WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pygocentrus nattereri MAUM00000000.1 (MAUM01) 581 183 16 64 233 22 20 43
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pygocentrus nattereri V29 trav MAUM01002188.1 240653 GKNVHQTPPHLVKNKQESADLHCSHSIQDYQVMLWYKQSENKLHFLGYLNMQIKYPEEALKNKTDLDGDGRNNGTLTVKNLQPNDSAVYFCAVRYTVLQ
Pygocentrus nattereri V28 trav MAUM01002188.1 240653 GKNVHQTPPHLVKNKQESADLHCSHSIQDYQVMLWYKQSENKLHFLGYLNMQIKYPEEALKNKTDLDGDGRNNGTLTVKNLQPNDSAVYFCAVRYTVLQ
Pygocentrus nattereri V27 trav MAUM01002188.1 235840 KKYDVHQSPFDLLSSAGEYRELHCNHSVSTFRTILWYQQSTGDISLKLIGYVFYKNPEVERPFEGQFNVSGDGEKHSTLHLLKLRAEDSAVYYCAARE
Pygocentrus nattereri V26 trav MAUM01002188.1 232908 QKDDIHQSPSDVLSHAGKYHELHCKHSGSTFRMILWYQQSTGDTSLKLIGYVNYKSLNVESSFEGQFNVSGDGAKHSTLHLKLRAAEDSAVYYCAAKV
Pygocentrus nattereri V25 trdv MAUM01002188.1 231492 SALCNVVQSPPDLIKNQNDTAEIKCAHNIRSYDRILWYKHTQATGFKFIGYLFNELRKTETEFENITLSGDGRKSGSLTITRLSVNDSAAYFCAAYYTVV
Pygocentrus nattereri V24 trdv MAUM01002188.1 231492 SALCNVVQSPPDLIKNQNDTAEIKCAHNIRSYDRILWYKHTQATGFKFIGYLFNELRKTETEFENITLSGDGRKSGSLTITRLSVNDSAAYFCAAYYTVV
Pygocentrus nattereri V23 trbv MAUM01002188.1 230426 FSHSNRVTQTPAHLTGNHAGSATIECSHSVQSYDQINWYKQSQQQDLTFIGYLLRTSKPQKEPEFLNKVDMTGDGTKNVLLIIKNLSDTDSAVYFCAAW
Pygocentrus nattereri V22 trav MAUM01002188.1 228972 SALCNVVQNPPDLIKNQNDTAEINCVHSVTDYERILWYKHTQTTKLKFMGYLHFQTPNPETEFANISLSGDGRNNGSLIISRLSVNDSAVYFCAAYYTVQ
Pygocentrus nattereri V21 trbv MAUM01002188.1 223265 CSSAVKNVHQTPRDLVWNKQESANVYCSHSIANHEVTLWYKQSENNQLHLLGYLNLQFKYPEEALKTKIELDGDGRNNSTLTIKNLQPNDSAVYFCAAR
Pygocentrus nattereri V20 trbv MAUM01002188.1 223265 CSSAVKNVHQTPRDLVWNKQESANVYCSHSIANHEVTLWYKQSENNQLHLLGYLNLQFKYPEEALKTKIELDGDGRNNSTLTIKNLQPNDSAVYFCAAR
Pygocentrus nattereri V19 trav MAUM01002188.1 221653 SSSTYEVAQTPSDLLRKPGESAELQCLHSISDFNYILWYKQTRNRELQFMGLLAFTSSQPEPEFRNNIALSGSGNKNGQLTINTPTSNDSAVYYCAAS
Pygocentrus nattereri V18 trbv MAUM01002188.1 216940 AQNVYQTPPDLIKNKEKFAELHCSHSIPSYQVILWYKQYENKFHLLGYLNLGSNFPEEALKNKITLDGNGRNNSTLTINNLQLNDSAVYFCAASQ
Pygocentrus nattereri V17 trav MAUM01002188.1 211222 AKDVIQPNVIWAEKGRSATIHCKHTKGVDYNQMYWFHQRQGESMKLIVLTATYIKQSEFEEGFNKEKYSANKTAVESGSLTVNDLDSTDSAIYFCAVSKHSV
Pygocentrus nattereri V16 trdv MAUM01002188.1 208887 DSGVTQSPRLLWVQKGKSGEINCNHDKGNLYFHMYWFRQQQGKPMELIVYTSTTSEPDFGSFDKNKFSATKKVAESGSFTVMNVESDDSALYFCAVS
Pygocentrus nattereri V15 trav MAUM01002188.1 204774 ANDVIQPNIICAEMGQSATINCEHTKGSTYREMYWYRQHPGESMKFIVFTVSYNKPEFGEGFDEQKFTASKTVAESGSLTVNNLVSTDSAVYFCSVREHSVT
Pygocentrus nattereri V14 trav MAUM01002188.1 204774 ANDVIQPNIICAEMGQSATINCEHTKGSTYREMYWYRQHPGESMKFIVFTVSYNKPEFGEGFDEQKFTASKTVAESGSLTVNNLVSTDSAVYFCSVREHSVT
Pygocentrus nattereri V13 trbv MAUM01002188.1 188657 SSNGPAVQQTPTDLIKNQGESAEIRCSHNIQGHDRIMWYKQAQNKELTFMGYHVGNSGNLEPNFRGKVKISGKANKLHSVLNVSSLSPDSAAVYFCAAY
Pygocentrus nattereri V12 trbv MAUM01002188.1 186775 SLNAVAVQQTPSDLIKNQGQSAEITCSHNIQSHDRILWYKQSQTKELTFMGYLFVASGNPEPEFNNKIKISGNSNEFHGSLTMTNLSLESTAVYFCAAY
Pygocentrus nattereri V11 trav MAUM01002188.1 183382 SPDNAKVLQPLPDLFSKHGESAKLQCSHSISTYDTIQWYKQSYNRRLQLMGYIVGSQPKLELEFDNKVTLKGNGYKNSTLTINTPTSNDSTVYFCAAFTQR
Pygocentrus nattereri V10 trbv MAUM01002188.1 179542 SAANNEVSQIPAELFRKSGESADLQCSHSISGYTTILWYKQARNGELQFMGYLTVTSPQSEPEFSKKVKFSGRGDTNGTLTINTLTSNDSAVYFCAAF
Pygocentrus nattereri V9 trav MAUM01002188.1 176940 DDVIQPNTIWAEIGQSAMINCEHTKGATYTHMYWYIQRQGESMKLIVFTVSYGQKPEFGEGFDDNKFLANKTVAEIGSLTVTDLDSADSAVYFCSVKQHSVTF
Pygocentrus nattereri V8 trav MAUM01002188.1 175413 DSGVTQSPSVLWVQKGKSAEMNCSHTKGISYNQMYWFRQQVKPMELIVYISTANNPDFGNFSREKFSATKKEAESGYFTVKNVESDDSALYFCAVS
Pygocentrus nattereri V7 trav MAUM01002188.1 171101 SAASDEVSQTPLDLFKKPGKSAELQCSHKSSSYNTILWYKQTRTRQLQLMGYLYTTSNNSEPEFSKKITLAGSGQNTGILTINTLTSNDSAVYYCAA
Pygocentrus nattereri V5 trav MAUM01002188.1 165652 DDVIQPNIIWAQMGQSATITCEHTKGAGYTQMYWFRQVQGESMKLVVFTASYAKEPEFGEGFDDKKFSTNKKVPESGSLTVTDLDSADSAVYFCSVKE
Pygocentrus nattereri V4 trav MAUM01002188.1 165652 DDVIQPNIIWAQMGQSATITCEHTKGAGYTQMYWFRQVQGESMKLVVFTASYAKEPEFGEGFDDKKFSTNKKVPESGSLTVTDLDSADSAVYFCSVKE
Pygocentrus nattereri V3 trav MAUM01002188.1 160932 SALCNVVQNPPDLIKHQNNTAEIKCAHTVKDYNRMLWYKHDQATSFKFMGYLSLQTPNPEAEFENIKLSGDGRNNGSLIISRLSVNDSAVYFCAAYYTVQ
Pygocentrus nattereri V2 trbv MAUM01002188.1 151216 SVFNNKVQQTPPDVIKARGDSVEIQCLHSIPNYNRILWYKKTVDQPFTLLGYLLNTFDNKEPAFNNKIDLKGDATKNGSLIINYPSEKDSAVYFCAVS
Pygocentrus nattereri V1 trbv MAUM01002188.1 148657 SVFSNNVQQSPLDLIKTSGKSVELQCLHNIPNYNVILWYKKNAVQEFVLLGYLWDDREKKEPAFKDKITLKGDATSKGFLTIKDLLVNDTAVYFCAASYHSV
Pygocentrus nattereri V0 trbv MAUM01002188.1 148657 SVFSNNVQQSPLDLIKTSGKSVELQCLHNIPNYNVILWYKKNAVQEFVLLGYLWDDREKKEPAFKDKITLKGDATSKGFLTIKDLLVNDTAVYFCAASYHSV
Pygocentrus nattereri V66 igkv MAUM01023628.1 24071 SHQEVQSPEFLSVEAGKTVSISCTGTSGVGDDMSWYLLRTGEAPKLLIYEANRRQSGVPERFSGSYSGYNFQLTISGVQPEDAGDYYCMGYYSDTV
Pygocentrus nattereri V65 trdv MAUM01019261.1 36131 TTFSGYAVEQDQLKIAEVGDSVALSCFSTRDMKTTIVWIKQNPGEKPVQIATSYQHQAGTFYNGFDQSGRFKTQAGPGSFNLTISSLEPSDTATYYCANIFIYD
Pygocentrus nattereri V64 igkv MAUM01019261.1 31540 AVYVVHQDQLKIAEAGDSIHLSCFSSRDTKTTIVWIKQISGEKPVVIATSYQHQPGIFQNGFDQSGRFETQTAAESFNLTISNLEPSDTATYYCTVIFFYD
Pygocentrus nattereri V63 trav MAUM01019260.1 18577 GHLQGKILQLDSVVTAKEGDDVTLSCLHPTDQINKVLWYQQPIGQKPLLVASSYYHSLPFEFYNDFDKTKRFDLSRRSGSSNLTITKVEPSDSAVYYCAGSFS
Pygocentrus nattereri V62 trgv MAUM01015985.1 2158 FLWQTSTSVSVKQGRNVTLTCPLKTSISIGVVSWYKQNLGEGPNMLLSYNVTMPWIVRYAKDLNSHRYVVLARDGSKARHRLRIITTEEQDTATYYCSYSEKMNE
Pygocentrus nattereri V61 igkv MAUM01012706.1 101154 STGQVTVTQTPAVKSALPGDTVTISCRTSQAVYYYSTYGHLHWYQQKPGETPKFLIKLVNELQSVFPARFSGSGSGSDFSLTISGVQPEDTGDYYCQS
Pygocentrus nattereri V60 igkv MAUM01012706.1 98199 QVTVTQTPAVKSALPGDTVTISCKISEAVYYHSSYGHYLNWYQQKPEETPKLLIKLANQLQSGFPARFSGSGSRSDFTLTISGFQPEDTGDYYCQS
Pygocentrus nattereri V59 igkv MAUM01012706.1 94970 STGQVTVTQTPAVKSALPGDTVTISCRTSQAVYHDSKGHHLYWYCLKPGETHKALIEFVNQVQSGFPARFSGSGSGSDFTLTISGVQREDTGDYYCQS
Pygocentrus nattereri V58 igkv MAUM01012706.1 89743 QVTVTQTPAVKSALPGDTVTISCRTSSAVYHHSSNGHYLHWYQQKPGETPKLLIKLANQLQSGFPARFSGSGSGSDFTLTISGVQPEDTGDYYCQSYHYINSNNL
Pygocentrus nattereri V57 igkv MAUM01012706.1 76651 SRGQATVTQTPAVKSALPGDTVTISCRTSPAVYQGRGYQPFSWYLQKTGESPKLLIKKANELYSGTAARFHGSGSGSDFTLTISGVQPEDEGDYYCVG
Pygocentrus nattereri V56 igkv MAUM01012706.1 72713 SRGQATVTQTPAVKSALPGDTVTISCRTSPAVYQSWGYQPFSWYLQKTGESPKLLIKKANELYSGTAARFHGSGSGSDFTLTISGVQPEDAGDYYCVG
Pygocentrus nattereri V55 igkv MAUM01012706.1 68925 TVTQTPAVKSALPGDTVTISCKTSRPVHRYSEGVEGLYWHVQKPGESPKALIKHAKVLVSDTPARFSGSGSTSDFTLTISGVQPEDAGDYYCQTYQSGTV
Pygocentrus nattereri V54 iglv MAUM01009187.1 15986 VSGVTVVTQKPPVLTPTKGETTTMHCNLGTVTSSAARWYKQVPGEAPQYVLVNYHGLSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYC
Pygocentrus nattereri V53 iglv MAUM01009187.1 2276 VSGVTVVTQKPPVLTPTKGEKITMHCNLGTVTSSAARWYKQVPGEAPQYVLVNYHGLSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYC
Pygocentrus nattereri V52 trdv MAUM01002189.1 34537 KTSTQQVLQSKAFMTPLGGDNVTLHCSIGAGSTMNSYTMAWYRQVQYGAPVQFLMKEYEQSTEKYSVALALDNNQFSLHILDLTLQDSGTYYCAA
