4662 DSLGQDTIISTSKEEHVLAGSNVTLSCNYSAGSGNSLQWYRQHPGSKPEFLILILIFGSDEKMTNKQFTVKHDKNNKFVHLEISSAEVADSALYYCALQ
Anguilla rostrata V303 igkv LTYT01032311.1 107 SMADIVLTQSPAAQSVQLGGTVSISCTASQSVTSGSYHFLSWYQQKPGQAPKLLIYLATSRQSGIPDRFSGSGSGTQFTLKITGVQAEDTGDYYCQQGL
Anguilla rostrata V302 trav LTYT01031023.1 892 ITVEQTPSSLFGNPRDHVQLTCKHDGSNYQYMYWYQRVQGQQALELIGYLQYESVNQDEKYKGKFNLSGHAKDKGSLDITSLSVQDSGTYFCAAS
Anguilla rostrata V301 ighv LTYT01029858.1 1509 GRCVELTQPGSMAVKPGESLTISCKVSGYSLTDSSYATHWIRQPAGKALEWVGYICSSGSTGYQDSLKSKFTIIRDTSSSTVFLQGSSLQTGDTAVYYCAR
Anguilla rostrata V300 ighv LTYT01029858.1 3569 VQGEIVLTESEAVVKRPGDSHKLTCTASGFTFSDHYMAWIRQAPGKGLEWLAKIHGDSSYIYYNPSVKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCARN
Anguilla rostrata V299 ighv LTYT01029220.1 1988 VKSQTLTESEPAVKKPGESHTPTCTASGFTFSSSWMHWIRQAPGKGLEWVAEISSACGSTYYATSVKGRFTISRDNSKNQPYLQMNRLAAEDTAVYYCAR
Anguilla rostrata V298 ighv LTYT01029220.1 3816 GHCVELTQSGSTVLTPGQSLTISCKVSGYSLTDSSYATGWIRQPAGKTLEWIGLIYYNGNTRLKDSLKSKFTISRDTSSSTVTLKGSSLQTGDTAVYYCARE
Anguilla rostrata V297 ighv LTYT01029185.1 727 ISSGEVELLSRREEEQVSMECTFSTGSSGYYYYFYWYRQYPGSALQYILYRGDGTGTSDFAKERFDATADTSSGKTILTIKKLIPEDTAFYYCAL
Anguilla rostrata V296 trav LTYT01029185.1 5237 NSFQNEITSTANAVHALKGSSVKLSCNYTTSTNGNYLHWYRQYPSSKPEFIILINTYESSAEKGVFAVKHEKENKHVHLEISSAEVTDSALYYCALQ
Anguilla rostrata V295 ighv LTYT01029185.1 9263 IFTGEVKLLNMKEEEQVSMECTFSTSSTGYYSYWYRQYPGSALQYILRRGSSSHTSNFAEKRFDATADTSSGKTILTIKKLIPEDTAFYYCAL
Anguilla rostrata V294 ighv LTYT01028387.1 3296 GHCVELTQPGSMTVKPGQPLSISCKVSGYSLTDSSYCTSWIRQPAGKALEWIGYICSDGNTYYKDSLKGKFTISRDTSSSTVSLQASSLQTGDTAVYYCAR
Anguilla rostrata V293 ighv LTYT01028387.1 4755 VKSQTLTESEPAVKKPGESHTLTCTASGFTFSGYWMAWIRQAPGKGLEWLGYRYDSSSVYYAQSIKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCAR
Anguilla rostrata V292 ighv LTYT01028092.1 87 SNCVELTQPGSMVLKPGETLSVSCKVSYSVTGYSTAWIRQPAGKALEWIGVMWSDGSTDYKDSLKSKFTITRDTSSNTVFLGGSSLQTGDTAVYYCARD
Anguilla rostrata V291 ighv LTYT01028092.1 4499 GFCVELTQTGSMAINPGGASSVSCKVSYSVSSYATHWIRQPAGKALEWIGGIGSGGGTAYKDSLKHKFTISRDTSSSTVTLRGSNQQTGDTAVYYCA
Anguilla rostrata V290 igkv LTYT01028055.1 1500 SMADIVLTQAPAAQSVQLGDTVSISCTASQGIYTYSSGECLSWYLQKPGQAPKLLIYLATKRETGIPDRFSGIGSGTQFTLKITGVQAEDAGDYYCQSVHYINSWV
