WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cyprinus carpio LHQP00000000.1 (LHQP01) 277 46 0 19 129 47 13 23
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cyprinus carpio V14 trbv LHQP01004487.1 26051 FSYAYKANQSPPDVIKKQGESAEIRCLHSVSNYNQINWYRQNQDQGFTLMGYLYLTSKNEEADFTNKIEMSGNGNSNGYLTIKDLLSNDSAVYFCAAS
Cyprinus carpio V13 trbv LHQP01004487.1 22045 FSHSNKVNQSPPDVIERQGETAKIQCLHSVPSYNQINWYRQNQDHRFTLMGYLLGKDPYKENDFKDKIEMSGDGNSNGYLNIKGLSSNDSAVYFCAAY
Cyprinus carpio V12 trbv LHQP01004487.1 11211 FSHSNKVNQSPPDIIKKQGESAEIRCLHSVTSYNQINWYRQGQGFTLMGYLVATSNFSEKEFTDKIIMSGNGNSNGLLTIKNLASSDSAVYFCAAY
Cyprinus carpio V11 trav LHQP01004487.1 9968 SLSDQVHQNPPHLITNAEKTVQLSCSHTINGYRMILWYQQLKGDSALNLIGNVYYKDPTTENQYKNQFTIGGNGAESSTLNVTLEREHVGSTAVYYCAASR
Cyprinus carpio V10 trav LHQP01004487.1 2736 ASLSDQVHQNPPHLITNAEKTVQLSCSHKIKDYIMILWYQQLKGDSALNLIGYVYYKDPTTENQYKNQFTIGGNGAESSTLNITLKKEHVGSTAVYYCAASR
Cyprinus carpio V9 ighv LHQP01003246.1 4162 LLMWSQVTESLTNTAVTLGADVIINCDLGIEEIYWYKQKSPDPPELILRTFSNRTEVAKYENSIFEDKYSVRTNSRLFIRNITVDELGVYYCVKTSE
Cyprinus carpio V8 trav LHQP01002944.1 20894 RVDQPDPHIAEFEGRSVTLQCKYKTTSPQPELFWYIQKENHFPKYMLKRNKYGGEDNDAQFQERFDSNVSSDSVPLTIKNLHVSDSAVYYCVLQPTVTG
Cyprinus carpio V7 trav LHQP01002944.1 15733 IVDQPDKHITEFEGKTVTLQCKFKTASSQPDHFWYIQRANDFPKYMLRRNKYGSEDNDAQFKERFDSKVSSDSVPLMIKNLRVSDSAVYYCALRSTVTE
Cyprinus carpio V6 trav LHQP01002944.1 12017 AVSGNITPDETELFAEEGLNVTLSCSYSSADYLYWYRQYPGSGPEHLVRIFNGATNTEKSDVDPRLSVILTKQEQKHVDLKISSAAVSDSALYYCALQPTVTG
Cyprinus carpio V5 trav LHQP01002402.1 3054 NTFANTIQPLYSEKHVVRGENVILSCNYSGNVNNLQWYRQYPGSQPEHLILVTEYSEPDLSLRLSAKASNVLKQVNLTISSAEETDSALYYCALAPTVTG
Cyprinus carpio V4 igkv LHQP01001599.1 204 SSGQITVTQTPAVQTTELGKTVVMRCTASTPLTGCSTPCLSWYLQKPGETPKLLIYYTNSRYTGTPSRFSGSGSGSDFSLTISGVQTEDTGDYYCES
Cyprinus carpio V3 trav LHQP01001506.1 62914 EQPSREMTANEADQVTLMCNYTTKATSTNTYLFWYKQLSNKSPTFILNKISFSEGTTESDFKKRFNATLDTTSRTVPLMIKNLLVSDSAVYYCALRPTVTE
Cyprinus carpio V1 ighv LHQP01001452.1 2148 LAAYNLSQEKTKSVKLGDKVSILCTAEDDENYISWYQQKAGAAPLFLLRNDIRASDLPDRFTYTDSGNQDYLTIDGVRAEDEAVYYCACVLNTG
Cyprinus carpio V0 igkv LHQP01000402.1 11522 TVTQNPSKKTVASGQSVTITCETSLDVGNWCSSKYCLSWYLKKTGDAPKLLIYQGHIRYSSIPSRFSGNGSDKKFQLVINGAQNEDSGDYYCFGDLGGHR
Cyprinus carpio V52 trbv LHQP01027862.1 31241 ACLGNTVLQTPDNLVKNQDESAVIICTHNIPNYYRILWYKQSPDMLGFKLMGYLNYDNENKELEFEKKIKLDGDGQKNGTLIISNLMQNDSAVYFCAAY
Cyprinus carpio V51 trbv LHQP01027862.1 8848 SVFSTKVHQSPPDLFKMKGDDAELECQHSISSNNVILWYKQTPGQGLILLGHLMMRIGQKEDDFTGKVELKGDATKSGSLTIKYLSDNDSAVYFCAAS
Cyprinus carpio V50 trav LHQP01027190.1 88 SDEIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCIEKSENGSSAQSCVYSLSQTELKPSDAGVYYCAVATCGK
Cyprinus carpio V49 trgv LHQP01025166.1 14195 ILWKISLNVSVQQGQNPTLRCPLMPDSSKGVLSWYKQTPWHLPQLILSYNITNISRVRYGTVQDHSRYAVLTREGLNPRHFLQIITTLQTDTGTYYCGFSDKNQ
Cyprinus carpio V48 trbv LHQP01020470.1 768 ISNSQDIHQTPKDLIKNSGQSEELRCSHSSSYNVMLWYKQKRGESLELLGYLVGSSDTVEDEFENKISLDGDANKNSVLKLERLSAEDSAVYFCAAS
Cyprinus carpio V47 trav LHQP01020400.1 26070 CKSQDKVDQHTRIQFAFEGDNVTIDCTYQTAYTTPTLFWYQQKDNGNPKHMLNKFSKSGNSEEEFKERFHANLNTTSVPLTIQDVRVSDSAVYYCALRPTVTE
Cyprinus carpio V46 trav LHQP01020400.1 17224 SSAQDRVEQSSREMTESEEAQVILMCNYTTTSTDPYLFWYKQLPNRSPTFILNQYTTEPDFIKKYSATLNSTPRTFPLTIKNLHVSDSAVYYCALRPTVTGT
Cyprinus carpio V45 trdv LHQP01020400.1 14104 ETFAQSITPLENKTLKYEGEKVTLSCKYDGAVTNLHWYHQYSGSKPEFLAYIYPHGATSKPLSNRLIPKVIKNNNLVSLEISDAEVTDSALYYC
Cyprinus carpio V44 trav LHQP01020400.1 12737 CSSQSEDKVDQHTRIQFAFEGDTVKIDCTYQTAYTNPTLFWYQQKGNGHLKHMLNKFSKSGNSEEEFKERFHANLSTTSVPLTIKYLRVSDSAVYYCALRPTVTE
Cyprinus carpio V43 igkv LHQP01019302.1 7604 SVGQVSVIQTPTEKHVQNKDTVTLTCKTSSSIGRQSDGWCKSCLSWYLQKLLVYGIKTLHTGTPSRFSGNGADHGTDFSLTISGVQTEDTGDYYCLS
Cyprinus carpio V42 trav LHQP01018315.1 30936 NGNVIRPNQPPVVLTEGSSTTLSCTYDGSAYSLHWYRQKPGSKPEFLLLIDESTKTEVPASPPHPHMSIRLHDNRSVDLEISSAAVSDSAMYYCALQ
Cyprinus carpio V41 trav LHQP01018315.1 26560 SLSDLITSHDSEKQAQDGNNVTLSCNYTGAVFNLLWYRQYQRSKPELLLFMTESGDPVKEDPSADWLSAKVDKLRKLMELEISPAKVSDSAQYYCALK
Cyprinus carpio V40 trav LHQP01018315.1 23697 AIKPLSLNIKRCVGDSVTLSCSYKDYTATVQNLQWYRQYPRSKPEFLLYIFQNGDMSEDRPPRFTAAVNQDNKQVDLNISSAEETDSAVYYCALL
Cyprinus carpio V38 trav LHQP01018315.1 18520 ADAIKPLSLNVNRRVGDSVNLSCSYKDYTATVQNLQWYRQYPRSKPEFLLYILENGAMSEDRPPRFTAAVKKDNKQVDLKISPAEETDSAMYYCALVPTVTGN
Cyprinus carpio V37 trav LHQP01018315.1 16330 HTEADTIKPLSLNVNRHVGDGVNLSCSYKDYTGAVNNLQWYRQYPRSKPEFLLYILQNGDMSKDRPPRFTAAVNQDNKQVDLKISPAEETDSAMYYCALV
Cyprinus carpio V36 trdv LHQP01018315.1 4221 GIAPLSSSELVTDGDSITLACNYNGTYNSDSLLWYRQFSSSNPEFLFLVSEAKLEQPADPPIPGVFAKLNEEKNRVVLKISSASVSDSALYYCALQ
Cyprinus carpio V35 trgv LHQP01018104.1 343075 DGAVELQQKISLTKAVEKLAIIDCQLQVSCWNYIHWYQQKDGETLKRILYADINDGSTKGNDAGDEFKSEKKGSNHFALKINKLKKEHLAMYYCACWDYSSS
Cyprinus carpio V34 trgv LHQP01018104.1 323599 DGAVALQQKISLTKAVEKLAIIDCQLQVSCWDYIHWYQQKDGENLKRILYTDINDGSTKNDVGFESIKSEKKASNHFALKITKLKKEHSAMYYCACWVSG
Cyprinus carpio V33 trav LHQP01018104.1 318088 AVFGVTLEQGQQILVKAVGKTSYLPCKVTGLQSWNCIHWYQKREGEAPSRLLYISAVGTFIHDTNNPQANDFTVDRTQLYNLKLSNTKPIHAAVYFCAYWDSN
Cyprinus carpio V32 trgv LHQP01018104.1 311163 CLNGQITHPDPVVFKASGRAARVQCKVDSSTLRSSVIHWYRAPPKGALQRLMYFEAGSPKATKDPDTPRRFSGSVSGDVVALTISKLEPSDEGSYYCALWSGD