Pygocentrus nattereri V51 trav MAUM01002189.1 24055 TTDSVIFQQISSLFTNESNSTTIKCSHDDSNLPVMLWYQQKRDSIAMALIGYTYGPNDPTYEDGFKKRFHLKRKTDQKGDLIISELLQSDSAVYYCAAK
Pygocentrus nattereri V50 trav MAUM01002189.1 20609 RTNCAEIAQSAAVFAKTDSVTINCSHGDSSLINMYWYQQKRDSTAMALIGYTTGVSNPANKEDGFSGRFTLNRQSIQKGDLTISELLQSDSAVYYCAAS
Pygocentrus nattereri V49 trav MAUM01002189.1 18642 GTSNCIIVQQISSLLANETKSITITCSHDDSSKTVMLWYQQKTDTTAMALIGYTATRMSDPVYEDGFTKERIKLNRQGDTEGDLTISRLLQSDSAVYYCAAK
Pygocentrus nattereri V48 trav MAUM01002189.1 3789 KTNCVTFQQIPSLLAKDNVTITCSHDDSSLQIMYWYRQKSDSTAMTLIGFGYPTTEQNYEDDFKQRFKLNRQGATKGYLTISKLLQSDSAVYYCAAS
Pygocentrus nattereri V47 trav MAUM01002189.1 1622 SVNVQQSSLLFAKQKDTVKIECSHSDSTYTAVLWYQQKSNSTALALISYTVGKGSLNNEDRFQERFTLNRQTTVEDLSISELQQSDSAVYYCGVSKQTA
Pygocentrus nattereri V46 trav MAUM01002189.1 1622 SVNVQQSSLLFAKQKDTVKIECSHSDSTYTAVLWYQQKSNSTALALISYTVGKGSLNNEDRFQERFTLNRQTTVEDLSISELQQSDSAVYYCGVSKQTA
Pygocentrus nattereri V45 trav MAUM01002188.1 293223 ISLSSEIIQPTAVFKEPGKNVSLRCTHTYKDYFYLYWYQQTTRDTSLKLTGYLYTTTFYHEKDFEMRFHISGDAKTEGTLQISNLSSADSAVYYCAVRDAQ
Pygocentrus nattereri V44 trav MAUM01002188.1 290492 GVFSALIIQQSPLDVLKTPDQREVMFSCRHGDSSYPYMYWYQQKSGTIELIGMLHYEKATPEDSFKARFSISGHSKGDALLVISNITAADSAVYFCAAS
Pygocentrus nattereri V43 trdv MAUM01002188.1 288881 LSVCSTVTQKPTDLLKNKNDSVTLECFHNISSYNVILWYKQSEHRDLQLLGFLYRGNINKDSGLNRSIELNGDGSKSSTLMMGNLTSNDSAVYYCAAS
Pygocentrus nattereri V41 trav MAUM01002188.1 283003 GQGDESGVFQEPDIIWGSPGSSVEMNCNHNKDINHRQMYWFRQFPGEGMTRIAFTFVGGEPDYGDFSKDKYEAVKTVVESGSFTVKNLDSGDSAVYFCAVS
Pygocentrus nattereri V40 trav MAUM01002188.1 281139 QGDETGVFQEPNIIWGSSGSSVEMNCTHNKPIDHRQMYWFRQFPGEEMAQIAFTFVGGKPDYGDFSEDKYEAVKTVVENGSFTVKHLDSGDSAVYFCAVS
Pygocentrus nattereri V39 trbv MAUM01002188.1 278242 FSHSTHVIQTPSNLIMNQKESATIKCWHNVTSYNQINWYKQTQEQELIFIGYYLGKSTPNKEKEFETKVNMTGDGNSDVSLTITGLSLTDTAVYFCAAY
Pygocentrus nattereri V38 trbv MAUM01002188.1 274072 FSHSTHVIQTPSNLIMNQKGSATIKCWHNVTSYNQISWYKQTQVQELIFIGYIYAKSTPNKEKEFETKVNMTGDGNSDVSLTITGLSLTDTAVYFCAAY
Pygocentrus nattereri V37 trbv MAUM01002188.1 271707 LAGDSGVTQSPKVLWVEKGNPAQMNCNHDKGGSYIQMYWFQQKQRKPMELIVFTTTSRKDFGSSDQNKFAATKEKAESGSFTVKTVESDDSALYFCAVS
Pygocentrus nattereri V36 trdv MAUM01002188.1 265280 DSGVTQNPSVLWAKKDKPAEMSCNHNKGSTYIYMYWFLQRQGKPMELIAFISTANKPDFGNFSREKFSATKKEAESGSFTVKNVESDDSALYFCAVS
Pygocentrus nattereri V35 trdv MAUM01002188.1 265280 DSGVTQNPSVLWAKKDKPAEMSCNHNKGSTYIYMYWFLQRQGKPMELIAFISTANKPDFGNFSREKFSATKKEAESGSFTVKNVESDDSALYFCAVS
Pygocentrus nattereri V34 trbv MAUM01002188.1 262199 FAGDSGVTQSPTVLWVEKGNSAEINCSHNKDASYFQMYWFRQQQGKPMELIVFTTTATKDFGSFDQNKFSAIKENTESGSFTVKNVESDDSTLYFCAVS
Pygocentrus nattereri V33 trav MAUM01002188.1 258637 DNGVTQSPRVLWVEKGNSAEINCSQTKGAAYSQMYWFQQQQGKPMELIVFTTTSRKDFGSSDQNKFSATKEKAESGSFTVKNVESDDSALYFCAVS
Pygocentrus nattereri V32 trav MAUM01002188.1 253734 LLICNKVDQSPADVLCLPKTMIKLTCNHSISNYDTILWYQQVHGDTSLKLIGYARYSTSKDIEKEYKDNFNITGDGSSSASLHIKQARPVKDSAMYFCAAYY
Pygocentrus nattereri V31 trbv MAUM01002188.1 251330 FSHCNSVIQTPLHLFENRDQSPTIECSHTVKNYDQIYWYKQTQSQELTLLGYVYGRSEPKKEREFETKVNMTGDGYSKVSLTIINLSLTDSAVYFCAAY
Pygocentrus nattereri V30 trbv MAUM01002188.1 243007 LFICNKVDQTPADVLCLPKKTVTLSCSHSIPSYNMILWYQQAYGDTSLKLIGYARLSSNVAEEEYRDNFSITGDGRSSALHITQARQVKDSAVYFCAASY
Pygocentrus nattereri V104 trav MAUM01039485.1 2252 NSSAQSIEPLENKTQVHACEDETVTLSCEYVDSGTVGSLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDGNTNTKKFWNLSLSSTAVSDSALYYCAMR
Pygocentrus nattereri V103 trav MAUM01038271.1 4108 GVYSINPVETEKQVSVGDSVSLSCRYSSSNVFLYWYRQYPSSKLDFLLRITESGSVSGSPPPGFSARVENKRVDLSISSAKLSDSALYYCAEA
Pygocentrus nattereri V102 trav MAUM01038154.1 97 GIEPSSSTVSVLQGDSVTLSCNYTGSAFTDYLLWYRQYPRSRPEFLILVSETNITQNADPPVAGVGTNIIQEKNRVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V101 trav MAUM01038152.1 6873 NTAAVGIQPLFFEKHVLEGADVTLSCNYSAATGDTFQWYRQYPGSRPEFLLYLTEFNIASDSALRLTAEVKKQFEHVDLNISHTVASDSALYYCALQ
Pygocentrus nattereri V100 trav MAUM01038152.1 3117 ETSAQTIVPLVGEVHVSEGDHVTLSCNYSSTTYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRLSAEVFTDKMQVDLEISSAAVSDSALYYCAMR
Pygocentrus nattereri V99 iglv MAUM01035655.1 21647 VSGVTVVTQKPPVLTPTKGEKITMSCNLETVTSSGARWYKQVPGEAPQYVLANYHGWSSPSYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYCHTWDSSAAV
Pygocentrus nattereri V98 igkv MAUM01035655.1 17623 VSSQKVLTQSPSVLTDQGRTVSLDCNIAKDESYVFWYKQIPQAAPQFVLRFYHSHSSPSQYGDNFPSSRFTSKASSNIDYQLIISNVEVGDAAVYYCGTWDGSASVGV
Pygocentrus nattereri V97 iglv MAUM01035654.1 15988 VSGVTVVTQKPPVLTPTKGEKTTMHCNLGTVTNFEAVWYKQVPGEAPEYVLRNYHGWSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYCSTWD
Pygocentrus nattereri V96 igkv MAUM01035654.1 11995 VSSQKILTQSPSVLTDQGRTVSLDCNIAKYEGNYVYWYKQIPQAVPQFVLRFLYSHSSPDIYGDNFPSSRFTSKASSNIDYQLIIGNVEVGDSAVYY
Pygocentrus nattereri V95 iglv MAUM01035654.1 4086 VSGVTVVTQKPPVLTPTKGETTTMYCNLGTVKTYQAVWYKQVPVGVPQYVLSSHLTWSSPRYGPGYSSSKFTSTCSSNSDCNLIISNVEVGDSAVYYC
Pygocentrus nattereri V94 iglv MAUM01035654.1 1581 VSGVTVVTQKPPVLTPTKGEKTTMYCNVGTFSDKAVWYKQVPGEAPRYVISNFHTWSSPSYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYY
Pygocentrus nattereri V93 trav MAUM01035652.1 3546 VSGVTVVTQKPPVLRPTKGEKTTMHCNLGSVINDAAYWYKQVPGEAPQYVLANYHSWSSPDYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYCQTYDSSAAV
Pygocentrus nattereri V92 ighv MAUM01034499.1 317 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYATAWIRQPAGKALEWIGVIDSGSSGGTVYSDKLKSKFSISRDTGTKTITLRGQNLQTEDTAVYYCA
Pygocentrus nattereri V91 ighv MAUM01034497.1 21104 VHSQIVLTQSERPVTVTPGGSHKLTCACSGFNVGDYWMGWIRQAPGKGLEWIIGYYTESHKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V90 ighv MAUM01034497.1 18311 GVDCVELTQSPSKVVKPGESFSISCKTSDSSYCIHWIRQPAGKTLEWLGYLCSGGGTNIKDTVKSKISFRQDTSSSTVFLQGQNFQSEDKAVYYCARQPQRY
Pygocentrus nattereri V89 ighv MAUM01034497.1 14548 VHSYELTQPGSMVVHPGQSLTVDCKVSYSVTSEYTAWIRQPAGKALEWIGRITSSGGTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V88 ighv MAUM01034497.1 9377 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSDWSTWIRQPAGKALEWIGVIDSSGGTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V87 ighv MAUM01034497.1 7106 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFAVGSYNMYWIRQVPGKGLKWIIFYYTSSVKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCALD
Pygocentrus nattereri V86 ighv MAUM01034497.1 2406 VHCIELTQPGSMAMNIGQSITLTCKVSGYSLTDSSYCTDWIRQPAGKALEWISTICGNGAEDTKASLKSKFSISKDSSTVTLSGRNLQTEDSAVYYCARRP
Pygocentrus nattereri V85 ighv MAUM01034496.1 5843 CVELTQSDSKLVKPGESFSISCKTTESGYCVHRMRQPAGKTLEWLGYLCKDDRKGLIDTVKSKISFRQDTSISTVFLQGQNFQSEDTAVYYCARQPQRY
Pygocentrus nattereri V84 ighv MAUM01034496.1 1077 VECIELVQPAAMAVKPGQSFSIACKISGYTAEGGGCTNWIRHSAGKAPERIGWFCNTNSTGSQSSLRSKISFTADSSSNTVFLQGQNFQPEDTAVYYCAR
Pygocentrus nattereri V83 ighv MAUM01034495.1 65 VECIELVQPAAMAVKPGQSFSIACKISGYTAEGGGCTNWIRHSVGKAPEWIGWFCSTSDTGTTDSLKSKISFTADSSSNTVFLQGQNFQPEDTAVYYCARN
Pygocentrus nattereri V81 ighv MAUM01034494.1 7770 VECIELVQPAAMVVKPDQSFSIACKITGYTAATSCTHWIRHSVGKAPEWLGWFCSTSNTGSKSSLRSKISFSVDASSNTLFLQGQNFQPEDTAVYYCARAHSA
Pygocentrus nattereri V80 trav MAUM01034494.1 3783 VHSVELNQPDFLAVSPGQTLNINCKVSYSLTTYATAWVRQPAGKSPEWIGLIYAGGDIPYKDSLRSKFSISRDTSTSTVTLRGQNLQTEDTAVYYCARA