Anguilla rostrata V289 igkv LTYT01028055.1 4711 SVADIVLTQDPTAWSAQLGDTVSISCTVSQSVFVGTRLHWYQQKPGQAPKLLIYLATSLQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V288 igkv LTYT01025108.1 4948 SMADIVLTQDPAARSVQLGNTVSISCTASQSVYGNNRLSWYLQKPGQAPKLLIYAATTRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V287 igkv LTYT01024901.1 648 SMADIILTQDPAAQGLQLGDTVSISCTVSQSVGSSLSWYLQKPGQAPKLLIYAATTRQSGIPDRFSGSGSGTQFSLKITGVQAEDAGDYYCQQYSSYP
Anguilla rostrata V310 trav LTYT01062244.1 280 VSGVTVVTQKPPVLSVSKGGTATMDCNLGTETAYGAWWYKQVPGGVPQYVLRFHHSWSAPTYGDGFSSARFTSSHQTESDYRLIINNLEAGDSAVYYC
Anguilla rostrata V286 igkv LTYT01024901.1 2427 TMAQVVLTQDPAAQSVQLGDTVSISCTASQSVATCYSANDCFSWYLQKPGQAPKLLIYYAITRQSGIPDRFSGSGSGTQFTLKITGVQAEDAGDYYCQS
Anguilla rostrata V256 trav LTYT01014019.1 12918 HSLGQDTITSTSKEKHVSDGSSVTLSCNYSAGSVNSLQWYRQHPGSKPEFLILTYSEPKTDKQFTIKHDKNNKFVHLEISSAKVADSALYYCALR
Anguilla rostrata V247 trav LTYT01013332.1 16884 DSFQDEITPTAKEVHVLEGSNVTLSCTYTAAANTLHWYRQYPRSKPEFLILVTGALSKKDEKGRFIVTNDKDNKHVRLEFTAEVTDSALYYCALR
Anguilla rostrata V208 trav LTYT01008442.1 26697 DVIQTPRQAVMKTGESVEISCSHKDSSLHYLYWYWQLPGKGIELIAYILTNEKATFENDFSNRTERYEIKKPETLFGSFRIKALQISDSAVYFCAAT
Anguilla rostrata V172 trav LTYT01001776.1 16677 DSLGQDAITSTSEEEHVLVGSGVTLSCNYSADRVNSLQWYRQHPGSKPEFLILTYSEPKTDKQFTIKHDKNNKFVHLEISSAVVTDSALYYCALE
Anguilla rostrata V169 trav LTYT01001776.1 23660 DSLGQDTIISTSKEAHVLDGSSVTLSCNYSSADVNSLHWYRQHRGSKPEFLILILFFGSEVDKTDKQFTVKLDKANSRVHLEISSVQVTDSALYYCALQ
Anguilla rostrata V137 iglv LTYT01022442.1 5146 VSGQKVLTQKPSVLSVNKQQKGTMDCNIARDEGNYVYWYKQVPGSAPQYVLRFYSWRGFNYGAGFPSSRFTSTAQSKTDYQLIITNVEAGDSAVYYCSTWDDSASAAV
Anguilla rostrata V130 trav LTYT01021386.1 379 ASAVTVVTQKPPVLSVSKGDTATMDCNLGTVTDNSARWYKQVPGGVPQFVLRFHRTHSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVDAGDSAVYYC
Anguilla rostrata V94 igkv LTYT01013267.1 36562 SKADIVLTQDPAARSVQLGETVSISCTASESIYYSNVNKDLLSWYLQKPGQAPKLLIYYATTRQSGIPDCFSGSGSGTQFTLKITGVQAEDAGDYYCQQGLSTP
Anguilla rostrata V91 igkv LTYT01013267.1 16864 SLADIVLTQHPAPRPFEQGDTVSISCTANEVLSTYLHWYLQKPGQAPKLLIYDDTNRQTGTPDRFSGSISGTQYTLKITGVQTEDAGDYYCQS
Anguilla rostrata V63 iglv LTYT01010537.1 4452 TVVTQKLPVLSVSKGDTATMDCNLGTVTGHAARWYKQVPGGVPQFVLYFHLTHSSPTLGAGFSSSHFTSKCQTNSDCQLIISNVEAADSAIYYCSSWDNEHV
Anguilla rostrata V52 ighv LTYT01006741.1 37443 IFCVELTQPGSMVVKPGETLSVPCKVSYSVSSDYTAWVRQPAGKALEWTGVISSGGGTAYKDSLKNKFTITRDTSSNTVFLRGTSLQTGDTAVYYCAR
Anguilla rostrata V24 trav LTYT01002376.1 89560 VSGVTAVTQKPPVLSVIKGDTATIDCNVGTGGDRAVWTKQVPGGAPQFVLYLYHTSSSPTYGAGFSSPHFTLNHQSKSDYQMIIDNTEAGDSAVYYC