Cyprinus carpio V31 trbv LHQP01018104.1 309383 LGVTVNQGPKVLVKEEGKTVYLPCKATGLGSSDYIHWYQMKHGEAPSRLLYISQRGDVTRDTNNPQANDFTVDKTKLYDLKLSDIQKSHAAVYFCAYWIYISG
Cyprinus carpio V30 trbv LHQP01011203.1 4665 ACLGKTVQQTPDKLIKNQDESAVVMCSHKISTYYQILWYKQSPDMLGLKLMGYLNNDAKNKEPEFENKIELEGNGRNDGTLIISNLTLTDSAVYFCAAY
Cyprinus carpio V29 trgv LHQP01010968.1 4924 DGNVELQQKSSLIKSVDKTVVIDCNYPSDCSGYIHWYQLKEENPLRRILYSSISGGATNNDAGFESFKIDRKPSNLALKIPELKEEHSAVYYCACWVSG
Cyprinus carpio V28 trbv LHQP01009079.1 52909 AGISDVSQVPSVLMAVKGNDAQLNCTHKKDSTFVQMYWYRQRPGQTMTLIVFTSTLNSKHDYGDSDPNKFPVIKTVPESGSLTVNNVESDDSAVYFCSVS
Cyprinus carpio V27 trbv LHQP01009079.1 48431 AGISDVSQVPSVLMAAKGSDVQLNCTHKKSSTFVQMYWYRQRPGQPMTLIVFTSTLNSKHDYGDSDPNKFPVIKTVPESGSLTVNNVESDDSAVYFCSVS
Cyprinus carpio V26 ighv LHQP01008898.1 4153 IDSYELTQPESLTVRPDATLTINCKVSYSVTSQNTGWIRQPAGKALEWIGVIYYDGSLAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARR
Cyprinus carpio V25 trbv LHQP01008578.1 29678 TVGGDGVVQEPKILWETKNGSASLNCSHNKGSSYYQMYWYRQRPGETMRLIVFTMTNSKPEFGDVDEKKFEAQKSVPESGSLKVNHLEPDDSGIYFCAVS
Cyprinus carpio V24 trbv LHQP01008578.1 25471 ACLGKTVLQTPGDILKKQDESAVITCTHNIQSYDRILWYKQSQDMLGFELMGNLFYEDGTKEPGFEKNIKLEGDGRNKGILTISNLTLTDSAVYFCAAY
Cyprinus carpio V23 trav LHQP01007556.1 10998 PTVLQQPVSDRLHSGDSVTLQCSVISQICAGEYRVYWFRHSSGHSDPGIIYTHDNRSDQCMERSESSSSTQSCVYSLSQTELTPSDAGIYYCAVATCGK
Cyprinus carpio V22 trbv LHQP01004487.1 41507 CVVCSPVIQQSPKHLLQTVEEKQANLSCHHGDSSYTYLYWYQQKHEGGSLELIGMLTYGEPSTEDKFKPRFVLSGHATKDAFLLISSISSEDSAVYFCAAS
Cyprinus carpio V21 trbv LHQP01004487.1 40344 CVVCSPVIQQSPKHLLRTVEEKEAKLSCNHGDSSYPYLFWYQQNNEGRSLELIGMLIDDSSTPEEKFKPRFALSGHATKDAYLIISNISAEDSAVYFCATS
Cyprinus carpio V20 trbv LHQP01004487.1 37788 CVVCSPVIQQSPKHLLQTVEEKDAKLFCRHGDNNYQYLYWYQQKSNGGSLELIGILNYGIASHEDKFKPRFNITGNAKEDAFLLISRISVEDTAVYFCAAS
Cyprinus carpio V19 trbv LHQP01004487.1 36250 CVVCSPVIQQSPKHLLQTVEEKEAKLFCHHGDSNYQNMYWYQQKSNGGSLELIGMLNYGTASHEDKFKPRFALSGHATKNASLIISNITAEDSAVYFCAAS
Cyprinus carpio V18 trbv LHQP01004487.1 32578 CVVCSPVIQQSPKHLLRTEEEKKAELSCNHGDSSYLYMYWYQQKNEGGSLELIGMLTGDSGTPEEKFKPRFALSGHATKVASLIISNISAEDSAVYFCAAS
Cyprinus carpio V17 trbv LHQP01004487.1 31954 LCLMLNVTQTPRNLFLVTGESMNITCSHHDKTYDKIFWYQQSNGQNLEHLGFLSFKQDFVGEKGFTITGDAEKEAYLLVSSVKAEHSAVYFCAVSA
Cyprinus carpio V16 trgv LHQP01004487.1 30755 NSTIIQTPTHLLSKNNAESVILHCSHKNPTLNVILWYKLPLSGEMQLMGYLYRKNNNSEPDFEEKIELLGNGGSNSDLTLKKLSSDDSAIYYCAAR
Cyprinus carpio V15 trbv LHQP01004487.1 27044 HLFSSVVQTPPEVIVHSGQTFTLCCSHNISSYNTILWYYQHEHSQGMHIIGYSFHGTHNVENLDDKKYKLEGDAKNSVNLTISELTLKESAVYFCAAS
Cyprinus carpio V91 ighv LHQP01067419.1 592 LVQSQKVDQSPRDLIRKLTESAVLTCSHSDQGFELILWYKRSDDKGLIFLGYLNNNFPNPEDEFKQKIDLAGDGRSSATLTIKDLTEDSSGVYYCAAR
Cyprinus carpio V90 trav LHQP01062615.1 3112 MSFGDEIMPDSTEEFAAVGSTVNLSCSYSSANTLQWYRQSPGSAPQFLVLITEGVKETKISDIDPRFSTKLRKEKQATKDIKRVDLIISTAAVSDSALYFCALR
Cyprinus carpio V89 trav LHQP01062615.1 634 CVDQPDQHITEFEGRSVTLQCKYKTALSQPELFWYIQRANDFPKYILWRNKFGTKNNDAQFQERFDSEVSSDSVPLTIQNLNVSDSAVYFCALRSTVTE
Cyprinus carpio V88 trgv LHQP01058561.1 4085 VESVSLNQTQKVLVKQKGKSVSFTCEVKGLASGGFVHWYHKKDGETFKRILYISESGTATTEATGFTAEKKGKSYGIKLNTIRDEQAGMYYCASWEG
Cyprinus carpio V87 ighv LHQP01056696.1 7862 VYSQVVLTQSEQSVVVSPSASYKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYYTDSDKGSAQSVQGRFTASKDSSNLYLHMSQLKTEDTAVYYCATD
Cyprinus carpio V86 ighv LHQP01056696.1 6912 LFCIELDQPPVMVVKPGETFTIFCKITGYSASGEGSTHWIRHSSGKPMEWTGYFYSSSNNRVTDSLKNKISFSSESSSNTVILTGKNFNTEDTAVYYCARN
Cyprinus carpio V85 trav LHQP01056671.1 1756 CRGQIVITQTPLTTAAQPGQEVKLNCKANRPVHLNDHMAWYFRKPGGATKLLINRATNRLAGAPSRFTGSGHGADFTLTISGVQPEDAGHYFCQS
Cyprinus carpio V83 trav LHQP01056446.1 14519 CRSEDKVDQPDEHMTEAEGRSVTLQCKYKTDSAQEDLFWYIQRANDFPKYILRRSKYGGDNGTEFQERFHSKLSSNSVPLTIQNLHVSDSAVYFCALR
Cyprinus carpio V82 trav LHQP01056446.1 9301 CRSEDKVDQPDEHMTEAEGRSVTLQCKYKTDSPQDYLFWYIQRANDFPKYILRRTKYGGEDTDAQFQERFDSKVSSNSVPLTIKDVRVSDSAVYFCALR
Cyprinus carpio V81 trbv LHQP01055672.1 2691 AGISDVSQVPSVLMAVKGNDAQLNCTHKKDFTFNQMYWYRQRPGQTMTLIVFTSTLNSKHDYGESDPNKFPVIKTVPESGSLTVNNVESDDSAVYFCSVS
Cyprinus carpio V80 trav LHQP01049967.1 9380 CRSEDTVDQPDKHVSEVEGRSVELKCKYKTVSVQEELFWYIQKANDFPKYILRRNKYGGENDVQFQERFHSEVSSNSVPLTIKNLRVSDSAVYYCALR
Cyprinus carpio V79 trav LHQP01049967.1 7203 KVDQHTRIQTAFEGDSVTINCTYHTAYNTPTLFWYQQKVSGNPKYMLNKFSKSGNSEEEFKERFHANLSKTSVPLTIQDVRVSDSAVYYCALQPTVTE
Cyprinus carpio V78 trgv LHQP01049704.1 4196 KSNGEIRQEPEIFANRSSTVTLTCEHDNSDHYRLFWYKQAKGTVDLFLMVFSASQNQVNIEEPFKTQDSKYAATRPEIKKSTLQINKLETKDSALYYCAT
Cyprinus carpio V77 trgv LHQP01049704.1 2616 QTSAHIVLQSTRFISALPGDKVTFDCSMAAGVSMSSYTMYWYKQDHYGQAVQFIIKEYEKTPQNYEAIMNTKDNMFSLTVSNLTAQDSSTYYCAA
Cyprinus carpio V76 trav LHQP01049704.1 1051 PANCVNFEQTPLLIVNQSSEAKINCKHDDSSLLVMLWYRQQSMSLDLIGYSYSGSPPNNEPEFKDRFTQTREKTETGSLTISELVLSDSAIYYCAASTQ
Cyprinus carpio V75 trav LHQP01045885.1 45718 KCFAQTITPLQDRTQVTEGKPVNLSCTYDVSVQSLLWYRQYPGSGLEFLLLVLESSKKSVVYADPPIPRLDGEMSMKDKRVDLIISAEVTDSALYYCALV
Cyprinus carpio V74 trav LHQP01045885.1 42399 CRCGDVITPVQPEVHGKSGDQISLSCNYSTALSLHWYRQYPRSSPDFLLLILQNSGESETIKPGMSVKLNEKKTSVDLEISSAKVTDSAVYYCALK
Cyprinus carpio V73 trav LHQP01045885.1 20169 VFADSIAPKEEGSNKTRREGESVTLSCIYKSKNNVLLYWYRQYPNREPQYLLFKSSRLSGEVNVSSKRYKITTSRTSTSLTINNVYLSDSALYYCALKVGAQ