Pygocentrus nattereri V79 ighv MAUM01034494.1 2043 VHSVELTQPGSMVRTPGQSMSLTCKVSGYSLTDSSYCTQWIQQPAGKALEWIGWICSNGGTGYSDKLKSRFEVSRDTSSNTVTLRGQNLQTGDTAVYYCARE
Pygocentrus nattereri V78 ighv MAUM01034492.1 15433 INCIELTQPGSMVVTPGQSMSLTCKVSGYSLTDSSYCTNWIRQPAGKALEWIVAICGGGDTYYSDKLKSRFEISRDTSSSTVTLRGQNMQTGDTAVYYCARY
Pygocentrus nattereri V77 trav MAUM01034492.1 13059 INCIELTQAGSMVVTPGQSMSLTCKVSGYSVTDSSYCTNWIRQPAGKALEWVARMCGSGNAYYSDKLKSRFEISRDSSSSTVTLRGQNMQTGDTAVYYCARDSQ
Pygocentrus nattereri V76 trav MAUM01034492.1 9231 INCIELTQPASMVVTPGQSMSLTCKVSGYSLTDSSYCTHWIRQPAGKTLEWIVAKCGSGSNYYNDKLKSRFEVSRDTSSSTVTLRGQNMQTGDTAVYYCARDSQ
Pygocentrus nattereri V75 ighv MAUM01034492.1 5030 INCVELTQPGSMVVTPGQSMSLTCKVSGYSVTDSSYCSHWIRQPAGKALEWIVAICGGGDTYYSDKLKSRFEITRDTSSSTVTLRGQNLQAGDTAVYYCAG
Pygocentrus nattereri V74 ighv MAUM01034492.1 1820 GVHSIELTQPGSLVINPGQSISLTCKVSGYSVTDVTYCTHWIRQPAGKALEWVGRMCGGGYSDYSDKLKSRFEVTSDSTSNSVTLRGQNVQTGDTAVYYCARQ
Pygocentrus nattereri V73 igkv MAUM01033295.1 11776 SFGEIILTQTPGSQTVSAGDSVTISCRSSQSISNNLHWYLQKPGEAPKLLIYYATNRQSGIPDRFSGSYSGTDFTLRISGVQSEDAGDYYCQQSNSFP
Pygocentrus nattereri V72 igkv MAUM01031244.1 226 SSGQVTVTQTPAVKTVSPGDSVTISCRTSTAVYRTSWGERLAWFQQKPGEAPKLLMSNANSRHSGVPARFGGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V71 igkv MAUM01028881.1 6900 SSGQVTVTQTPAVKTVFPGDSVTISCRTSSAVYMDSAGPYLSWYQQKPGEPPKLLIYYATRRQSGVPARLSASGSGTGFTLTISNVQTEDAGDYYCLS
Pygocentrus nattereri V70 igkv MAUM01027883.1 2768 SRGQAVITQTPAVKSALPGETVTISCNANVAVDNDCNNNFACVSWYQQKPGEAPKLLIKLANQLHSGVPARFSGSGSKTYFTLVISGVQTEDAGDYYCLMDHY
Pygocentrus nattereri V69 trav MAUM01024319.1 89127 QKKPGETLSLSCRGSGFSFSCCSMQWVRQLAGKPLEWIGRVRASGIGNDYSKSFQGRTEITRDNSNSMVYLKLSGVTVEDSAVYYCAKSAQ
Pygocentrus nattereri V68 ighv MAUM01023631.1 4547 QTVQAGKTVSITCKHDPAIDCYDTATKKKDCVSWYHQLPGETPKLLIIWATESYSGVPSRISGSRAGNKIDYTFTITGVQPEDSGVYYCQS
Pygocentrus nattereri V142 trav MAUM01047388.1 850 ETADIIKQNQTSMLVSEGSNATLSCTYGGDVYSLHWYQQKPGSRLEFLLLIMESTQHITKAETLDERLSISLNKKDMKVDLLISSAAVSDSALYYCAME
Pygocentrus nattereri V141 igkv MAUM01046894.1 1679 SSGQVTVTQTPAVKSVSPGDSVTINCRTSTSVQGNYLAWYQQKLGEVPKLLIYGATSRQSGIPARFSGSGSGFDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V140 ighv MAUM01046755.1 81 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSLGGAYMYWIRQAPGKGLEWIIYYHSDSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCASD
Pygocentrus nattereri V139 trav MAUM01046482.1 1300 ETSAQTIEPLVGEMHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRLSAEVFTDKMQVDLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V138 trav MAUM01046466.1 1306 ETSAQTIEPLVGEMHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPEFLLYITLQGTMSDPRPPRMSAEVFTDKMQVDLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V137 trdv MAUM01046100.1 1227 ETSAQKTEPLVGEMHVSEGDTVTLSCNYSSTSYPLQWYHQFPRSRPEFLLYVTLQGTMSDPRMSAKVFTDKMHVHLEISSAAVSESALYYCALQPTVTGNSD
Pygocentrus nattereri V136 igkv MAUM01045238.1 825 SFGDIIMTQTPGSQTVSPGDSVTISCRASQSISNDLAWYLQKPGEAPKLLIYYATNRQSGVPDRFSGSGSGSDYSLKISGVQSEDAGDYYCQQGY
Pygocentrus nattereri V135 trav MAUM01044903.1 310 NCVSQSIEPQENKIHAVKDETVTLSCKYNGSVDNLQWYRQYPGSRPEYLLMTFPGSDSVSLADPPFPRLNATLKKSRMNLIISSAAVSDSALYYCALR
Pygocentrus nattereri V134 igkv MAUM01044690.1 771 SSGQVTVTQTPAVKTLSPGDSITISCRTSTAPACSPPCISWYHQNSGEAPKLLIYRATSRQSGIPARFSGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V133 trav MAUM01044561.1 1320 ETSAQTIEPLVGEMHVSEGDHVTLSCNYSSTTYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRMSAKVFTDKMQVDLEISSAAVSDSALYYCAQQ
Pygocentrus nattereri V132 ighv MAUM01044380.1 3728 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSVGGTSMHWIRQAPGKGLEWIIYYYSESSKSSAQSVQGRFTASKDSSNVYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V131 iglv MAUM01044311.1 2898 VSGVTVVTQKPPVLTPTKGETTTMHCNLGTVTRSAARWYKQVPGEAPQYVLRNYHGLSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYY
Pygocentrus nattereri V130 trav MAUM01043868.1 1749 ETADIIKQNQTSMLVSEGSNATLSCTYGGDVYSLHWYQQKPGSRLEFLLLIMESTQHITKAETLDERLSISLNKKDMKVDLLISSAEVSDSALYYCAME
Pygocentrus nattereri V129 trav MAUM01043320.1 843 NCVSQSIEPLENKIHALEDETVTLSCRYGSSAPGNYLHWYRQYPGSRPEYLLMIYAATKAVSHATPPFPRLNATENNKTVDLIISSAAVSDSALYYCALR
Pygocentrus nattereri V128 trav MAUM01042999.1 1696 DSFENVITSHGSVKQARDGETVTLSCNYSVSSYGLFWYRQYSRSKPEFLLSITESGGTVKADPTAPFSASIDKSQSNKILSLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V127 trav MAUM01042858.1 149 VSGVTVVTQKPPVLTATKGETTTMHCNLGTVTSSGACWYKQVPGEAPQYVLANYHSWSSPDYGSGFSSPKFTSTHSSKSDYTLIISNVEVGDSAVYYCSTMDSSAAA
Pygocentrus nattereri V126 igkv MAUM01042680.1 889 SFGDVILTQTPGSQTISPGDSVTISCRASQDIGWSLAWYLQKPGEAPKLLIKAGDERYSGVPDRFSGSRSGTDFTLKISGVQSEDAGDYYCQQGY
Pygocentrus nattereri V125 ighv MAUM01042560.1 106 VHSQVVLTQSERSVTVTPGGSHKLTCACSGFNVGGTGMNWIRQAPGKGLEWIIYYYSESSKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCA
Pygocentrus nattereri V124 ighv MAUM01042558.1 1002 VHSQVILTQSEGSVTVAPGGSLKLTCACSGFSVGGAYTHWIRQAPGKGLEWIIYYYSDSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDSAVYYCARS
Pygocentrus nattereri V123 ighv MAUM01042556.1 423 VHSQVVLTQSEGSVTVAPGGSLKLTCACSGFSVGGAYTHWIRQAPGKGLEWIIYYYSDSYKYSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V122 trav MAUM01042515.1 5131 VSGVTVVTQKPPVLTPTKGETTTMHCNLGTVTNDARWYKQVPGEAPQYVLRHYHGWSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYYCSTMDSSAAV
Pygocentrus nattereri V121 igkv MAUM01042404.1 1003 ICVSQSIEPLENTTQALENEKVTLSCKYVFDRVASSLQWYRQYPGSRPEYLLMFIPATKTVSHATPPFPRLNATENNKTVNLTISSAAVSDSALYYCTLQ
Pygocentrus nattereri V120 iglv MAUM01042247.1 5995 VSGVTVVTQKPPVLTPTKGEKTTMHCNLGTVTGNSAKWYKQVPGEAPQYVLANYHGWSSPKYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYY
Pygocentrus nattereri V119 ighv MAUM01042178.1 86 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSSAMGWVRQAHGKGPEWIAYIETSTHSNTGYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V118 ighv MAUM01042177.1 2367 FQSQTLTQSEAVVKKPGESHKLTCTASGSSFSSYYMGWIRQAPGKGLEWIAYIGTASSPIYYSQSVQGRFTVSRSDSSSQLYLQMNSLKSEDTAVYYCARV
Pygocentrus nattereri V117 ighv MAUM01042176.1 119 FQSQTLTQSEAVVKKPGESHKLTCTVSGFTVSSYEMVWVRQAPGKGLEWIAYIGTYGTPTYYSQSVQGRFTISTSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V116 igkv MAUM01042165.1 1813 SSGQVTVTQTPAVKTVSPGDSVTISCRTSPAVYQGWSVQPLAWYQQKPGEAPKLLIYGATSRQSGIPARFSGSGSGSDFTLTINNVQTEDAGDYYCQSYHEISGSWVF
Pygocentrus nattereri V115 trav MAUM01041906.1 6010 VSGVTVVTQKPPVLTVTKGETTTMHCNLGTVTNYAAYWYKQVPGEAPQHVIRHHHSWSSPNYGSGFSSPKFTSTCSSNSDCSVIISNVEVGDSAVYYC
Pygocentrus nattereri V114 trav MAUM01041906.1 1107 VSGVTVMTEKPPVLTATKGETTTMHCNLGSVTDPIVCWYKQVPGGTTQYVLENYHGWNSPSYGSGFSSPKFTSTHSSQSGYTLIISNVEVGDSAVYYC
Pygocentrus nattereri V113 trav MAUM01041763.1 1463 DSFENVITSHGSVIPARDAETVTLSCNYSVSPYGLFWYRQYSRSKPEFLLFITESGDPVKAAQLFATSDKNSKVMRLTIFPAEVSDSAFYYCALQ
Pygocentrus nattereri V112 trav MAUM01041759.1 6154 DSFENVITSHGSVKQARDGETVTLSCNYSVTPYGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALT
Pygocentrus nattereri V111 trav MAUM01041759.1 1990 DSFENVITSHGSVKQARDGETVTLSCNYSVTPYGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALT
