WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Morone saxatilis JTCL00000000.1 (JTCL01) 9 1 0 1 0 7 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Morone saxatilis V8 trbv JTCL01034895.1 732 SSLSEKVHQSPTDMFTNQGETAKIQCSHSIEGYDRILWYKKTDGQLQLLGYMNLNTGYPETGVNVKIDGNANKDQTCTLTTERLNSSAVYFCAAS
Morone saxatilis V7 trbv JTCL01034895.1 2636 LIDGSDVTQTDTLWKNERDSATIDCRHTKGVHYYQMYWYRQLPGEGMKQIVFTTTTPPHKYESGFSEDKFPAQKNDPQTGSLTVEKLLPEDSGVYFCAVS
Morone saxatilis V6 trbv JTCL01008446.1 729 LIDGSDVTQNDTLWKYKGDSATIDCRHTKGVDYNYMYWYRQLPGETMKQIVFTSINSIDFGNFSTEKFSATKPDAASGTFTVNNLEPEDKGLYFCAVS
Morone saxatilis V5 trbv JTCL01004748.1 61498 SSVGVKVHQPSLGFSREGDPAVTLQCEQDDEQYFYMFWYRQGSSGDMQLVSYSLSKGSCRVEAPFNTTKYTMSRPTLLNSSLQIHSVKAADSAVYYCASSR
Morone saxatilis V4 ighv JTCL01025081.1 1128 VNSIDLIQPDSMVVQPGQRLTITCQVSGYSLTDNSYATGWIRQCEGKPMDWISHQWGGGDFYQNNALKNKFSYSRDTSTRTVTLTGQNVQPEDTAVYYCVRR
Morone saxatilis V3 trbv JTCL01016459.1 36183 LLKTSVRQNPPAMFKDPGEEVLMNCNHSNTDFNMIQWYKQSVHSSEMTLIGFVRYDSATIESPFKKIYNVNGDGRSLSSLHTQTAKGTEDSVVYFCAASD
Morone saxatilis V2 igkv JTCL01004055.1 1486 SGASPSVTQSPISKSVGLGQTVSLSCTASTGVGDDLSWYLQKPGQAPKLLFYKISSRQSGTPSRFSSSGSEPEFTLTISGVQAEDAGDYYCMGAYTSG
Morone saxatilis V1 trbv JTCL01001313.1 3837 VCLGVEVHQTPPALLRRPGDNVQLVCSHGKTDYSLMYWYEKSPGDRALKRIGHVYYSTIELEQSFKEHFNISGDLSGETAKNGSLFIVNLKAVEHSAVYYCAASY
Morone saxatilis V0 trbv JTCL01001313.1 1871 SSLSDKVHQTPADVYKKTGETAKISCSHSIQDYTRIYWYKQSNNRQMQLLGYMNVNDGNYEDGVNVKMDGGALKDQTCTLTIEGFDLNSSAVYFCAAS