Cyprinus carpio V72 trav LHQP01045885.1 16053 AEVITPYSSYQFAVEGDSVTLSCSYTGSVRGLHWYHQYTGSPPKFLILDYYETVTEADPPVAGVSIHHRKDNSSVDLKISSAAVTDSALYYCALE
Cyprinus carpio V71 trav LHQP01045885.1 7316 VSFGNVITPVQPEVSGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILHRTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSVKVKYSALYYCALDSTVTG
Cyprinus carpio V70 ighv LHQP01045845.1 50513 ASGQSLTSSDSVVKKPGESVTLSCTGSGFSVGSSYMHWVYQKPGNGLEWIGRIDPGTGTIFAQSLQGQFSIKKDSSKNMLYLEIKSLKTEDTAVYYCAGE
Cyprinus carpio V69 ighv LHQP01045845.1 43813 VSGQSLTSSDSVVKKPGESVTLSCTGSGFLVGSSYMHWIYQKPGKGLEWIGRIDPGSGTLFAQSLQGQFSITKDTNKNMLYLEVKSLGTEDTAVYYCARQ
Cyprinus carpio V68 ighv LHQP01045845.1 1713 VSGQSLTSSDAVVKKPGESVTLSCTVSGISMTYFWLHWVRQKPGKGLEWIGHIDDGTGTVFAQSLQGQFSITKDTNKNMLYLEVKSLKPEDTAVYYCVRD
Cyprinus carpio V67 ighv LHQP01045845.1 365 IDCQVVLTQSEQSVVVAPGGSYKLTCACSGFSVIGTSMYWIRQAPGKGLEWIIYYYSDSNKSSAQSVEGRFTASKDSSNFYLHMNQLKTEDTAVYYCAR
Cyprinus carpio V66 trav LHQP01045168.1 8308 CNSQSQDKVDQHTRIQFAFEGDTVTINCTYQTAYGSPTLFWYQQKVNGIPKHMLYKVSKSGNSEEEFKERFHANLSTTAVPLTIQDVHVSDSAVYYCTLQPTVTE
Cyprinus carpio V65 trav LHQP01045168.1 4987 NSFGDTIQPWFLEKHDSEGENVTLSCNYSLTSGSTGVNIQWFRQYPGAKPEFLLLVTEYSNKSEPELRLFSEAKKEIKRVDLVISSAAVSDSALYYCALQ
Cyprinus carpio V64 ighv LHQP01042920.1 8784 ISGDEIRLDQSPAEIKRPGETVKISCKISGFTMTSSYMHWIRQKPGKALEWIGRVNSGSSSRSDYLIYADSMKNHFTLSEDVSQSTQYLEAKSLRAEDTAVYYCARQ
Cyprinus carpio V63 igkv LHQP01042920.1 278 IDCQVVLTQSEQSVVVSPGASYKLTCACSGFTLSSTHMYWIRQAPGKGLEWIIYYYSDAYKSSAQSVQGRFTASKDSSNLYLHMNQIKTEDIAVYYAYFVTKALF
Cyprinus carpio V62 trav LHQP01042165.1 2268 KVDQHTRIQSAFEGDTVTINCTYQTAYPTPTLFWYQQKDNGHPKHMLNKFSKSGNTEEEFKERFHANLSTTSVPLTIQEVRVSDSAVYYCALK
Cyprinus carpio V61 igkv LHQP01040368.1 7595 QVTVIQTPTEKHVQNGQTVTLTCKTSSSIGRQSDGDCKSCVFWYLQKPGEAPKLLVRSIKTLYTGTPSRFSGNGVDYGTDFSLTISGVQTEDTGDYYCLS
Cyprinus carpio V60 trav LHQP01039536.1 21849 GSFGNVITPVQTEVYKKERENVTLSCNCSSASTLQWYRQYPGSASEFLMLILHSTGKVSQRSEIVDRDPRFSGKVNEEKTHVILEISSAKLTDAALYYCSLEPTVTG
Cyprinus carpio V59 trdv LHQP01039536.1 14639 GSFANVITPVQTEVYKKEGENVTLSCSYSSASTLQWYRQYPGSAPQFLLIILHATGKVSQKSEIVDRDPRFFGKVNEEKTHVILEISSAKLTDAALYYCALEPTVTG
Cyprinus carpio V58 trav LHQP01038668.1 4860 RVEQPPGEMTANEADQVTLTCNYTTKTTNVYLFWYKQLSNKSPTFILNKYPFSEGTTESDFKKRFYAKLDTTSRTVPLMIKNLRVSDSAVYYCALR
Cyprinus carpio V57 trav LHQP01038668.1 3670 CKSEDAVHQNIRVETADEGADVIISCSYTTTDPSPTLFWYQQKVNGFPKYMLNRAATYRNNEEEFKKRFNASLNTQTKSVPLTIKNLRVSDSAVYYCALK
Cyprinus carpio V56 trav LHQP01038668.1 2448 RVEQPSGEMTANKGDPVTLHCNYSTSATNVYIYWYKQLPNRSPTFMLSVFSFGKGTTVDEFKDRFFPTLNSKSTTVQLMIKNLHVSDSAVYYCALQPTVT
Cyprinus carpio V55 igkv LHQP01029324.1 21842 QITVTQTQSIIAAQPGQEVRINCKTSSRVYNSDFLAWHLQKPGEAPKILIYAATYNYTGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Cyprinus carpio V54 igkv LHQP01029324.1 540 SIGQVTVTQTPSQLLTQTGEEVKIKCTTSSNAACCCGGTACISWYLQKHGEAPKLLIYGANQRQSGTPSRFSGSGSNSDFTLTISGVQTKIQEYYCMSHTEISG
Cyprinus carpio V129 trbv LHQP01010204.1 35259 SSSDVDVVQEDNVKIVRAGEDVNLTCTFSSLLQTTTAWFKQTADGKSLQIVSFYIKLQPSWNKEFEKANRFIVIKGDGHFNLTILKTKSSDSARYFCVVS
Cyprinus carpio V128 ighv LHQP01010204.1 96041 NPDIMTKNHLKIVQAGDSVNFTCIFPKESRTTVAWVKQRAGEKPLLITSSYQALPVVFENNFDKHNRFFVEKDDSHFNLSITNVKESDTATYYCVKYIYQ
Cyprinus carpio V127 trbv LHQP01009702.1 2764 EKGDMTVHQKPYNLIINYGESPEIKCFHKIPDYDRLLWYKQSQSEELTFMGYLLGDTGYSEKAFQNKIKIRGDANNFHGSLTLINSTSENSAVYFCAAYYTV
Cyprinus carpio V126 trbv LHQP01009702.1 5666 FADVNAVTQSPNFMLAAKENATLNCNHTKGDTYNRMYWFRQHQGKTMELIVFTTSFGTVEFGKLEKTKYSVKHESAAKGVLTVISLESDDNALYLCAVS
Cyprinus carpio V124 ighv LHQP01008900.1 5489 VYCQVVLTQSEQSVVVSPGASYKLTCACSGFTPSSYRMHWIRQAHGKGLEWILHYYTDSDKGSAQSVQGRFTASKDSSNFYLHMSQLKTEDTAVYYCARE
Cyprinus carpio V123 ighv LHQP01007333.1 2932 ISGDEIRLDQSPAEIKRPGETVKISCKISGFTMTSYWMHWIRQKPGKALEWIGRVNSGSGSADYADTMKNHFTLSEDVSQSTQYLEAKSLREEDTAVYYCARQ
Cyprinus carpio V122 ighv LHQP01007333.1 5934 CWCQTLTESEAPVMKPGESHKLTCTASGLDIAGYWMAWIRQKSGKELEWLALIRSDSQSIYYSQSVQGRFTISRDNSRKQVYLQMNSLKNEDTAVYYCAR
Cyprinus carpio V121 ighv LHQP01006969.1 5176 CRSQTLVESDAAVIKPGESHKLTCTASGFNFGGSWMAWIRQAAGKGPEWVATLSDGNSYIYYSDKVKGRFTISRDNNKNQLYLQMSSLKTEDTAVYYCA
Cyprinus carpio V120 ighv LHQP01006969.1 7347 AHGQSLTSSGSEVKKPGESVTLSCVASGLSLSWLHWIRQKQGKGLEWIGRIDDGTGTIFAQSLQGQFSITKDTSKNMVYLEIKSLKTEDTAVYYCARESQ
Cyprinus carpio V119 ighv LHQP01006969.1 11242 VECNIVLKQTNSIVLQPGNSLTLTCEVSGYSVTDDSYATAWIRQPAGKALEWITEIWGGGDIYKKDSLSNKFSISKSDSSNTVTLKGQNLQTEDTAVYYCARR
Cyprinus carpio V118 ighv LHQP01006969.1 12344 CWCQTLAESESVVIKPGGSHRLTCTFSGFSSDPSLAWIRQTAGGGLEWLAYISSDGSSYIYYSQSVKGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Cyprinus carpio V117 trbv LHQP01002765.1 1480 MVRCVNVQQNMTPLLFRENKTAELMCNYDDSGKPNMLWYQQKNTAMALIVFSYGADSEPTYEDGFKERFKLERKNTLNGVLKIPDLSLSDSAVYFCAVS
Cyprinus carpio V116 igkv LHQP01002227.1 887 SRAAEITVTQTPSVKTATPGENVVMSCKLSKDSTCGPPCVAWYLQKPGEALKLLIYDASSRQSGTSSRFSGSGSHSDYTLTISGVQTEDAGHYYCQS
Cyprinus carpio V115 trav LHQP01001683.1 1012 CKSEDAVHQNIRVETADEGADVIINCSYTTTDPLPTLFWYQQKVNGFPKHMLSTYGNNEDEFKKRFNARLNKLTKSAPLTIQDLRVSDSAVYYCALRPTVTE
Cyprinus carpio V114 trav LHQP01001683.1 2218 KVEQASRQMTADEAAQVTLLCNYSTSFTNAYLFWYKQLPNRSPTFILSEFTVGKGTIEDEFKDRFSATLDSTSRTVPLMIKKLHVSDSAVYYCALRPTVTE