Pygocentrus nattereri V110 igkv MAUM01041513.1 1196 SSGQVTVTQTPAVKTVSPGDSVTISCRTSISPSGCSPGCISWYKQKPGEAPKLLIYYATSRQSGVPARFSGSGSGSDFTLTISNVQTEDTGDYYCQS
Pygocentrus nattereri V109 trdv MAUM01040737.1 674 QTIQPLAGELHVSEGDNVTLSCNYSTTNFGDAIQWYRQFPKSRPEFLLYIYIQGTKSDPLPPRMSAEMDKDNKRVDLLISSAAISDYALYYCAL
Pygocentrus nattereri V108 trav MAUM01040388.1 4132 ETSAQTIEPLVGEVHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPEFLLYITLQGTMSDPRPPRLSAEVFTDKMQVDLEISSAAVSDSALYYCAMR
Pygocentrus nattereri V107 igkv MAUM01039933.1 4005 IIMTQTPGSQTVSPGDSVTISCRASQSISSYLAWYLQKPGEAPKLLIYGATTRQSGVPDRFSGSGSGSDYSLKISGVQSEDAGDYYCQQGG
Pygocentrus nattereri V106 igkv MAUM01039930.1 798 SSGQVTLTQTPAVKTVSPGDSVNISCRTGTEGYNSDNLAWYQQKPGEALKLLIYWAKSRQSGVPARFIGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V180 ighv MAUM01070527.1 92 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSYEMVWVRQAPGKGLEWIAFISTYSSPISYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARR
Pygocentrus nattereri V179 ighv MAUM01069544.1 55 VHGEELTQPGSMVVRPGQSLTIDCKVSYSVSSYWSAWIRQPAGKALEWIGNIYSGGSTDYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCARG
Pygocentrus nattereri V178 ighv MAUM01069325.1 92 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSVRSTNMHWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCA
Pygocentrus nattereri V177 trav MAUM01068311.1 118 DSFENVITSHGSVKQARDGETVTLSCNYSVSPFGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V176 igkv MAUM01068141.1 277 SFGDIIMTQTPGSQTVSPGDSVTISCRASQGINNWLAWYLQKPGEAPKLLIYYATNRQSGVPGRFSGSGSGSDYSLKISGVQPEDAGDYYCQQGYSRP
Pygocentrus nattereri V175 ighv MAUM01067155.1 279 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSYDSGWIRQPAGKALEWIGYIYSGGSTYYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V174 ighv MAUM01067074.1 27 VHGEELTQPGSMVVRPGQSLTIDCKVSYSVSSYWSAWIRQPAGKALEWIGNIYSGGSTDYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCARG
Pygocentrus nattereri V173 trdv MAUM01066744.1 492 NCVSQSIAPLEDKMQVHALEGERANLSCKYDKADYLFWYRQYPGSRPEYLLTIIPSTKSVTPVLQQLKAEVDGKRVDLLISSAAVSDSALYYCAMR
Pygocentrus nattereri V172 igkv MAUM01065984.1 215 SSGQVTVTQTPAVKTVSPGDSVTISCRTSTAPACSPPCISWYQQKPEEAPKLLIYRATSRQSGVPARFSGSGSGSDFTLTINNVQTEDAGDYYCQS
Pygocentrus nattereri V171 ighv MAUM01065602.1 513 VQSQVVLTQSERSVTVTPGGSKKLTCACSGFTLSSYRMHWIRQAPGKGLEWIMHYYTDSDKGSSQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCATG
Pygocentrus nattereri V170 trav MAUM01064550.1 383 ETSAQTIEPLVGEVHVSEGDTVTLSCKYSSTSYPLQWYRKFPRSRPEFLLYVTLQGTMSDPRPPRMSAKVFTDKMQVDLEISSAAVPDSALYYCALQ
Pygocentrus nattereri V169 ighv MAUM01063931.1 35 VHCFELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTSWIRQPAGKALEWVGYISSDSSGSTAYSDKLKSKFSISRDTGTKTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V168 trdv MAUM01063914.1 492 NCVSQSIAPLEDKMQVHALEGERANLSCKYDKADYLFWYRQYPGSRPEYLLTIILSTKSVTPVLQQLKAEVDGNRVDLLISSAAVSDSALYYCAMR
Pygocentrus nattereri V167 ighv MAUM01062458.1 35 VHCFELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTSWIRQPAGKALEWVGYISWDSSGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCA
Pygocentrus nattereri V166 ighv MAUM01061734.1 159 VQSQIVLTQSERPVTVTPGGSHKLTCACSGFDLSGTWMHWIRQAPGKSLEWMITYYSESQTKYSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V165 ighv MAUM01061337.1 183 VQSQIVLTQSERSVTVTPGGSHKLTCACSGFDLSSTWMGWIRQAPGKGLEWIISYYDESNKGSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCA
Pygocentrus nattereri V164 ighv MAUM01059051.1 94 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFNVGGTGMNWIRQAPGKGLEWIIYYYSDSDKSSAPSVQGRFTASKDRSNFYLHMSQLKPEDTAVYYCATG
Pygocentrus nattereri V163 igkv MAUM01059043.1 567 SSGQVIVTQSPAVKTVSQGDSVTISCRTSTAVYKNDYLAWYQQNPGEATKFLIYRATSRQSGTPARFSGSGSGTDFTLTISNVQTEDAGDYYCQSVHWTGSTYVF
Pygocentrus nattereri V162 trav MAUM01057351.1 161 ETSAQTIEPLVGEVHVSEGDHVTLSCNYSSTSYPLQWYHQFPRSRPEFLLYITLQGTMSDPRPPRMSAKVFTDKMHVHLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V161 ighv MAUM01056422.1 99 FQSQTLTQSEAVVKKPGESHKLTCTTSGFTFSDYRMVWVRQAPGKGPEWIAYISIATYSYSSSYSQSVQGRFTSSRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V160 ighv MAUM01054819.1 485 TVHAQIRLDQSSAEVKKPGEAVKISCKISGYRMTSYNMGWIRQKPGQALEWIGRMSTGSNSATYADSVKDHFTMTEDVSTSTQFLEAKSLRAEDTAVYYCARQ
Pygocentrus nattereri V159 trav MAUM01054648.1 604 DSFENVITSHGSVKQARDGETVTLSCNYSVSSFGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLDISSAAVSDSALYYCALQ
Pygocentrus nattereri V158 ighv MAUM01054636.1 751 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYNTAWIRQPAGKALEWINLIYYDGDIRAKDSLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V157 trav MAUM01054289.1 865 VSSEDLITSHGSVKHARDGESVTLSCNYSVSQYGLFWYHQYSRSKPEFLLSTTESGGTVKADPAAQFSATVDKIQNSKVLNLVISSAAVSDSALYYCALQ
Pygocentrus nattereri V156 ighv MAUM01052962.1 308 IISAEIRLDQSSAEVEKPGEAVKISCKISGYSMTSIYLHWIRQKPGQALEWIGRMSTGSNSATYADSVKDDFTMTEDVSTSTQFLEAKSLRAEDTAVYYCARY
Pygocentrus nattereri V155 trav MAUM01051655.1 804 DSFENVITSHGSVKQARDGETVTLSCNYSVSSFGLFWYRQYSRSKPEFLLSTTESGVTVKADPTAPFSATVDKSQSNKILSLDISSAAVSDSALYYCALQ
Pygocentrus nattereri V154 ighv MAUM01051485.1 276 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTAWIRQPAGKALEWIGNIYSDGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCVR
Pygocentrus nattereri V153 ighv MAUM01051081.1 511 CWSQTLAQSEAVVISPGGSHTLTCTVSGLDFNDYWMGWIRQAAGKGLEWISTISAPTGSSKEYSQSVQGRFTISRENSKKQVQLQMSSLKTEDTAVYYCARE
Pygocentrus nattereri V152 igkv MAUM01050551.1 313 SFGDIIMTQTPGSQTVSPGDSVTISCRSSQSISSYLAWYLQKAGEAPKLLIYGATYRQSGVPDRFSGSRSGTDFTLKISGVQSEDAGDYYCQQGY
Pygocentrus nattereri V151 ighv MAUM01050514.1 427 CWSQTLTQSEAVVISPGGSHTLTCTVSGLDFNDYWMGWIRQAAGKGLEWISTISAPSGSSKEYSQSVRGRFTISRENSKKQVYLQMSSLKTEDTAVYYCARE
Pygocentrus nattereri V149 ighv MAUM01050021.1 99 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSDYAMDWVRQAPGKGLEWIALIETSTYSYRSYYSQSAQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCA
Pygocentrus nattereri V148 igkv MAUM01049559.1 483 IIMTQTPGSQTVSPGDSVTISCRSSQSISNYLAWYLQKPGEAPKLLIYGATYRQSGVPDRFSGSGSGSDYSLKISGVQSEDAGDYYCQQGG
Pygocentrus nattereri V147 ighv MAUM01049213.1 465 VQCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYGTSWIRQPAGKALEWIGVIGSSGGTAYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V146 trav MAUM01048707.1 1378 SCVSQSITPLKNIIHAHEDETVTLSCTFDGDVSSLQWYHQYPGSRYQMPVYLLMTFPGSDSVNYATPRFPRLDAKEYNKTVDLIISSAAVSDSALYYCAVT
Pygocentrus nattereri V145 igkv MAUM01048537.1 1197 SSGQVTVTQTPAVKSVSPGDSVTISCRTSTSVQGNYLAWYQQKLGEVPKLLIYGATSRQSGIPARFSGSGSGFDFTLTISNVQTEDAGDYYCQSYHYIS
Pygocentrus nattereri V144 trav MAUM01047729.1 850 ETADIIKQNQTSMLVSEGSNATLSCTYGGNVDSLHWYQQKPGSRPEFLLLIMESTQHITKAETLDERLSISLNKKDMKVDLLISSAEVSDSALYYCAME
Pygocentrus nattereri V218 trav MAUM01002189.1 62823 AQVIQVHQNPEELIVSPGSPLKVFCSISGIANPYLYWYQWTPAAGFTLVFTSLSSGSVNPQRKDQFKSSRPGELQIVLESDGVSESDSAVWYCAAS
Pygocentrus nattereri V217 trav MAUM01002189.1 67371 VQLIQLQQDPEELILSPGSSLKVSCFVTGADDPYLYWYQWTPAEGFTLVFTSVTTGSVDSSSKGQFKSQRPGELQIVLESDGVSESDSAVWYCAAS
Pygocentrus nattereri V216 trbv MAUM01002188.1 190702 CASTAQNVYQTPPDLIKNKEKSTELHCSHSIPNYRLMLWYKQSENNQLSLLGYLNMDSKYPEEALRAKITLDGDGQNNGTLTLKNLQPNDSAVYFCAAS