Cyprinus carpio V113 trav LHQP01001527.1 1985 VSFGNVITPVQPEVSGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLTVLHRTGKVSQTSKIVDLDPRFSGKVTEKKTHVDLEISSVKMKDSALYYCALE
Cyprinus carpio V112 trav LHQP01001527.1 3409 SVKQPKSVQSAYEEEDSVTLDCKYNTTSSNPTLLWYRQNSYDSPKYILRKHKFGDGDEAPEFKGRFHARHDSTSKSVPLTIQNPRASDSALYYCALQ
Cyprinus carpio V111 trav LHQP01001527.1 6144 CFGEDTVNQPNENITAVEGQQVSINCEFKTLQLTPYLYWYIQRSNAPEYVLMRYKFGSSNSSEFEKRFDARLDSNSVPLTIKNLRVSDSAVYYCALQPTVT
Cyprinus carpio V110 trav LHQP01001527.1 7958 NSVTQPRKVQTATAGETVTIDCTYKTNAFPTLYWYQYKVNQAPKYMLKRYAGSSDEDEDFKERFNATLQTSSTSVSLTIHDVRVSDSAVYYCALQPTVTE
Cyprinus carpio V109 trav LHQP01001527.1 9143 CDSLEIVDQNSSVQTDVEGRSVTINCRYETSDPSPYLFWYQQKMNGIPKHMMMIFGTTVQNDKDFKERFKANDDKTSKSVPLMIEDVRVSDSAVYYCALRPTVTE
Cyprinus carpio V108 trav LHQP01001527.1 12012 CQSEDTVDQPLKHVTKLEGESVTLDCKYNTTSPSQELFWYIQRTEESPKLVLQRNSYGGGSNGTEFQERFYSVVEPLKSVPLIIRRLCMSDSAVYYCALR
Cyprinus carpio V107 trav LHQP01001527.1 15611 VFSDSIGPNEKDKSITRKEGESVTLSCSYDTNSNNIYLYWFRQYNNREPEYLLFEGARSYSGAADIQDHRFQSTTSQTSTKLIIKTASLSDSALYYCALRVRAQ
Cyprinus carpio V106 trav LHQP01001527.1 16530 CRAEDTVDQPNKHVTEAEGGSVTLQCKYTATTTTTPELFWYIQRANDIPKYMLRKNKYNGDQGTEFQERFDSAVSSDSVPLTIKDLRVSDSAVYYCALQPTVTE
Cyprinus carpio V105 trav LHQP01001527.1 18371 CDSLDSVEQNTTVQTAVEGATVTISCQYETTDISPNFYWYQQKVNGVPKGMLSKFGFHKERFSGDLNTISKSFPLTIQDVHGSDSAVYYCALQPTVTE
Cyprinus carpio V104 trav LHQP01001527.1 19300 CWGQDSVEQPVREKTSAEGDQVTLLCNYTIMSSANAYLFWYKQLPNRSPTFILSNFSIGKGTTEPEFQERFHAKLDSKLGTVPLTIKNLHVSDSAVYYCALQPTVTE
Cyprinus carpio V103 trav LHQP01001527.1 20616 CDSLESVDQNSSVQTDVEGRSVTINCRYETSDPSPYLFWYQQKMNGIPKNMMTIIAKNVQKDKEFKERFNANHDKSSKSVPLMIKDVRVSDSAVYYCALRPTVTE
Cyprinus carpio V102 trav LHQP01001527.1 22722 CQSEDTVDQPLKHVTKLEGESVTLDCKYNTISTSEELFWYIQRREEYPKLVLQRNSYGGGFNGTEFRERFYSEVKPSKSVPLIIRRLCVSDSAVYYCALR
Cyprinus carpio V101 trav LHQP01000668.1 6407 VSGVTVVTQSPLITVSKGETAKLDCNLGTVTESSARWYKQTPAGVPQHVLRFHHSWSSVEYGSGFSAPKFTSTHSSKSDYSLIINNVDVDDSAVYYC
Cyprinus carpio V100 trav LHQP01079806.1 6312 KDVITPYSDAAFTTETERVKLSCNYTGSVESLHWYQQYAGSPPQFLILDSYGSITQANPPVSGISIRPRKEDKSVDLIISSAAVSDSALYYCALK
Cyprinus carpio V99 trav LHQP01078843.1 727 ADTIKPLSLSENRHVGESVNLSCSYKDYTGNIQNLQWYRQYPRSKPEFLLYIFPQGLLSEDRPPRFTAAVNQDNKQVVLNISSAVETDSAIYYCALV
Cyprinus carpio V98 trgv LHQP01078837.1 6913 VESLKLEQTKKVWVKQKGKSVSFECEVEGLGSGNFVHWYHKKNNGTFKRILYISKSGTATSEATDVVADKKGDSYGIKLSIRDDEQAGMYYCASWDG
Cyprinus carpio V97 igkv LHQP01078087.1 274 SRGVTLTQPEVKNVQQGQTATIECQIDIGIRYSHLYWYQQKSGEAPKLLIYHINTLQSGNPSRFSGSGTANTGRDFTLTISGVQTEDKGDYYCQS
Cyprinus carpio V96 ighv LHQP01076667.1 205 IDSYELTQPESLTVRPDATLTINCKVSYSVTSQNTAWIRQPAGKALEWIGVIWSDGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Cyprinus carpio V95 ighv LHQP01075103.1 2937 GVFCVELTQQPPFMVVKPQESFSISCRISESSYCINWIRQPTEKAMEWLGYLCSGGSTGTTYSVKKKISFTQDTSKNTVFLQGKNFETEDSAVYYCARYTQ
Cyprinus carpio V94 trav LHQP01074068.1 88 SDEIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCIEKSENGSSAQSCVYSLSQTELKPSDAGVYYCAVATCGK
Cyprinus carpio V93 ighv LHQP01069495.1 7733 VYYQVVLTQSEQSVVVSPGASYKLTCACSGFTVSSTNMYWIRQAPGKGLEWIIYYYSDSDKGSAQSVQGRFMASTDSSNLYLHMSQLKTEDTAVYYCATD
Cyprinus carpio V168 trav LHQP01018706.1 263038 ESNGNVIRPNQPSVVLTEGSSTTLSCSYDRSAYSLHWYRQKPGSKPEFLQLIVESSKYVNKADQPHPHMSIRLHDNKSVDLEISSAGVSDSAVYYCALE
Cyprinus carpio V167 trav LHQP01018706.1 266082 NVDAEVITSFYTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIYYTESSSQSEPKLRLDAVADKGSKLMNLSISSTQMDDSALYYCALQ
Cyprinus carpio V166 trav LHQP01018706.1 267374 ESNGNVIRPNQPSVVLAEGSSTTLSCTYDGSAYSLHWYRQKPGSKPEFLLLIVRSTKTVVPASPPHTHMYIRLHDNKSVDLEISSAAVSDSAVYYCALE
Cyprinus carpio V165 trav LHQP01018706.1 269446 NADAEVIRPFLTEQYVLAGKDITLSCNYSGYVQNLQWYRQYPRSKPENIIFHTEGNHQSESKLRLYAVADKGIKLMNLSISSTKLEDSALYYCALEPTVTG
Cyprinus carpio V164 trav LHQP01018706.1 270459 NADANTINPLVPEKHITAGDNVTLSCKYSGTVNTLQWYRQYPGSRIEFLIFATELSGQSEHALRLSSTADRGNKQMHLNIFLTEMEDSAIYYCALVPTVTG
Cyprinus carpio V163 trav LHQP01018706.1 272227 TIKPLSLNENRHVGDNVNLSCSYKDYTGTVNNLQWYRQYPRSKPEFLLYIFQHGAMSDDRPPRFTAAVNQDNKQVDLNISSAVETDSAIYYCALV
Cyprinus carpio V162 trdv LHQP01018706.1 273159 NADANTINPLDPEKRVTAGDNVTLTCDYSGGVNTLQWYRQYPGSRIEFLIFVTELKGRSEPALRLSSVADERNKRMNLSIFQTEMEDSALYYCALV
Cyprinus carpio V161 trdv LHQP01018706.1 274469 CTEADTIEPLSLNEYRHVGDSVTLSCSYKEYTATVNNLFWYRQYPRSKPEFLLYILPQGLMSEDRPPRFTAAVNQDNKQVDLNISSAAETDSAIYYCALV
Cyprinus carpio V160 igkv LHQP01017526.1 156 SRGVTVTQPIVKTVQLGQTASIECSTDPGIYYSSLAWYQQKPGEAPKLLIYQINTLQSGTPSRFSGSGTSKGKDFTLTISGVQTEDTGDYYC
Cyprinus carpio V159 igkv LHQP01017524.1 671 SRGITVTQPKVKTVQLCQTSSIECSLDVGLTSIDLVWYQQKPGEAPKLLMYAIDCSWEHLDSVAVDLATEMILLYRNDTGDYYCQSYHYPNSKDV
Cyprinus carpio V158 trbv LHQP01015947.1 198 CVVCSPVIQQSPKHLLLRVEEKEAKFSCRHGDSSYQYLYWYQQKSNGGSLELIGMLNYGTAYQEEKFKSRFNITGHATKDAYMLISSISAEDSALYFCAAS
Cyprinus carpio V157 trdv LHQP01015227.1 25419 YGNEIKPTKTLEFADEGSSVKLSCSYSSAFNLHWYRQYPKSAPEFIMLISSSAKEAQESYVDSRFTAKVTTDKENLVDLEISSASITDSALYYCALEPTVTG
Cyprinus carpio V156 igkv LHQP01015124.1 5105 QITVTQSPSLITAAQGQEVRINCKTSSRVDEGNDLAWYLQKPGEAPKLLIYDATSRYTGTPSRFSGSGSDSDFTLTISGVQTEDTGDYYCMS
Cyprinus carpio V155 ighv LHQP01015078.1 23462 SHEEVQTPESLSVKAGESVSISCTGTSGVGNDMSWYLQKPGEAPKLLIYTASELESGVPDRFSGSGSEPDFTLNIRGVQSEDAGVYYCMGAYDGPV
Cyprinus carpio V153 ighv LHQP01014240.1 287268 SHEEVQSPESLLVKAGDSASISCTASFGIGYSLSWYLLKPGKTPKLLIYRTSNLASGVSDRFSGTYSGYVFTLNIRGVQSEDDGDYYCMGYYDGGV
Cyprinus carpio V152 trav LHQP01013758.1 1181 SVNQSTRVQTASEHEMVKLHCTYSTSDQYPSLYWYQHKTNGFPVYMLRKLSTGSSSSEKEFEERFYADLNKSSSSVSLSIQDLRVSDSAVYYCALQPTVTE
Cyprinus carpio V151 trav LHQP01013758.1 3486 ALSGNVITPDKTELFAEEGSNVTLSCSYSSADDLYWYRQYPGSAPEFIELIFDGATNTKKSEVDPRLSVKLTKQEQKHVDLKISSAAVSDSALYYCALR
Cyprinus carpio V150 trdv LHQP01013758.1 4856 DTLAQSITPQGNKTLAAVGQNVTLSCEYEGAITNLHWYRQYPRSKPEFLAWIYPQGATSNPLPPRIIPKVDKNLVSLEISDAEVTDSALYYCALT
Cyprinus carpio V149 trav LHQP01013758.1 5985 CDSLDSVEQKTRVQTAFEGETVTINCTYSTTDSFPYLFWYQQEIKGYPRYMLKKFPGSGEVDKQFEERFNANLNTSTTSVPLTIKNLRVSDSAVYYCTLRPTVTK
Cyprinus carpio V148 trgv LHQP01013758.1 8104 CWGQDSIDQPLREKTSAEGNQVILLCNYTLMRAANAYLYWYKQLPNRSPTFILSDFSIGKGTTEPEFKKRFYIKLDSTLGTVSLTIKNLCVSDSHVYYCALR
Cyprinus carpio V147 trdv LHQP01013758.1 9467 VMTADQIRPNQEISVIKEDATVTLSCSYDTTSSYVYWYRQYPNGELRYLIYKASWSSGGGGRPADPRFESTTSETSTELTITGVTLSDSALYYC
Cyprinus carpio V146 trdv LHQP01013758.1 10763 ATYGNQIKPNKTEEFADEGSSVKLSCSYSSALRLHWYRQYPGSAPEFIMLISDSAKEAQESYVDSRFSAKVTKVSKENHVDLEISSASITDFALYYCALEPTVTG
Cyprinus carpio V145 trav LHQP01013758.1 11971 VCFGDEITPDSTEKSAAVGSTVTLSCSYSSAESLQWYRQYPGSAPQFLVLIIESVKENKTSDVDPRFSTKLRKEKQATKEINRVDLIISYAAVSDSALYYCALR
Cyprinus carpio V144 trav LHQP01013758.1 14162 SSGQDRVKQSSGEMPESEGAQVILMCNYTTTSLSPDLFWYKQLPNRSPTFILNQYTTEPDFKYSATLNSTLRTFPLMIKNLLVSDSAVYYCALRPTVTE
Cyprinus carpio V143 trdv LHQP01013758.1 17106 ETFAQSITPLENKTLKSDGEKVTLSCKYDGAVNNLHWYRQYPGSKPEFLAFIYPHGATSNPLPDRLIPKVDNNNNLVSLEIYDAEVTDSALYYCALT
Cyprinus carpio V142 trdv LHQP01013758.1 19044 TSFADTIQPLSSEKYIVEGKNVTLSCNYSTSGTVNSLQWYRQYVGAKPKFLLFVDEYSSKFKTDLRLYSKATKEIKRVDLVIFSAAVSDSALYYCALRPTVTG
Cyprinus carpio V141 trav LHQP01013758.1 22843 AVFGNVIKPDQPDVFAEEASDITLSCSFSGAGASNNLYWYRQYGRSKPEFLVLTYSSAKEAQPSDVDLRFNVKVEKKEHVYLEISSAAVSDSALYYCALE
Cyprinus carpio V140 trav LHQP01013758.1 27513 IESQDSVEQKTRVQTAYEGGTVIINCTYQTTYPPTLFWYQQKVNKVPKYMLNRVGKTGDEDKEFKDRFNAYIDTSSKSVPLTIKSLSVSDSAVYYCALQTTVTE
Cyprinus carpio V139 trav LHQP01013758.1 29835 AVFGNVIKPNKIKIFAEEGSSITLSCSFSDSGGTDYLHWYRQYGRSKPEFLVLTYDTAKEAQPSGVDPRFIVNITKREQVDLKISSAAVSDSALYYCALQPTVTG
Cyprinus carpio V138 trav LHQP01013758.1 36396 KVDQHTRIQSAFEGDSVTINCTYQTTVTNPTLFWYQQKVSGIPKYMLNKFSKSGNSEEEFKERFHANLSTTSVPLTIQDVRVSDSAVYYCALQPTVTE
Cyprinus carpio V137 trav LHQP01013758.1 39086 AVFGNVIKPNKTTVVYEEGSNIILICSHSPGNSDYLHWYRQYGRSKPEFLVLTYGSSKEAAVSDVDPRFTVKVEKREQNHADLNISSASVSDSALYYCALA
Cyprinus carpio V136 trav LHQP01013758.1 47395 CRSEDKVDQPDKHVTTAGGKSVTLNCIYTTTSAQPYLFWYIQRANDLPRYILRREKFGIGENGTEFHERFHSEVSSNSVPLTIKNLRVSDSAVYYCALR
Cyprinus carpio V135 trav LHQP01013758.1 56284 CRSEDTVDQPDKHVTEVEGRSAELKCKYKTDSIQEDLFWYIQRANDFPKYILRRNKYGGDNGTEFQERFHSKLSSNSVPLTIKNLRVSDSAVYYCALR
Cyprinus carpio V134 trav LHQP01010718.1 2084 AVFGNVIKPNKTDVFAEEGSSVTLSCNYSASGGNDYLHWYRQYGRSKPEFLVLTYSSAKGAKESDVDPRFTVNNTKKQQVDLKISSAAVSDSALYYCALQ
Cyprinus carpio V133 trav LHQP01010718.1 4183 VVFGNNISPETTDVGAVEGQKATLSCSYSSSGGTENLFWYRQYGRSKPEFLVATYSTAKESEVSGVDSKFSVKVTKKEQIHVILEISSAAVSDSALYYCALR
Cyprinus carpio V132 trav LHQP01010718.1 5194 TVSQPERHQTELEGNSVTLNCKYSSASTAPDLFWYIQRANDIPKYILRRDKFETGETDTEFQERFHSKLSSDSVPLTIQDVRVSDSAVYYCALR
Cyprinus carpio V131 trav LHQP01010718.1 6090 QDNVMQSKPVMTAYEDGTATLDCTYKATSTQYPNLLWYQQKTNGSPKYMLIRSSGSSSNDEEFKDRFNANLNTSLKSVPLTIKDVRVSDSAVYYCALQPTVTE
Cyprinus carpio V207 trav LHQP01030582.1 15320 CQSEDTVDQPLHVSEFEGESVTLDCKYTTTSQSQELFWYIQRTDESPKLVLQRNSYGGGINGTEFQERFYAEVKPSKSVPLIIQRLRVSDSALYYCALR
Cyprinus carpio V206 trav LHQP01030582.1 20315 DTVDQPDKHVTEPEGGSVALQCKYTATTTTPELFWYIQRAHYIPKYMLRKNKHGGDQGTEFQERFHSEVSLDSVALTIQNLRVSDSAVYYCALQ
Cyprinus carpio V205 trav LHQP01030582.1 26875 CRPEDTVDQPDKHVTEAEGGSVALQCKYTATTTTPELFWYIQRANEIPKYMLRKNKYGGDQGTEFQERFHSEVSSDSVPLLIKNLRVSDSAVYYCALQ
Cyprinus carpio V204 trav LHQP01030582.1 34124 KVEQPSRKMTANEADQIYLMCNYSTSSYNDAYIYWYKQLQNRSPTFILSEFTVGKGTTEDEFKERFSATLNSTYRTGPLMIKNLRVSDSAVYYCALRPTVTE
Cyprinus carpio V203 trav LHQP01030582.1 40690 SSGQDRVEQFYREMTTSEGDQVIVRCNYTTTDTNPYLFWYQQLPNKSPTFILNKFTFGDGNTEPDFKKRFSATLDSTSRTVPLMIKDVRVSDSAVYYCALRPTVTE
Cyprinus carpio V202 trdv LHQP01030582.1 47165 AAYGNEIKPNKTEEFAEEGSSVKLSCSYSSAYYLHWYRQYPGSAPEFIVLISDSAKEAKESYVDSRFMTKVSKGKENHVDLEISSASITDSALYYCALEPTVTG
Cyprinus carpio V201 trav LHQP01030582.1 48158 CCGQDMVEQPSEEMTESEGAQVILMCNYSSTNPDLFWYKQLPNRSPTFILNQYTTEPDFKRFSATPDSTSRMFPLTIKNLRVSDSAVYYCALR
Cyprinus carpio V200 trav LHQP01030582.1 49323 AAYGNEIKPTKTEVFAEKGLSVKLSCSYSSAFNLHWYRQYPKSAPEFIVLVSDGAKEAQESYVDSRFTAKVTTDKENHVDLIISYAAVSDSALYYCALT
Cyprinus carpio V199 trav LHQP01030582.1 50182 DSVDQPEKHIAEVEGKSVTLKCKYKTALSQPELFWYIQRANDFPKYILWRNKIGTKDNDAQFQERFQSEVSSDSVPLTIKNLRVSDSAVYYCALRPTVTE
Cyprinus carpio V198 trav LHQP01030582.1 53124 VSFGDEITPDSTEESTAVGSTVTLSCSYSSAHSLQWYRQYPGSAPQFLVLIMESVKENKTSDVDSRFSTKLRKEKQVTKEINRVYLMISSAAVSDSALYYCALR
Cyprinus carpio V197 trav LHQP01030582.1 54738 SSGQDRVEQSLGEMTESEGAQVILMCNYTTTSTSPYHFWYKQLPNRSPTFILNQYTTEPDFTKQFSAKLDSTSRKFPLKIKDVRVSDSAVYYCALRSTVTE
Cyprinus carpio V196 trav LHQP01030582.1 57669 AVSGNIITPDKTELFAEGSNVTLSCSYSSADYLYWYRQYPGSAPEFIELILDGTTSPKKSEVDPRLSVKLIKREQKHVDLEISSAAVSDSALYYCALR