Pygocentrus nattereri V215 trbv MAUM01002188.1 190702 CASTAQNVYQTPPDLIKNKEKSTELHCSHSIPNYRLMLWYKQSENNQLSLLGYLNMDSKYPEEALRAKITLDGDGQNNGTLTLKNLQPNDSAVYFCAAS
Pygocentrus nattereri V214 ighv MAUM01156678.1 13 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYRTDWIRHPAGKALEWIGYITSSGSTAYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V213 trav MAUM01144703.1 55 NTAAVGIQPLFFEKHVLEGADVTLSCNYSAATGDTFQWYRQYPGSRSEFLLYLTEFNIASDSALRLTAEVKKQFERVDLNISHTVASDSALYYCALQ
Pygocentrus nattereri V212 trav MAUM01131718.1 32 EDVITPDRDVVCAVEGRNVTLFCNYSRAADSLHWYRQYSGSPPQFLILDYSGVITEAQPPVPGISINHVNKLKQVDLVISSAVVSDSALYYCALQ
Pygocentrus nattereri V211 ighv MAUM01127587.1 35 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYATAWIRQPAGKALEYIGFIDWGSSGSTYYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCA
Pygocentrus nattereri V210 ighv MAUM01121120.1 21 VHSQVVLTQSEGSVTVAPGGSLKLTCACSGFSVGSAYTHWIRQAPGKGLEWIIYYYSDSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCA
Pygocentrus nattereri V209 ighv MAUM01111416.1 43 IISAEIRLDQSSAEVKKPGEAVKISCKISGYSMTSNYLHWIRQKPGQALEWIGRMDTGSNSATYADSVKDHFTMTEDVSTSTQFLEAKSLRAEDTAVYYCARE
Pygocentrus nattereri V208 ighv MAUM01105423.1 92 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSVRNTNMHWIRQAPGKGLEWIIYYHSESSKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V207 ighv MAUM01104202.1 96 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTAWIRQPAGKALEWIGNIYSDGSTAYSDKLKSKFSISRDTGTKTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V206 ighv MAUM01098284.1 112 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFDLSSYTMHWIRQAPGKGLEWIIYYYSDSVKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCATG
Pygocentrus nattereri V205 trav MAUM01092910.1 70 EDVITPDRDVVFAVEGRNVTLSCNYSRAADSLHWYRQYSGSPPQFLILDYSGVITEAQPPVPGISINHVNKLKQVDLVISSAIVSDSALYYCALQ
Pygocentrus nattereri V204 ighv MAUM01090692.1 143 SYGQSLTSSESVVEKPGTSVTLSCSVTGLSLSWLHWIRQKPGQGLQWIGRIDDGTGTIFAQSLQGQFSITKDTSKNMVYLQVKSLKAEDTAVYYCARE
Pygocentrus nattereri V203 ighv MAUM01088304.1 41 SCSQTLTESDPVVLKPDQSHKLTCTASGLDFDSYWMAWIRQAPGKGLEFVATIEYDSASKYYSSAVTGRFTISRDNSKDQVYLQMSRLKTEDTAVYYCA
Pygocentrus nattereri V202 ighv MAUM01086924.1 207 GPNDQETDVFRKEGESVTLKCSYETSSEDVFLFWYRQYPNRALQYLLLRGARTRSGGDHTADDRFESTAKRSSTLLTVGELRLADTALYYCALQVIGTQ
Pygocentrus nattereri V201 ighv MAUM01086502.1 99 FQSQTLTQSEAVVKKPGESHKLTCTTSGFTFSSHYMAWIRQAPGKGPEWIAYISTATYSNTGYYSQSVQGRFTSSRSDSSSQLYLQMNSLKSEDTAVYYCARD
Pygocentrus nattereri V200 trav MAUM01083540.1 102 ETSAQTIEPLVEELHVSEGDHVTLSCKYSSTSYPLQWYRKFPRSRREFLLYVTLQGTMSDPRPPRMSAKVFTDKMHVHLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V199 ighv MAUM01082417.1 96 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYATSWIRQPAGKALEWVGYISSDSSGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCA
Pygocentrus nattereri V198 ighv MAUM01082156.1 221 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSVGGTSMHWIRQAPGKGLEWIIYYHSDSYKSSAQSVQGRFTASKDSSNVYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V197 trav MAUM01079792.1 281 ETSAQTIEPLVEELHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPDFLLYITLQGTMSDPRPPRMSAKVFTDKMQVDLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V196 iglv MAUM01078186.1 134 VSGVTVVTQKPPVLTPTKGEMTTMHCNLGTVTNAARWYKQVPGEAPQYVLSNRHSWSSPEYGSGFSSPKFTSTHSSQSDYTLIISNVDVGDSAVYYC
Pygocentrus nattereri V195 ighv MAUM01078069.1 185 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYYSAWIRQPAGKALEYIGYISSGGGTAYNDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V194 ighv MAUM01077896.1 273 GPNDQETDVFRKEGESVTLKCSYETSSEDVFLFWYRQYPNRALQYLLLRGARTMSGGDHTADDRFESTAKRSSTLLTVGELRLADTALYYCALQVIGTQ
Pygocentrus nattereri V193 ighv MAUM01077481.1 121 FQSQTLTQSEAVVKKPGESHKLTCTVSGSSFSSYYMAWIRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V192 ighv MAUM01076464.1 286 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYATSWIRQPAGKALEWVGYISWDSSGSTAYSDKLKSKFSISRDTGTKTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V191 ighv MAUM01075963.1 14 VKCVDLIQPSSELIKPGGSLTISCKVSGYSVTDNDYATGWIRQPAGKTLEWINHIWGGGGTYQKESLKSKFSVSKDASSSTVTLQGQNMQPEDTAVYYCARLR
Pygocentrus nattereri V190 ighv MAUM01075254.1 275 VHCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTAWIRQPAGKALEWIGNIYSDGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V189 trdv MAUM01074562.1 323 NCVSQSIAPLEDKMQVHALEGERANLSCKYDKADYLFWYRQYPGSRPEYLLTIILSTKSVTPVLQQLKAEVDGKRVDLLISSAAVSDSALYYCAMR
Pygocentrus nattereri V188 trav MAUM01073397.1 118 DSFENVITSHGSVKQARDGETVTLSCNYSVSSFGLFWYRQYSRSKPEFLLSTTESGVTVKADPTAPFSATVDKSQSNKILSLDISSAAVSDSALYYCALQ
Pygocentrus nattereri V187 trav MAUM01073151.1 108 DSFENVITSHGSVIPARDGETVTLSCNYSVSPFGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V186 ighv MAUM01073106.1 336 VHCFELTQPGSMVVRPGQSLTIDCKVSYSVRSDATSWIRQPAGKALEWVGYISWDSSGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAKG
Pygocentrus nattereri V185 trav MAUM01072820.1 118 DSFENVITSHGSVKQARDGETVTLSCNYSITPYGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALT
Pygocentrus nattereri V184 trav MAUM01072210.1 150 EDVITSSRDVVFAVEGQNVTLSCNYIGTAYGLHWYRQYSGSPPQFLILDYNGVITKAQPPVPGISINHVKEMNKVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V182 ighv MAUM01071401.1 27 VHGEELTQPGSMVVRPGQSLTIDCKVSYSVSSYWSAWIRQPAGKALEWIGNIYSGGGTDYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCARG
Pygocentrus nattereri V256 iglv MAUM01019263.1 37060 GLSNIDIQCVDGMNYIQSGQNVHLNCAFATFNAITSAWLKQTPGEKLLLIASAYRSTPVKFHNNFDKNSRFNVEREKSSFTLRISNAEPSDSATYYCIAADYS
Pygocentrus nattereri V255 trav MAUM01019263.1 48526 SSSNIDVPCVDGMKFIQSGQSITLNCPFATFDTITSTWLKQTPGEKLLLIAAAFRSTAVKYHNGFNKSGRFNSSREKGSFTLSISNAEPSDSATYYCAVSDFS
Pygocentrus nattereri V254 trgv MAUM01019262.1 7897 NEDIISLERLKFIHLGDKINLTCSFSSIDASAAAWFKETPGEKPLLIATAFRSTPVAFHNGFNKNGRYRAIRERSSFILNILDAEPSDSATYYCAVVDYSNLGLGA
Pygocentrus nattereri V253 trav MAUM01016393.1 7030 NCASQSIAPLKNRIHSVEDEIVTLSCEYNGSVSNLQWYRQYPGSRPEFLLLKYPGATDVVHADPPFPRLNATVKKSGVDLIISSAAVSDSALYYCALR
Pygocentrus nattereri V252 trav MAUM01016393.1 8896 SCVSQSIAPLENKVQLHALEDETVTLSCKYNGSVTNLQWYRQYPGSRPEYLLMIYPSNKVMHAIPPFPRLNATVKDSRVHLTISSAAVSDSALYYCALT
Pygocentrus nattereri V251 trav MAUM01016393.1 17919 NCVSQSIAPLENKLHALEDETVTLSCVYNGSVSNLQWYRQYPGSRPEYLLMIFPSNKVMHAIPPFPRLNATVKKSGVNLTISSAVVSDSGLYYCAME
Pygocentrus nattereri V250 igkv MAUM01015640.1 637 SHQEVQTPERSSLEPGQPITFSCVADRGIGYYMSWYQMKPGAAPKLLIYGSSNRRSGVPQRFSGTNSGYTFTMTISGVQPEDAGEYYCMGYYSGPE
Pygocentrus nattereri V249 igkv MAUM01015640.1 10692 SHQEVQTPERSSVEPGQSVTFSCVADRGIGYAMSWYQLKPGAAPKTLIYGSSYRNSGVPQRFSGTNSGYTFTMTISGVQPEDAGEYYCMGGYSGPE
Pygocentrus nattereri V248 igkv MAUM01015640.1 30311 SHQEVQTPERSSVEPGQSVTFSCVADRGIGYLMSWYQLKPGAAPKLLIYGSSYRNSGVPQRFSGTNSGYTFTMTISGVQPEDAGEYYCMGYYDFSAVS
Pygocentrus nattereri V247 trgv MAUM01014094.1 9161 HSAEKLEQKVLMTKAAAKLAIIECTFSTYCLNYVHWYQKKEDELKRVQYVNINDGTTKNIPVFEYLKSARKGIRTFVLKIPHLKPEHSATYYCACWTGYHSEM
Pygocentrus nattereri V245 trgv MAUM01014093.1 7693 AVLGVTVEQSELSWTKPKGKRVFISCRVTDLTTDYIHWYQQKDDEALKRILYIKHDGSGLTYNPNHPQAREFTVKVDRSSNIHELRVDTLKTSHSAVYYCACWERG
Pygocentrus nattereri V244 trgv MAUM01014093.1 22390 VLGVTVEQSELFWVKANSKRVFISCKVSDLTTDYIHWYQQKDGEALKRILYIKHDATHPTYDSNHPQAREFSVRVDRRSNAYDLRVDTLKTSHSAVYYCACWERD