Cyprinus carpio V195 trav LHQP01030582.1 58729 CRSEDAVHQNLKVQTAVEGAAVTINCSYTTTDPSPTLFWYQQKVNGFPEYMLNRLATYGNNEEEFKKRFNASLNTLTKSVPLTIQNLRCDSAVYYCALR
Cyprinus carpio V194 trav LHQP01030582.1 61212 RVKQPSGEMTANKGDPVTLQCNYSTTTKNAYLFWYKQLPNRAPTFILSEFTVGKGTTEDKLDERFSATLDSTSRTVPLTIKNLRVSDSAVYYCALR
Cyprinus carpio V193 trav LHQP01030582.1 70183 TSFADTIQPLSLEKYVVEGKNVTLSCNYSTSTGNVNSLQWYRQYVGAKPEFLLQVNEYSTKSEPDLRLYSKATKEIKRVDLEISSAAVSDSALYYCALQ
Cyprinus carpio V192 trav LHQP01030582.1 76686 TSFADTIQPLSSEKDVVEGKNVTLSCNYSTSGTVNSLQWYRQYVGAEPEFLLLLDEYSTKSKPDLRLYSKATKEIKRVDLEISSAAVSDSALYYCALQ
Cyprinus carpio V191 ighv LHQP01030202.1 315 CWCQTLAESESVVIKPGGSHKLTCTFSGFSSDPSLAWIRQTAGGGLEWLAYISSDGTIYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARQ
Cyprinus carpio V190 ighv LHQP01030202.1 1246 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGAADISWIRQAEGKALEWISHISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTNMQAEDTAVYYCARK
Cyprinus carpio V189 trav LHQP01029437.1 1775 VSGVIVVTQNPPVLTLSTGQTATLDCNLDTVTDSGARWYKQIHGGVPQFVLYFYHPNSSPTYGSGYSSPKFNSNHKTKSDYSLIISSVDVDDSAVYYC
Cyprinus carpio V188 igkv LHQP01026407.1 1924 SAAEVTITQTPAVKPVQPGDTVTMSCKTSPEVQQGWSYEPLAWYLQKPGEAPKLLIYKTNVRWSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Cyprinus carpio V187 igkv LHQP01023479.1 4281 SAAEVTITQTPAVKPVQPGDTVTMSCKTSPEVQQGWSYEPLAWYLQKPGEAPKLLIYKTNVRWSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Cyprinus carpio V186 trbv LHQP01021800.1 9983 FSDGVLITQWPKYISSRSGSSVEMHCYQNDTDYNFKYWYRQIKGEGPVLIGSYNFNSPSKEEGFENGFNFSGTETKKWTLTVDVKKGIDAVYLCAAS
Cyprinus carpio V185 trbv LHQP01021800.1 13231 MVRCVNVQQNMTPLLFRENKTAELMCNYDDSGKPNMLWYQQKNTAMALIVFSYGADSEPTYEDGFKERFKLERKNTLNGVLKIPDLSLSDSAVYFCAVS
Cyprinus carpio V184 trbv LHQP01021800.1 18501 ISLGSSIDQPADMMKHQGNTVNISCTHTYSSFYYLYWYQRTTQEESFKLLGYLYLQKFNPEKDYDRFHIYGNSQTHGTLQISTVTSEDSAMYFCAVS
Cyprinus carpio V183 trbv LHQP01021800.1 19710 CVVCSPVIQQSPKHLLRRVEEKEANLSCHHGDNDYPYLFWYQQKSNGGSLELIGMLSYGADSEEDKFKSRFDIPGHAKEDAFLLISNITAEDSAVYFCAAS
Cyprinus carpio V182 trdv LHQP01020814.1 90272 DASSEGIAPVSPKEFVSEGNAITLSCNYNGSANIDALHWYRQYPRSRPDFLFLVNEAAFMQTADPPIAGISARLNEEKNRVHLEITGTALTDSALYYCALQ
Cyprinus carpio V181 trav LHQP01020471.1 1426 PVGSVQQSPSNLIKSERDNAELVCEHNIASYTIILWYKQTQANHGFTLLGYIWNKNYFPEDNFMQKIDLDGDGTKMGSLKIKALEASDSAMYYCAAS
Cyprinus carpio V180 trbv LHQP01020469.1 923 SILGKSVVQTPSELLKKKDEFAEIKCSHNIQSYYITQWYKQSQSIMELQLMGNINVKQKTIEPEFNGKIKLDGDGRNNVTLTIDTLILNDSAMYFCAAY
Cyprinus carpio V179 trbv LHQP01020469.1 5402 STLSDKVFQEPRNMIVDIKDSPVLQCSHSISGYDRILWYKQTQDGQLVFLGYLLGLNDLLEPEVKNKFKLDGNGNNNGKLVIKSLDFNDTATYFCAASTQCHTSV
Cyprinus carpio V178 trbv LHQP01020469.1 12944 ANHAKTVLQSPNDLLKNQNESAVIICSHKIQDYNRMLWYKQSQDMPGLRFMGYLFTNENIEPEFINKIQMQGDATENATLTINNLTPQDSAVYFCAAY
Cyprinus carpio V177 trbv LHQP01020469.1 14208 ACLGKTVLQTPGDILTKKDESAVITCSHKIQSYDRILWYKQSQDSLGLKLMGYLYVDSKNKEPGFENKINLEGNGRNKGILTLSNLTLTDSAVYFCAAY
Cyprinus carpio V175 trbv LHQP01020469.1 16593 ACFGKTVFQSPGDLIKNQDESAVITCTHNIAGYDRILWYKKDIMGFKFMGFLNLKYDNPELEFKNKIKLDGDGQKNGTLIISNLTLTDSAVYFCAAY
Cyprinus carpio V174 trbv LHQP01020469.1 17350 SVFSTKVHQSPSVLFKTKGDDAQLECQHSISSNNVILWYKQTPGQGLILLGHLMMQTGQREDDFIAKVELKGDATKSGSLTIKDLSDNDSAVYFCASS
Cyprinus carpio V173 trbv LHQP01020469.1 19391 VNSLGKTVLQTPNDLLKRQDESAVITCTHKIQSYDQILWYKQSQDSLGLKLMGYLQYNNKYPEPEFENKIKLEGEAKTNGNLTINNLTLTDSAVYFCAAYYTVLR
Cyprinus carpio V172 igkv LHQP01019303.1 7437 QITVTQSPSITAAQGQEVRINCKTSSNVYSDSNGSRMGWYLQKPGEAPKLLIYKVNSLQSGTSSRFSGSGSNSDFSLTISGVQTEDTGDYYCQS
Cyprinus carpio V171 trav LHQP01018706.1 254459 TAGEDVIKPVFTQMHVLEGKDVTLICNYTEAVNNLQWYRQYPGSKPEHLIMFFETIPKSEDALRLTAAADKAAKSMSLTISSTEVKDSAMYYCALV
Cyprinus carpio V170 trav LHQP01018706.1 256784 TAGEDVIKPVFTQMHVLAGKDVTLICNYTGSVQNLQWYRQYPGSKPEHLILNIESIPKSEDALRLTAAADKATKSMTLTISSTEVKDSAMYYCALV
Cyprinus carpio V246 trbv LHQP01049703.1 418 DFSDGVLITQWPKYISSPPETSVEMHCYQNDTDYDYKYWYRQIRGEGLVLIGSYNFNSPSSEKGFETGFTMSGTETKKWTLTVDVKEGIDAVYLCAAS
Cyprinus carpio V245 ighv LHQP01049648.1 2133 VHCVELTQTDSVVLSPGQVLTLSCKLYGYSVTDSSYWTHWIRQPAGKALEWVGDIGSSGDTYYSDKLKSRFQIGRDISSNTVTLRGQNMQTEDTSVYYCARER
Cyprinus carpio V244 ighv LHQP01049648.1 3807 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYATGWIRQPEGKALEWIGLIDSDGDLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Cyprinus carpio V243 trav LHQP01047768.1 25 KVEQPSRKMTANEADQINLMCNYSTSSYNDAYLYWYKQLQNRSLTFILSEFTVGKGTTEDEFKERFSATLDSTSRTVPLMIKNLRVSDSAVYYCALRPTVTE
Cyprinus carpio V242 trav LHQP01046317.1 2377 AVFGNVIKPNKTDVFAEEGSSVTLSCNFSASGGNDNLHWYRQYGRSKPEFLVLTYINAKEAEVSKIDPRFSVNIPKSEHVDLKISSAAVSDSALYYCALV
Cyprinus carpio V241 ighv LHQP01043760.1 2903 VVKRPGESFRLVCTSSEFSFSSCAAAVVREIPGKGLEWIAFIHVSSSYIFYSQSVQGRFTVSRDDYKGQLYLQMNSLKTEDTAVYYCAV
Cyprinus carpio V240 ighv LHQP01043760.1 11466 IECQTFTQSEAVVKKPGESHKLTCTITGFTFSSLVLSWIRQSPGKGLEWIAFIHTASSPIYYSQSVQGRFTISRDDSSSQLYLQMNSLKTEDTAVYYCTRE
Cyprinus carpio V239 ighv LHQP01042966.1 12322 VSGISLTSSPAQTKAPGQSVRLSCQISGYALTDLGTAWIRQPPGKAMEWIGIIWGSGSIASGNSFKSRFTISRDTGRNELYLDISSLQTEDTAVYYCAKTQ
Cyprinus carpio V238 ighv LHQP01042966.1 13482 VECNIVLTQTNSIVLQPGNSFTLTCEVSGYSVTDNSYATAWIRQPAGKALEWITEIWGGGSIYKKDSLSNKFSISKIDSSNTVTLKGQNLQTEDTAVYYCARQ
Cyprinus carpio V237 ighv LHQP01042966.1 14563 CWCQTLTESESVVIKPGGSHKLTCTFSGFSSDPRLAWIRQTAVGGLEWLAYIYSDGSSYIFYSQSVQGRFTISRDNSNKQVYLQMNNMKNEDTAVYYCIRETQ
Cyprinus carpio V236 ighv LHQP01042966.1 18322 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGDAHISWIRQAEGKALEWISYISAPSGSSKYYSKTVEGRFTISRDNSKIQVYLHMTNLQTEDTAVYYCARK
Cyprinus carpio V235 trav LHQP01042164.1 2863 CDSLDNVEQKTRVQTAVEGETVTINCTYSTTDSFPYLFWYQQEINGYPRYMLKKFPGSGEVDKQFEGRFDAKLNTSRTSVPLTIKKVCVSDSAVYFCALRPTVTE
Cyprinus carpio V234 trdv LHQP01042164.1 4018 ETFAQSITPQESKALKYEGEKVTLSCKYDGAVNNLHWYRQYSGSKPEFLAYIYPNGDTSNPLPDRLIPKVDKNKNLVSLEISDAEVTDSALYYCALS
Cyprinus carpio V233 ighv LHQP01041899.1 2569 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSVSSYWMHWIRQKPGKALEWIGFIDTGTSTTFAQSLQGQFSITKDIGNNMLFLEVKSLKTEDTAVYYCARD
Cyprinus carpio V232 igkv LHQP01041032.1 2433 QYTVTQSPSLITAAQGQEVRINCKTSSSVCGSNNLYWYLKKPGEAPKLLIYYATYRYTGTPSRFSGRGSNTDFTLTISGVQTEDTGDYYCQS
Cyprinus carpio V231 ighv LHQP01039912.1 7415 VTLTQLKVKTVQQGQTATIECHIDVKISSNGLAWYQQKPGEAPKLLIYHINTLQSGTPSRFSGSGSYSGSDFTFTISGVQSEDTGDYYCQS
Cyprinus carpio V230 trbv LHQP01039465.1 1746 LCMMLHVTQTPTDLFLVNGATMNLTCSHNDKSYDKIFWYQQFNRQNLEHLGFLSFKQPLVDKEGFTITGDAEKEAYLLVSSVKAEHSAVYLCAVS
Cyprinus carpio V229 trgv LHQP01039465.1 3039 FSVNSAIKQTPSDLLSKNNVESVTLHCSHTNPSFNVILWYKQPLSGEMQLMGYLYRTNNNSEPVFNEKIEILGNGASKSHLILKKLSSDDNAIYYCAAR
Cyprinus carpio V228 trav LHQP01039465.1 12506 CLICEKVHQTPSDVLCKPKDSVSLTCKHKINNYDTILWYQRSYGDSSLKLIGYARYNSLKEIEASYKDNFNVTGNGEEEVTLKIHQARPDQDSAEYFCAAYYAQ
Cyprinus carpio V227 trbv LHQP01039465.1 13939 HLLSSVDQTPSEVIVHSGQACTLSCSHSISSYNTILWYYQHEHGQGMHIIGYTFHSTHNLENADDKKYKLKGDAKSSVNLTISELTFKESAVYFCAAS
Cyprinus carpio V226 trbv LHQP01039465.1 15010 CSYTYTVDQSPPDVIKKPKESAKIQCSHNVPNYNQISWYRQNQDQGFTFMGYLFLKSQNPEKEFTKKIEMSGEGNSNGYLTIEDLSSNDSAVYFCAAC
Cyprinus carpio V224 trbv LHQP01039465.1 32156 SSHSNTVDQSPPDVIKKQGESAEIQCSHNVPGYNQINWYRQNQRQEFTFMGYLLLTDPTPEKEFTTKIEMSGIGNRNGAVTIKNLSSDDSAVYFCAAY
Cyprinus carpio V223 trdv LHQP01038667.1 813 YGNEIKPTKSLKFIDEGSSVKLSCSYSSALTLYWYRQYPGSAPEFIVFISDRSEQAQESNVDNRFTAKVTKDKESHVYLEISSAAVSDSALYYCALQ
Cyprinus carpio V222 trav LHQP01038667.1 7552 ATHGNEIKPTKTLEFADEGSSVKLSCSYSSALTLYWYRQYPGSAPQFIVFISDGSKQAQESNVDSRFTAKVTKDKESHVDLIISSAAVSDSALYYCALQ
Cyprinus carpio V221 trav LHQP01038667.1 8652 KVEQASRQMTADEAARVTLLCNYSTSFTNAYLFWYKQLPNRSPTFILSEFTVGKGTIEDEYKDRFSVTLDSISRTVPLMIKNLHVSDSAVYYCALRPTVTE
Cyprinus carpio V220 trav LHQP01036028.1 912 AVFGNVIKPNKTDVFAEEGSSVTLSCNFSASGGNDYLHWYRQYGRSKPEFLVLTYSKAKQAEVSKIDPKFSVNIPKSEHVDLEISSAAVSDSALYYCALA
Cyprinus carpio V219 trav LHQP01036028.1 5516 AVFGNVIKPNKTDVFAEEGSSVTLSCNFSASGRTDYLHWYRQYGRSKPEFLVLTHSKAKQAEVSKIDPRFSVNIPKSEHVDLKISSAAVSDSALYYCALA
Cyprinus carpio V218 trbv LHQP01034716.1 1244 MVRCVNVQQNMTPLLFRENKTAELMCNYDDSGKPNMLWYQQKNTAMALIVFSYGADSEPTYEDGFKERFKLERKNTLNGVLKIPDLSLSDSAVYFCAVS
Cyprinus carpio V217 ighv LHQP01033400.1 6290 VYSSVEHIQPSSLLVKPGESFTISCKISGYALSDSSKAPSWIRLNQGKILEFIGMIHAGGGIDYKDSLKNKFIISRETSTSTVYLKGQNLQTEDTAVYYCVR
Cyprinus carpio V216 ighv LHQP01033400.1 11632 CWCQTLTESESVVIKPGGSHKLTCTFSGFSSDPRLAWIRQTAGGGLEWLAYISDGGGTTYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Cyprinus carpio V215 ighv LHQP01033400.1 25156 CWCQTLTESEAPVMKPGESHKLTCTASGLDIAGYWMAWIRQKSGKELEWLALIRSDSQSIYYSQSVQGRFTISRDNSRKQVYLQMNSLKNEDTAVYYCAR
Cyprinus carpio V214 trbv LHQP01030863.1 1003 SSDVTQTSTLWVSQGESARMECNHTKGGFYRYMYWFRQRQRETMRLIAFTMPDVKPDFGEYSDDKYSAEKTVAESGSFTVNKLQPDDSGVYFCAVS
Cyprinus carpio V213 trav LHQP01030863.1 2738 SSDVTQTSRLLVEQGESAVMNCSHTKGEDYWYMYWFRQRQGETMRLIAFIMINQKPDFGEFSEDKYSAEKTVAERGSFTVNKLQPDDSGVYFCAVSKHS
Cyprinus carpio V212 trdv LHQP01030582.1 1458 SDVITPKRDKEFALEGDNVTLSCNYSGSVRGVHWYRHYAGSPPQFLILEYSEVTTLANPPVPGITINHRKTESHVDLEISSAAVSDSALYYCALQ
Cyprinus carpio V211 trav LHQP01030582.1 3416 VSFGNVITPVQTEVFWTEGRNITLSCNYSSAISLQWYRQYHGSAPEFLLIILHGTGKVSQKSNIVETDPRFSGKLNEKKTRVELDISSAKVTDSALYYCALE
Cyprinus carpio V210 trdv LHQP01030582.1 5631 GFADRIGPREGDTNIIREEGESVTLSCTYETTSNNIWLFWYRQYPNREPEYILYKGARSWSSENIPDGFQSTTSWSSTELTILKAALSDSALYYC
Cyprinus carpio V209 trav LHQP01030582.1 9211 SVNQPKSFQSYEEDDAVTLDCKYNTTSQNPTLLWYRQNSHDSPPKYILRRHKFGDGDEAIEFKGRFHSRHDSTSRSVPLTIQNPRVSDSALYYCALQ
Cyprinus carpio V276 trav LHQP01078361.1 316 AVFGNVIKPNNTNVVYEEGSNVTLFCIHSPAANDYIHWYRQYERSKPEFFVLTHGSAKEAEVSDVDPRFSVKVEKRDKIHVDLKITTAAVSDSALYYCALR
Cyprinus carpio V275 igkv LHQP01077453.1 81 VTLTQPEVKTVQQGQTATIECNIDVGILGSYLAWYQQKPGEAPKLLIYYINRLQSGTPSRFRGSGTASTGKDFTLTISGVQTEDTGDYYCQS
Cyprinus carpio V274 ighv LHQP01076764.1 638 VYSQVVLTQSEQSVTVSPGGSYKLTCACSGFTLSGYRMDWIRQASGKGLEWILHYYTDSDKGSAQSVQGRFMASKDSSNFYLHMSQLRTEDTAVYYCARD
Cyprinus carpio V273 ighv LHQP01076764.1 2002 LFCIELAQPPVMVVQPRETFTIACKITGYSVSGGGYTNWIRHSSGKPMEWIGYSSSTNYVIDSLQINKISFSAESSSKAVILTGKNFNTEDIAVYYCACY
Cyprinus carpio V272 trav LHQP01070371.1 1018 MVRCVTVQQNPTSMLANKTESAVITCSHDDNNMDYMLWYQQKDTAMVLIVFNYGATGDPSYEDEFKDRFKLERKHTLNGALKISNLSLSDSAVYYCAVS
Cyprinus carpio V271 trav LHQP01070371.1 3516 RCVNVQQNLTPLLVNKNDKAEITCKYDDSGKPNMLWYQQKDTAMALIVLSYSAGSDPIYEDGFKDWFTLKRTETLAGVLKISNLSLSDSAVYYCAVS
Cyprinus carpio V270 trav LHQP01069263.1 2439 VSFGNVITPVQTEVFGTEGVNITLSCNYSSAISLQWYRQYPGSAPEYLLVIFHATGKVSQKSKIVEIDPRFSGKLNAKKTHVDLEISSAKVTDSALYYCALT