Pygocentrus nattereri V243 trgv MAUM01014093.1 26467 AVVGVTVEQSELSWTKPKGKRVFISCRVTDLTTDYIHWYQQKDDEALKRILYVKHDGSGLKYDPNHPQAREFSVRVDRRSNAYDLRVDTLKTSHSAVYYCACWERG
Pygocentrus nattereri V242 trgv MAUM01014093.1 29169 DSAVELHQKFLMTKAATKTAIIDCTFPSDCWSYIHWYQKKDDETLKRVQYVDISDGDYQNDPGFEFLKSEKKTDDQFVLKIPNLKTEHSATYYCACWDYS
Pygocentrus nattereri V241 trgv MAUM01014093.1 30160 AVLGLTVEQSQLIWMKPVGKSVYISCKVRDLTTDYIHWYQQKDGDALKRILYIKHDETRPTYDPNFQEAREFSMKVDKKSNAYDLKVQTLKTSHSAVYYCACWD
Pygocentrus nattereri V240 trgv MAUM01014093.1 31147 AVLGVTLEQSQLSWTKKESKRAYISCKVTGLTTTYVHWYHQKDGEALKRILYVNEAGTTPVSEANDFTVELEKGNDYVLRIDAVKLSHSGVYYCACWESG
Pygocentrus nattereri V239 trgv MAUM01014093.1 46358 TVLGLTIKQNELSWTKTEGKSIYIKCEVEGLSDSSYLHWYQQKNDEALKRILYFSRDGGTVPDGNHPEKDDFTVTKDYDLKINSLKKSHSAVYYCASWDGAQ
Pygocentrus nattereri V238 trgv MAUM01014092.1 8024 VLGLTVEQPELSWTKQKVKRAYIKCKVTGLASSNYVHWYQQKDGEAIRRILYVNAAGTSTVRDPNHPEADDFSVKRENDDTYVLRVDTLKMGHSAVYYCACWD
Pygocentrus nattereri V237 trgv MAUM01014092.1 13575 VLGQTALEQPEPSSTKEKGKRAYINCKATGLSDGSYIHWYRQKDGEGLKRILYVDKLGSTPVRDSEEKDFTVQLQGGNNYALKVNEVKSTHSGVYYCACWDSS
Pygocentrus nattereri V236 trgv MAUM01014092.1 16097 GVLGQTVEQPDLSFTKGEGRRAYISCKVNGLLSDNYVHWYQQKEGEALTRILYVNKGASSTVYNPDLLDAKGFSVKLGNNDDYVLRIDAVKLSHEGVYYCACWDTS
Pygocentrus nattereri V235 trgv MAUM01014092.1 20369 AVLGVTVEQSQLSWTKPVGNTAYIKCKVTDLTTDYIHWYQQKDGEALKRILYIKHDETRPTHDSNHQEAREFSVRVDRRSNSYDLKVQTLKMNHFAVYYCACWERG
Pygocentrus nattereri V234 trgv MAUM01014092.1 29149 VLGQTVEQPELSWIKSQNKRARISCIVTGLQSDNYVHWYQQKDGEALKRILYVNKGGTSPVYNDNVREAKDFTVQLENDNYALRVRELKTTHSGVYYCAVWDTS
Pygocentrus nattereri V233 trgv MAUM01014092.1 37176 VLGQTVEQPELSWTKQTTKRAYIKCKVTGLTDDNYVHWYQQKDGEALKRILYVQKHGSSPVRSAGAEDFTVELQNNNDYVLRVKDLKLSHSGVYYCACWVSG
Pygocentrus nattereri V232 ighv MAUM01013580.1 1814 TYGQSLTSSESVVEKPGTSVTLSCSVSGISMSSYWMHWIRQKPGQGLEWVGYIDSGTGTGFAQSLQGQFSITKDTSKNMLYLQVKSLKAEDTAVYYCARD
Pygocentrus nattereri V231 ighv MAUM01013580.1 1814 TYGQSLTSSESVVEKPGTSVTLSCSVSGISMSSYWMHWIRQKPGQGLEWVGYIDSGTGTGFAQSLQGQFSITKDTSKNMLYLQVKSLKAEDTAVYYCARD
Pygocentrus nattereri V230 ighv MAUM01013580.1 1814 TYGQSLTSSESVVEKPGTSVTLSCSVSGISMSSYWMHWIRQKPGQGLEWVGYIDSGTGTGFAQSLQGQFSITKDTSKNMLYLQVKSLKAEDTAVYYCARD
Pygocentrus nattereri V229 ighv MAUM01013580.1 7076 TYGQSLTSSESVVEKPGKSVTLSCSVSGFSMGSYWMHWVRQKPGKGLEWIGRIDSGTGTSFAQSLQGQFSITKDTSKNMLYLQVKSLKAEDTAVYYCARD
Pygocentrus nattereri V228 ighv MAUM01013580.1 19100 SCSQTLTESDPVVLKPDQSHKLTCTASGLDFDSYWMAWIRQAPGKGLEFVAIIEYDSASKYYSSAVTGRFTISRDNSKDQVYLQMSRLKTEDTAVYYCA
Pygocentrus nattereri V227 ighv MAUM01013579.1 1153 LTSSESVVEKPGTSVTLSCSVSGISMGNWFSWIRQKPGKGLEWIGYINSGTGTSFAQSLQGQFSITKDTSKNMVYLQVKSLKAEDTAVYYCARD
Pygocentrus nattereri V226 ighv MAUM01013579.1 6334 TNGQSLTSSESVLEKPGTSVTLSCSVSGLSLSYLHWIRQKPGQGLEWIGRIDSGTGTSFAQSLQGQFSITKDTSKNMLYLQVKSLKAEDTAVYYCAKE
Pygocentrus nattereri V225 ighv MAUM01013579.1 9313 SCQEIRMDQSPPQVKKPGESVKISCKISGYDMTSYYMHWIRQKPGKALEWIGYVDSGTANEPTYADSMKDHFILTEDVSTSTQFLEAKSLRAEDTAVYYCARR
Pygocentrus nattereri V224 ighv MAUM01013579.1 12593 LSCQEIRMDQSPPQVKKPGESVKISCKISGYDMTSYYMHWIRQKPGKALEWIGRVNSGTTHEPTYAGSMKDHFKLTEDVSTSTQFLEAKSLRAEDTAVYYCARQ
Pygocentrus nattereri V223 ighv MAUM01013577.1 37185 LSCQEIRMDQSPPQVKKPGESVKISCKISGYDMTSYLMHWIRQKPGKALEWIGFVNSGTTDEPTYADSMKDRFTLTEDVSTSTQFLEAKSLRAEDSAAYYCARE
Pygocentrus nattereri V222 igkv MAUM01008328.1 2914 DATALQAPAFALVETGQRVVLSCKTSSHIGRLSDGDCKSCLAWYYQRDGKTPKVLIRGITTLQSDTPSRFVGSGSDYGTEFTLTISGVQTEDAGDYYCQS
Pygocentrus nattereri V221 igkv MAUM01008327.1 28113 VTVKQTPSVASVSSGENVNIVCSFSYYTTGCNPDCLSWYLQKPGEAPKLLMYEVSKVQSGTPSRFSGRGSGRDFTLTITGVQAEDMGDYYCLLS
Pygocentrus nattereri V220 ighv MAUM01004224.1 57932 LEALVLTQEKTKSVKLGENIKVSCRTDDSTDWTLTWYQQKPGESPKFLLADSKRASGLPSRFTYSGSRNQEYLHINGVQAEDEAVYYCACHSCGSL
Pygocentrus nattereri V294 ighv MAUM01034092.1 19428 MKCQIMESLETAVQLKPGETLSLSCRGSGFNFGGSGMHWIRHQAGKPLEWIGTIWSDSSKTAYIKSVEGRLEIIKKDTQNMVHLKLSGLTAQDSAVYYCTR
Pygocentrus nattereri V293 ighv MAUM01034092.1 23131 AEGVELTQPSSVAVKPGESVKLSCKVSGYSITSYCTHWIRQFKGKTLEWIGWICSGGDTAHKDSLKSRFSISRDTSSNMLYLQGQNLQPEDTAVYYCARQ
Pygocentrus nattereri V292 ighv MAUM01034092.1 30395 VKGQSLESFPSDPVLVRPGGSFSVSCKAVGYRFEGYSMHWIRQPSGKALQWIERIFPTNGETLYAKGLEGRIEIMKDNSKSTSYLKLSGLTVEDTAVYYCARL
Pygocentrus nattereri V291 ighv MAUM01034092.1 32101 VKGQSLESIPSDPVLVRPGGSFSVSCKAVGYDFGSYSMHWIRQPSGKALQWIGRIYTNTGTTAYTKGLEGRIEITKDNSKGTSYLKLSGLTVEDTAVYYCAR
Pygocentrus nattereri V290 ighv MAUM01034092.1 34741 VKCESMESLETGVQLKPGETLSLSCRGSGFTFSSYDMNWIIQQAGKPLEWIGYISNLAYSTNYAKSYQGRAEITRDNSKSMAYLKLSGVTVEDSAVYYCAR
Pygocentrus nattereri V289 ighv MAUM01034092.1 37595 IKCQSMESLETAVQLKPGETLSLSCRGSGFNFGCCSMHWIRQEAGKPLEWMGRVSSSGGTKNYAKSFEGRTEITRDNSKSMAYLKLSGVTVEDSAVYYCAKQ
Pygocentrus nattereri V288 ighv MAUM01034092.1 41236 VKCESVESLETAVQKKPGETLSLSCRGSGFTFSSYHMHWIRQQAGKPLEWMGYISTDGDTKGYAASFQGRTEFTRHNSNSMVYLKLSGVTVEDSAVYYCGRE
Pygocentrus nattereri V287 ighv MAUM01034092.1 43189 VKCQNMESLQTAVQLKPGETLSLSCRGSGFTFSSYNMHWIRQQAGKPLERMARVSGGGGSKSYPASFQGRTEITRDNSNSMVSLKLSGVTVEDSAVYYCARS
Pygocentrus nattereri V286 ighv MAUM01034089.1 6520 GVHSVELTQPASMVINPGQSVLLTCKLSGYSVTDSYCSHWIRQPAGKALEWIEAICGDGSTGHSDKLKSRFAVSRASSSNTVTLRGQNMQTGDTAVYYCARE
Pygocentrus nattereri V285 trav MAUM01034089.1 8418 VHSYELTQPEFLAVRPDQTLTINCKVSYSITSYATVWIRQPAGKALEWVATMGYSGGLYYKDSLKSKFSLSRDTSSSTVTLRGQNLQTGDTAVYYCARE
Pygocentrus nattereri V284 ighv MAUM01034088.1 628 FQSQTLTQSEAVVKQPGESHKLTCTASGSSFSSYYMGWIRQAPGKGLEWIAYIGTASSPIYYSQSVQGRFTVSRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V282 trav MAUM01032741.1 7545 NSSAQSIEPLENKTQVHAREDETVTLSCEYVYSGTVDSLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDDNTNTKKFWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V281 trav MAUM01032740.1 690 NSSAQSIEPLENKTQVHAREDETVTLSCEYVYSGNVKSLQWYRQYPGSRPEYLLLKYRGSTDVTRADPTFLRLDATDDNTDDKKLWNLSISSTAVSDSALYYCAMT
Pygocentrus nattereri V280 trav MAUM01032739.1 1994 NSSAQSIEPLGNQTQVHAREDETVTLSCQYEGNVNNLLWYRQYPGSRPEYLLLKYPGSADVTRADPTFLRLDATDDNKNKPKLWNLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V279 trav MAUM01032737.1 809 NSSAQSIEPLENQTQVHAREDETVTLSCQYEGSVNNLLWYRQYPGSRPEYLLLTYRGSTDVTRADPTFLRPDATDDNTDDKNFWNLSISSTAVSDSALYYCAMT
Pygocentrus nattereri V278 trav MAUM01032737.1 1632 NSSAQSIETLENKTQVHAREDETVTLSCQYVYSGTVESLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDDNTETKKFWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V277 trav MAUM01032736.1 305 NSSAQSIEPLENKTQVHAREDETVTLSCEYVYIGTDNSLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDDNTETKKFWNLSLSSTEVSDSALYYCAMT
Pygocentrus nattereri V276 trav MAUM01032733.1 2689 NSSAQSIEPLDNKVLIHARENETVTLSCEYKYSATPSSLQWYRQYPGSRPEYLLLKYPGSTDVTRADPTFLRLDATDDNTNTKKLWKLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V275 trdv MAUM01032732.1 7042 SCVSQSIAPLENKTLVNILENETVTLSCKYEYDGVVSNLQWYRQYPGSRGEYLLLIIPASKAVNHTTPHFPRLNGRVNEKTVNLTISSAALEDTAFYYCAME
Pygocentrus nattereri V274 trav MAUM01032732.1 17825 CCVSQSIAPLDNKLQVNAVEDETVTLSCRYQGSATYLYWYRQYPGSRPVFLLRIDPDTNAVRHATPRFPRLDIKLNGKTLILLISSAAVSDSALYYCALR
Pygocentrus nattereri V273 trav MAUM01032732.1 19145 NCVSQTITPLENKVQVDALEDETVTLSCKYDGAAYYLYWYRQYPGSRPEFLLRIDPDTNAVTHATPRFPRLDIKLNGKTLILEISSAAVSDSALYYCAME
Pygocentrus nattereri V272 trdv MAUM01032732.1 22612 YCVSQSITPLDNKTQVRALEDKITLSCRYQGSVWYLYWYRQYPGSRPEFLLMIHASSKDVTRADPPFPRLNVEASGTNLDLIISDATVSDSALYYCALQ
Pygocentrus nattereri V271 trdv MAUM01032732.1 25232 ESVDPISPDETSVLVSEGSRTTLSCTYDGSPYSLHWYQQKPGSRPEFVLLIFFENEATSQPHPRMSIRLRKQHKKVDLIISSATVSDSALYYCALR
Pygocentrus nattereri V270 trav MAUM01032732.1 29774 NCVSQTITPLENKVQVDALEDETVTLSCKYEGSAAYLYWYRQYSGSRPEFLLRIDPDTNAVAHATPRFPRLDTKLNGRTLILEISSAAISDSALYYCAME
Pygocentrus nattereri V269 trav MAUM01032732.1 37026 SCVSQSITPLENKVRVDALEDETVTLSCKYEGRAYYLYWYRQYSGSRPEFLLRIDPDTNAVAHATPRFPRLDTKLNGRTLILLISSAAISDSALYYCALR
Pygocentrus nattereri V268 trav MAUM01032732.1 38972 ESVDPIRPDETSVLVSEGSRTTLSCTYEGSPYSLHWYQQKPGSRPEFLLLMVVANEATSQPHPRMSIRLRKQHKKVDLTISSTAVSDSALYYCALQ
Pygocentrus nattereri V267 trav MAUM01032732.1 47290 NSVSQSIAPLENKLQVHALEDETVALSCNYVGSTAYLCWYRQYPGSRPELLLLISPTSKYVRHADPPVPRLNVKVNANKLDLLISPAAVSDSALYYCAM
Pygocentrus nattereri V266 trav MAUM01032732.1 50329 NSSAQSIEPLDNKVLIHAREDETVTLSCEYKYSATPSSLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDDNTNTKKFWNLSLSSTAVSDSALYYCAMT
Pygocentrus nattereri V265 iglv MAUM01030854.1 13377 VLSVSLSSQAGLTVEAEPGDDVTLWCKHSLIKSNYLFWYKHTWSSVPDRVACKYYSLSSSNTCFFIPESNRSVMGVNSTFSSLTITAVTVSDSGLYYCSSVENKD
Pygocentrus nattereri V264 igkv MAUM01030710.1 795 IIMTQTPGSQTVSPGDSVTISCRSSQSISNYVTWYLQKPEEAPKFLIYGATYRQSGVPDRFSGSYSGTSFTLKISGVQSEDAGDYYCQQGG
Pygocentrus nattereri V263 igkv MAUM01028898.1 25009 SFGEIILTQTPGSQTVSAGDSVTISCRASQSIGNNLHWYRQKPGEAPKLLIYVATSRQSGVPDRFSGSGSGSDYSLKISGVQSEDAGDYYCQQGY
Pygocentrus nattereri V262 igkv MAUM01028892.1 4497 VILTQTPGSQTVSPGDSVTISCRASQSISSYLAWYLQKPGEAPKLLIYGATSRQSGVPDRFSGSGSGTDFTLRISGVQSEDAGDYYCQQYSSG
Pygocentrus nattereri V261 igkv MAUM01028891.1 336 SSGQVTVTQTPAVKTVSPGDSVTISCRTSTAVYRRSDGDETLFWYQQKPGEAPKLMIRYAKKLQSGIPARFSGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V260 igkv MAUM01028887.1 26368 SSGQITVSQSPAVKTVSPGDSVTISCRTSPAVYADVALSWYQHKPGEAPKLLIYAADTLDDDVPARFSGSGSGTDFTLTISKVQTEDAGDYYCQSYHEISGRDVF
Pygocentrus nattereri V259 igkv MAUM01028443.1 2258 SSGQVTVTQTPAVKTVSPGDSVTINCRTSTAVFTASGYHFLAWYQQKPGEAPKHLIYYATSRQSGVPARFSGSGSGTDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V258 trgv MAUM01026329.1 5222 CTSNVDISSCLDGLKVIQSGENISITCASSNSYVTAIAWFKQTPGEKALLIASALDSTPQYHNDFDKSGRFIAAREQSSFTLNISNAEPSDSATYYCSVMY
Pygocentrus nattereri V332 trbv MAUM01037493.1 419 GVYSINRLEAEKQVSVGDSVSLSCSYSRGSVYRLYWYRQYPSSKLDYLLYITPTGGLSGNEPPGVSARVENNRVDLVISSAKLLDSALYFCASR
Pygocentrus nattereri V331 trav MAUM01037490.1 894 GAYSINPVETEKQVSVGDSVSLSCIYSSSVYRLHWYRQFPSSKLNFLLFIYESGGLSDSIPPGFSAKVENKTVDLLISSAAVSDSALYYCAME
Pygocentrus nattereri V330 trav MAUM01037488.1 2872 NCVSQSIEPQENKIHAVKDETVTLSCKYNGSVDNLQWYRQYPGSRPEYLLMIYPATKAVSHATPPFPRLNATVKESRMNLIISSAAVSDSALYYCALR
Pygocentrus nattereri V329 trdv MAUM01037488.1 4857 NCASQSIAPLDNKTQVHALEDERVILSCTYNGRVNNLQWYRQYPGSRPEFLLLKYPEASGVVPADPPFPRLDAKVNGSRVNLLISSAAVSDSALYYCALQ
Pygocentrus nattereri V328 trav MAUM01037487.1 1136 SCVSQSIGPLDNKVLIHAREDETVTLSCKYEYSATPNSLQWYRQYTGSRPENLLLKYAGSADVTRADPTFLRLNATDNNNNWTLSISSAAVSDSALYYCAME
Pygocentrus nattereri V327 trav MAUM01037241.1 5436 SCVSQSIGPLDNKVLVHAREDETVTLSCKYESSGTGNYLHWYRQYPGSRPEYLLMKLSGSNVINYATPRFPRLETTENNKTVNLIISSAEVSDSALYYCALQ
Pygocentrus nattereri V326 trav MAUM01037236.1 4448 KCAAQSIEPLENKIHALEDETVTLSCNYESTAISNYLHWYRQYPGSRPEYLLMIYPASKAVSHATPPFPRLNVTENNKTVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V325 ighv MAUM01036451.1 842 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSSHYATAWIRQPAGKALEWINMIYHDGGIAAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARE
Pygocentrus nattereri V324 ighv MAUM01036451.1 2063 CWSQTLTQSEAVVISPGGSHTLTCTVSGLDFDDYWMGWIRQAAGKGLEWISHISAPSGSTKEFSQSVQGRFTISRENSKKQVYLQMSSLKTEDTAVYYCARE
Pygocentrus nattereri V323 ighv MAUM01036450.1 1749 CWSQTLIQSEAAVITPGGSHRLTCTASSLDFDGYWMGWVRQAAGKGLEWVATISHTSQTTRYSQSVQGRFTISRDNSKDQLYLQMTSVKTEDTAVYYCARE
Pygocentrus nattereri V322 ighv MAUM01036450.1 6652 VFSELIQPDSVLIKPAEPLTITCTVSGASITDSSSHYGTAWIRQPAGKALEWINIIYYSGGIDAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARRA
Pygocentrus nattereri V321 ighv MAUM01036450.1 10275 VFCATELIQPDSVLIKPAEPLTITCTVSGASITSSSHYGTAWIRQPAGKTLEFINGIDYDAYKRAGASLKSKFSISRDTTSNTVTLQGQNLQAEDTAVYYCARY
Pygocentrus nattereri V320 ighv MAUM01036449.1 1757 CRCQTLTESEPALVTPGGSHTLTCTFSGIDVSSADISWIRQAPGKGLEWISHISAPSGSTKEYSQSVQGRFTISRENSKKQVYLQMSSLKTEDTAVYYCAR
Pygocentrus nattereri V313 trav MAUM01036416.1 30 KDTVLQPRRQQWASERETVTLDCEYNTTSSNPTLLWYQQKDQHSPKYILLTNSYGAGDTAAEFKERFHSNLSTRTAPLMIQKLSVSDSAVYYCALQ
Pygocentrus nattereri V312 trav MAUM01036414.1 6152 GIEPSSSTVSVLQGDSVTLSCNYTGSAFTDYLLWYRQYPRSRPEFLILVSETNITQNADPPVAGVGTNIIQEKNRVDLLISCAAVSDSALYYCALR
Pygocentrus nattereri V311 trav MAUM01036412.1 2435 VSSEDLITSHGSVKHARDGESVTLSCNYSVSQYGLFWYRQYSRSKPEFLLSTTESGGTVKADPAAQFSATVDKIQNSKVLNLVISSAAVSDSALYYCALT
Pygocentrus nattereri V310 trav MAUM01036408.1 2400 DSFENVIRSYGSVIPARDGETVTLSCNYSVPPYGLFWYRQYSRSKPEFLLSTTESGDPVEADSSARLSAVADRNSKVMNLTISSAAVSDSALYYCALR
Pygocentrus nattereri V309 trav MAUM01035385.1 386 GNIDISCIDGMKTIEDKENISLTCSFLQPYVLAVVWFRQTPGENALLIASAFTSSPKYHNDFDKSGRFIAVRGQSSFTLSISNAEPSDSATYYCAVADYS
Pygocentrus nattereri V308 ighv MAUM01034096.1 150 VKCQSMESLETAVQLKPGETLSLSCRGSGFTFSSYHMNWIRQQAGKPLEWMGWTAGNYAKPFQGRTEITRDDSNSMVYLKVSGVTAEDSAVYYCAR
Pygocentrus nattereri V307 ighv MAUM01034096.1 2898 VKCQSMESLQTAVQLKPGETLSLSCRGSGFTFSSYNMNWIRQQAGKPLEWMAEVWSSGSNKAKSFDGRAEFTKDNSNSMVSLKLSGVTVEDSAVYYCAR
Pygocentrus nattereri V305 ighv MAUM01034096.1 9827 VKCQSMESLETAVQLKPGETLSLSCRGSGFTFSSYNMNWIRHQAGKPLEWIGYVRYDGGSNGYAASFQGRTEISRDNSNSVTYLKLSAVTLEDSAVYYCAR
Pygocentrus nattereri V304 ighv MAUM01034096.1 12547 VKCQSMESLQTAVQKKPGETLSLSCRGSGFSFDCCTMHWVRQQPGKPLEWLGAGYSSASNDYAKSFQGRIEITRDDSNSMMYLKLSGVTVEDSAVYYCAK
Pygocentrus nattereri V303 ighv MAUM01034096.1 15599 VKCQSMESLQTAVQLKPGETLSLSCRGSGFTFSSYDMHWIRQQAGKPLEWMAEVWVGGGRKAKSLESRMEFNKDNSNSLVSLKLSGVTVEDSAVYYCARS
Pygocentrus nattereri V302 ighv MAUM01034094.1 819 VKCESMESLQTVVQLKPGETLSLSCRGSGFTFSSYNMHWIRQQAGKPLEWMGWTAGSYAKPFQGRTEITRDNSNSMVSLKLSGVTVEDSAVYYCAR
Pygocentrus nattereri V301 ighv MAUM01034093.1 337 GKCQSVESLQTAVQLKPGETLSLSCRGSGFTFSSYDMHWIRQQAGKPLEWIAEVGSSGSNKAKSFDGRAEFTKDDSNRMVYLKLSGVTVEDSAVYYCASE
Pygocentrus nattereri V300 ighv MAUM01034093.1 2446 VKCESMESLQTAVQLKPGETLSLSCRGSGFTFSSYAMHWIRQPAGKPLEWIAQVLTSGGRKAKSLESRMEFNKDNSNSMVYLKLSGVTVEDSAVYYCAR
Pygocentrus nattereri V299 ighv MAUM01034093.1 6300 VKCQSMESLETAVQLKPGETLSLSCRGSGFTFSSYDMHWIRQQAGKPLEWIAEVWSSGSNKAKSLEGRLELKKDNSNSMVYLKLSGVTVEDSAVYYCASE
Pygocentrus nattereri V298 ighv MAUM01034092.1 2243 VHSVELTQPGSMVINPGQSMSLTCTVSGYSLTSYWTHWIRQPAGKALEWIGQIHGDGSTYYSDKLKSRFQLAVDTSSSTVTLRGQNMQTGDTAVYYCARE
Pygocentrus nattereri V297 ighv MAUM01034092.1 6326 VYCVELIQPGSMVKNPGQSMSLTCTVSGYSLTSYWTHWIRQPAGKALEWIGQTYAAGTSYYSDKLKSRFQLAVDTSSSTVTLSGQNLQTGDTAVYYCARE