Cyprinus carpio V269 trdv LHQP01069263.1 8426 FFADRVGPREGDTNIIREEGESVTLSCTYETNSNDIWLNWYRKYPNREPEYILYKGARSKSSEEDIPDGFQSTTSQSSTELTILKAALSDSALYYC
Cyprinus carpio V268 trgv LHQP01069263.1 10080 SVFANAITPFFTEKHAFEGEKATLSCNYSGSNIQVLQWYRQYPNTAPEFLLQAFESLGPEQKDRHVAKAQKDKKHLNLEISETKVADAAIYYCALV
Cyprinus carpio V267 trdv LHQP01069263.1 12060 KSFAQSIAPLQTTERATERETVILSCKYDSQARNLQWYRQYPGSRPEFLLLVYESNSVLHAEPPFPRLNASVNKEGKWVYLEISSVAVTDSALYYCALE
Cyprinus carpio V266 trbv LHQP01068531.1 879 SSDVTQTPVLWVSQGESAQMNCSHTMGVGYNYMYWFQQRKGETMRLIAFTMLGSKPDFGEFSVDKYSAEKTVADKGSFTVKKLQPDDSGVYFCAVS
Cyprinus carpio V265 trav LHQP01065383.1 1826 VRCVKVFTQKPAILTEQKGRSVTMDCNIEKDERNSVSWYKQIPNAAPQYVLRYYHSNSDPYYGDGFSSSRFTSKAPSNIDYQLIISNVDVTDSAVYYCKTYD
Cyprinus carpio V264 ighv LHQP01065012.1 1024 VYSIELNQPDSKEIKPGQPLSLSCKVSGYSLSSCSYCTNWIRQASGGLEWIGRVCCSGGTDYSEKLKNKFSISRDTSSSTVTITGQNMQTEDTAVYYCARESQ
Cyprinus carpio V263 trav LHQP01063607.1 648 SSGQDRVEQSSGEMTASEKDQVIVGCNYFTTDRNINLFWYQQLPNKSPTLILNKLPFGEGTTEPDFKKRFSATLNSTTKTVPLMIKDVHVSDSAVYYCALRPTVTG
Cyprinus carpio V262 trav LHQP01063327.1 537 MVRCVTVQQNPTSMLANKTETAVITCSHDDNNMDYMQWYQQKDTAMVLIVLSYGATGGDPSYEDEFKGRFKLDRTATVNGVLKISNLSLSDSAVYYCAVS
Cyprinus carpio V261 trav LHQP01062614.1 258 AISGNITPDETELFAEEGLNVTLSCSYSSADYLYWYRQYPGSAPEFLVHVLDGATNTKKSDVDPRLSVKLTKREQKHVDLIISSAAVSDSALYYCALR
Cyprinus carpio V260 trav LHQP01062613.1 10821 RVEQPLGEMTAIKGDLVTLQCSFSATTTNAYLYWYKQLPNRSPTFILSEFTIGKGTTEDEFKERFYATLDSTSSTVPLTIKNLRVSDSAVYYCALQPTVTE
Cyprinus carpio V259 ighv LHQP01061639.1 2571 CRSQTLVESDAAVIKPGESHKLTCTASGFNFGGSWMAWIRQATGKGPEWVATLSDGNSYIYYSDKVKGRFTISRDDNKNQLYLQMSSLKTEDTAVYYCAR
Cyprinus carpio V258 ighv LHQP01061639.1 3795 AHGQSLTSSGSEVKKPGESVTLSCVASGLSLSWLHWIRQKQGKGLEWIGRIDDGTGTIFAQSLQGQFSITKDTSKNMVYLEIKSLKTEDTAVYYCARESQ
Cyprinus carpio V257 trav LHQP01061102.1 109 GCFAQTITPLQDRTQVTEGNPVNLSCKYDVSVQNLLWYRQYPGSGLEFLLLVVESPKKNVVYADPPIPRLDGELSMKDKQVDLEISSAEVTDSALYYCALR
Cyprinus carpio V256 trav LHQP01061102.1 1424 NILTNMITSHDSQKQVLEGKNVTLTCNYSGVPDNLHWYHQYSRSTPKFLLYIYESRLMSYNIPQRLTPRVNKNTKQVDLEMSSAGVSDSAVYYCALR
Cyprinus carpio V255 trav LHQP01057881.1 1321 GRFESPITSDQTEVFDEEGANITLFCSYSTAISLYWYRQYPRSVPENLLLILQTSGRVQSTENLDSRVSVRLNEKKNRVALIISSVKVTDSALYYCALE
Cyprinus carpio V254 trdv LHQP01057881.1 4900 GSFANVITPVQTEVYKKERENVTLSCNYSSASTLQWYRQYPGSAPEFLMLILHSTGKVSQKSEIVDRDPRFHGKVNEEKTHVILEISSAKLTDAALYYCALM
Cyprinus carpio V253 trav LHQP01057881.1 5917 GTFATDITPVQNEMFHSEGANITLSCNFSSAYTLQWYRQYPGQAPKYLIVILYSTGKVSQRSEIVDQDPRFSGKLNDKKTHVDLEISSAAVSDSALYYCALQ
Cyprinus carpio V252 ighv LHQP01055354.1 3830 GVFCVELTQPPSMVVKPQELFSISCRISVSSYCIHWIRQPTGKALEWLGYLCSSGGTNIKDSVKNKISFTQDTSKNTVFLQGNNFQTEDTAVYYCARE
Cyprinus carpio V251 trav LHQP01053238.1 267 AVFGNVIKPNNTDVVYKEGSSVTLFCSHSPGATDYIHWYRQYERSKPEFLVLIYSSAKKAEVSDVDPRFSVKVEKREKIHVDLKITTAAVSDSALYYCALQ
Cyprinus carpio V250 igkv LHQP01052438.1 708 VTVTQPKVKTVQHGQTASIECSTDPGIYSNYLAWYQQKPGETPKLLIYYINTLQSGTPSRFSGSGTSNGKDFTLTISGVQTEDTGDYYCQS
Cyprinus carpio V249 trav LHQP01051976.1 13710 TMHGNEIKPTKTLEFADEGLSVKLSCSYSSAYRLLWYRQYPGSAPQFIVFISDGSKQAQESNVDSRFIAKVTKDKESHVDLKISSAAVSDSALYYCALE
Cyprinus carpio V248 trav LHQP01051976.1 14668 SSGQDSVEQSSREMPANEGAQVIVMCTYTTSGTPDLFWYKQHPNRSPTLILSQYTTEPDFKKRFSATLNSTSRTFPLMIKNLHVSDSAVYYCALRSIVME
Cyprinus carpio V247 trav LHQP01051976.1 18147 SSAQVSVEQSGEMTESGGDKVILMCNYTTTSTTHYLFWYKQLPNRSPTFILNQNTTEPDFTKRFSATLDPTSRTFPLMIKDVRVSDSAVYYCALR
Cyprinus carpio V225 trbv LHQP01039465.1 20970 FSLSNKVDQTPSDVIETQGETAKIQCSHSVPSYDQINWYRQNQDHGFTLMGYLVGTEPYKENDFKDKIEMSGDGNNNGYLNIKSLSSNDNAVYFCAAY
Cyprinus carpio V208 trav LHQP01030582.1 11874 CDSLDSVDQNTRVQTAVEGKSVTINCSYETSDLSPYLFWYQQKMNGIPKYMMMIFATTVQNDKNFEDRFIVNHNKTSKSVPLTIQDVRVSDSAVYYCALRPTVTE
Cyprinus carpio V176 trav LHQP01020469.1 15502 SAVNGSVNQSPSNLIKSERNNADLVCDHNVLSYDMILWYKQTLGHDFTLLGYTWNKNSVPEDNLKEKIKLDGDGTKNGSLKIKDLEASDSAMYYCAAS
Cyprinus carpio V169 trdv LHQP01018706.1 258763 TAGENVIKPVFTEKQDLEGKDVTLICNYTEAVNNLQWYRQYPGSKPEHLIMFFETIPTSEHALRLTAAADKAAKSMTLTISSTEVKDSAMYYCALV
Cyprinus carpio V154 igkv LHQP01014506.1 16253 QILTQSEDQTVNPDQTVTIHCKQTPAVVCRKKDTSLYCMSWYHQIPGEAPKLLTYYTSERASGVSSRFSGSESGNHMDFTLTISGVQPEDSGVYYCQSQHDKGVSG
Cyprinus carpio V130 trbv LHQP01010204.1 35259 SSSDVDVVQEDNVKIVRAGEDVNLTCTFSSLLQTTTAWFKQTADGKSLQIVSFYIKLQPSWNKEFEKANRFIVIKGDGHFNLTILKTKSSDSARYFCVVS
Cyprinus carpio V125 ighv LHQP01008900.1 624 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSMSGYWMHWIRQKPGKALEWIGQISGSTVYYAQSLQGQFSITTDTSKNMLYLEVKSLKTEDTAVYYCARESL
Cyprinus carpio V92 trdv LHQP01069150.1 2695 GIAPLSSSKLANNGDSITLTCNYNGSYSSDSLLWYRQYSSSKPQFLFLVSESALEQPADPPIPGVTAKVNDEKNSVDLKISSASVSDSAMYYCALQ
Cyprinus carpio V84 trdv LHQP01056446.1 15747 AVLGNVIKPEQLDVFAEEGSSVTLSCSFSASGRTDYLHWYRQNGRSKPEFLVLTYSNAKEAQQSDVDPRFSVNISKSQYVDLEISSAAVSDSALYYCALV
Cyprinus carpio V53 trbv LHQP01027862.1 35764 ANHAKIVLQRPDDLIKNQNESAVIGCSHNIQRYDQMLWYKQSQDMPGLKLMGYLYVGENIEPEFKDKIKLKGDASKNGTLTIKNLTSQDSAVYFCAAY
Cyprinus carpio V39 trav LHQP01018315.1 21545 AEIEPLSLNENKRVGDSITLSCSYKDYSGTVNNLQWYRQYPRSKPEFLLYIFQHGAMSEDRPPRFTAAVNKDNKQVDLNISSAVETDSAMYYCALR
Cyprinus carpio V2 trav LHQP01001506.1 52741 CNSQSQDKVDQHTRIQFAFEGDTVKIDCTYQTAYSGPTLFWYQQKGNGNPKHMLNKFSKSGNSEEEFKERFHANLSTTSVPLTIKNLRVSDSAVYYCALRPTVTE