Pygocentrus nattereri V296 ighv MAUM01034092.1 9848 VYSVELVQSGPTVVRPGQSMSLTCKVSGYSLSDSTFCSHWIRQPAGKALEWIGVTCGRGTVYYSDKLKSRFEITRGTSITTMTLRGQNMQTGDTAVYYCARE
Pygocentrus nattereri V319 ighv MAUM01036448.1 1842 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSNHYATTWIRQPAGKAPEWINNMYHDGSIVAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARY
Pygocentrus nattereri V318 ighv MAUM01036448.1 4174 CRCQTLTESEPALVTPGGSHTLTCTFSGISVSSADISWIRQAPGKGLEWIAFISAPSGSTKEYSQSVRGRFTISRENSKQQVYLQMSSLKTEDTAVYYCART
Pygocentrus nattereri V317 ighv MAUM01036448.1 5870 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSSHWGTSWIRQPAGKAPEWINMIYHDGGIAAKDSLKSKFSVSRDTRRNTVTLQGQNLQAEDTAVYYCARD
Pygocentrus nattereri V316 ighv MAUM01036447.1 2366 VDCAVELIQTRSVGVKPGESLTLICTASGYSVTNTNYATVWIRHPAEKTLEWISHIWGGGQSYRAQSLKKFGISKDASSNTVTLQGQNMQPEDTAVYYCIR
Pygocentrus nattereri V315 ighv MAUM01036447.1 8798 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDGSSHWATGWIRQPAGKALEWISRIDYDGEIFVKASLKSKFSVSRDTSRNTVTLQGQNLQAEDTAVYYCARYS
Pygocentrus nattereri V314 ighv MAUM01036446.1 196 SCSQTLTESDPVVLKPDQSHKLTCTASGLDFDSYWMAWIRQAPGKGLEFVATIEYDSASKYYSSAVTGRFTISRDNSKDQVYLQMSRLKTEDTAVYYCA
Pygocentrus nattereri V370 trav MAUM01038968.1 11956 KCAAQSIEPLENKIHALEDETVTLSCKYESTATSNYLQWYRQYPGSRPEYLLMLFPTTKAVSHAIPPFPRLNVTEQTNIVNLTISSAAVSDSALYYCALK
Pygocentrus nattereri V369 trav MAUM01038845.1 1756 AVVPLEGEIHVSEGDNVTLSCNYTSSFVGDVLQWYRQFPRSGPGFLLSINLYASKSDPPPRMSVELYQDNKRVDLIISSAAVSDSTLYYCALQ
Pygocentrus nattereri V368 trdv MAUM01038844.1 10619 VFGADQIGPNDQETDVFRKEGEPVTLNCSYETSSEDVWLFWYRQSPNRALQHLLWKGARSRSHSHISDHRFSSTTSRYSTELTVTELRLADTALYYCA
Pygocentrus nattereri V367 trav MAUM01038844.1 14582 EDVITPSRDVVFAVEGQNVTLSCNYNGTTYGLHWYRQYSGSPPQFLILDYNGVITKAQPPVPGISINHVKDMKKVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V366 trav MAUM01038151.1 8225 KDAVFQPRRQQWASERETVTLDCEYNTTRTDPTLLWYQQKDHHSPKYILLKSKFGAGDTASEFRERFHSNLNSSTRTAPLMIQKLSVRDSAVYYCALQ
Pygocentrus nattereri V365 trav MAUM01038151.1 8225 KDAVFQPRRQQWASERETVTLDCEYNTTRTDPTLLWYQQKDHHSPKYILLKSKFGAGDTASEFRERFHSNLNSSTRTAPLMIQKLSVRDSAVYYCALQ
Pygocentrus nattereri V364 trdv MAUM01038104.1 508 KSSAQSIEPLGNKTQAHAREDETVTLSCQYEGNVNNLLWYRQYPGSRPEYLLLKYPGSADVTRADPTFLRLDATDDNKNNPKLWNLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V363 trav MAUM01038104.1 4210 NSSAQSIEPQNNKTQVHAREDETVTLSCEYVYIATVGSLQWYRQYPGSRPEYLLLKYPGSTDVTRADPTFLRLDATDENTDNKKFWNLSISSAAVSDSALYYCAMT
Pygocentrus nattereri V362 trav MAUM01038102.1 2421 NSSAQSIEPLDNKVLIHAREDETVTLSCQYEGSMDSLQWYRQYPGSRPEYLLLKYRGSTDVTRADPTFLRLDATDDNKNTKKFWNLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V361 trav MAUM01038100.1 305 NSSAQSIEPLGNKTKVHAREDETVTLSCEYVDSGTVQSLQWYRQYPGSRPEYLLQKYPGSTDVTRADPTFLRLDATDDNTDNKKLWKLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V360 trav MAUM01038100.1 6097 NSSAQSIEPLDNKVLIHAREDETVTLSCEYKYSATPSSLLWYRQYPGSRTEYLLLKYPGSADVTRADPTFLRLDATDDNKNNTKLWNLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V359 trav MAUM01038100.1 7945 NSSAQSIEPLENKTQVHAREDETVTLSCEYVDSGTVGSLQWYRQYPGSRPEYLLLKYRGSTDVTRADPTFLRLDATDDNTNTKKFWNLSISSAAVSDSALYYCALM
Pygocentrus nattereri V358 trdv MAUM01038100.1 14959 NSSAQSIAPLDNKVLIHAREDETVTLSCEYKYSATPNSLQWYRQYLGSRPEYLLLKYLGSADVTRADPTFLRLDATDDNTDDKKLWNLSISSAAVSDSALYYCGLT
Pygocentrus nattereri V357 trav MAUM01038100.1 18242 NSSAQSIEPLENKTQVHAREDETVTLSCEYVYSGTVESLQWYRQYPGSRPEYLLQKYPGSADLTRADPTFLRLDATDDNTNTKKFWNLSISSTAVSDSALYYCAMT
Pygocentrus nattereri V356 trdv MAUM01037861.1 2359 NCASQSIAPLDNKTQVHALEDERVILSCTYNGRVSNLQWFRQYPGSRPEFLLLKYPGASGVVPADPPFPRLDAKVNGSRVNLLISSAAVSDSALYYCALE
Pygocentrus nattereri V355 trav MAUM01037857.1 5844 DCSSQKIAPLENKTQVHAHEDQTVTLSCKYEYSGSVESLQWYRQYPGYRPEYLLMILPASKSVNYAMPRFPRLHITEKNKTVNLIISSAEVSDSALYYCAMK
Pygocentrus nattereri V354 trav MAUM01037857.1 12843 SCVSQSIAPLDDKVLVHALEDETVTLSCKYKSSTTPNNLQWYRQYPGSRPEYLLMILPAAKIVNYATPPFPRLNTTENNKTVNLIISSAAVSDSALYYCTMQ
Pygocentrus nattereri V353 trav MAUM01037857.1 15645 SCVSQSIGPLDNKVLIHAREDETVTLSCKYEYSTTPNSLQWYRQYTGYRPENLLLKYPGSADVTRADPTFLRLNATDNNNNWTLSISSAAVSDSALYYCAME
Pygocentrus nattereri V351 trdv MAUM01037855.1 477 GVSSISPLETEKQVSVGDTVTLSCSYSSSNVYIDWYRQYPSSKLDFLLYTDESGGWGGSPPPGFSAKVENKRVDLLISSAKLSDSALYYCAET
Pygocentrus nattereri V350 ighv MAUM01037765.1 801 VQSQVVLTQSERSVTVTPGGSHKLTCACSGFSVGGTNMHWIRQAPGKGLEWIIYYHSNSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V349 ighv MAUM01037764.1 5 SVSEEIRLDQSSAEVKKPGEAVKISCKISGYRMTSYNMGWIRQKPGQALEWIGYMSTGSNSATYADSVKDHFTMTEDVSTSTQFLEAKSLRAEDTAVYYCARQ
Pygocentrus nattereri V348 ighv MAUM01037764.1 2970 VQCYELTQPGSMVVRPGQSLTIDCKVSYSVTSDGTSWIRQPAGKALEWIGYIYTGGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V347 ighv MAUM01037763.1 953 VQCYELTQPGSMVVRPGQSLTIDCKVSYSVTSYGTSWIRQPAGKALEWIGYIYTDGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V346 ighv MAUM01037762.1 2884 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSDATAWIRQPAGKALEWIGGIGSNGGTGYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAGD
Pygocentrus nattereri V345 ighv MAUM01037762.1 5248 IISAGIRLDQSSAEVKKPGEAVKISCKISGFTMTEYFFHWIRQKPGQALEWIGRVNSGRSSDIIYADSMKDHFILTEDVSTSTQFLEARSLRAEDTAVYYCARR
Pygocentrus nattereri V344 ighv MAUM01037762.1 7763 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYATAWIRHPAGKALEYIGYIGSGGSPAYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V343 ighv MAUM01037762.1 12083 VHGISLSSSPAQLKPPGESVRLSCEVSGYRLSDYGTGWIRQPPGKALAWIGIIWGSGSIDTGASFKSRFKISRDTSSNVLFLDISSLESGDTAVYYCAKT
Pygocentrus nattereri V342 ighv MAUM01037762.1 14710 VHCEELTQSGSIVVRPGQSLTIDCKVSYSVTSYGTSWIRQPAGKALEWIGVIGSSGGTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V341 ighv MAUM01037761.1 2361 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFSLGGAYMSWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V340 ighv MAUM01037761.1 5257 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFDLSSYRMYWIRQAPGKGLEWIIYYYSDSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V339 ighv MAUM01037761.1 7774 LTQPGSMVVHPGQSLTIDCKVSYSVTSDWSAWIRQPAGKALEWIGRITSSGGTAYNDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V338 ighv MAUM01037760.1 522 VKCVDLIQPSSDLIKPGGSLTISCKVSGYSVTDSSYGTAWIRQPAGKTLEWINHIWGGGGTYQKESLKSKFSVSKDASSSTVTLQGQNMQPEDTAVYYCARYT
Pygocentrus nattereri V337 ighv MAUM01037760.1 3142 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYYWTGWIRQPAGKALEWIGYITNGGAIYYSDELKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V336 ighv MAUM01037758.1 368 VKCVDLIQPSSELIKPGGSLTISCKVSGYSVTDNSYATGWIRQPAGKTLEWINYIWGGGSTYQKESLKSKFSVSKDASSSTVTLQGQNMQPEDTAVYYCARYR
Pygocentrus nattereri V335 trav MAUM01037497.1 1805 NCVSQSIAPLKNTIHAVEDQTLTLSCKYNGSVNNLQWYRQYPGSRPVYLLMTFPGSPTVSHATPRFPRLDAKEKNKTLDLIISSAEVSDSALYYCALQ
Pygocentrus nattereri V334 trdv MAUM01037496.1 2026 NYVSQSIAPLDNKMQIHATESETVTLSCKYEYDRVARSLQWYHQYPGSRLEHLLMIIPGSKDVSYAAAPRMKVEENNKTLSLTISSAAVSDSALYYCAME
Pygocentrus nattereri V408 igkv MAUM01042452.1 4396 SFGDIIMTQTPGSQTVSRGDSVTFSCRSSEYSSDYVMWYLHKPGEAPKILIYDADNLWSGVPDRFSATYSGNDFTLKISGVQPEDAGDYYCQQGYSRP
Pygocentrus nattereri V407 trav MAUM01042099.1 1152 DTSAQKITPLTEEVQVSEGDNVTLSCTYSSSSTNDALQWYRQFPRSTPEFLLYIYPRGGMSDPLPPRMSAEVEENEHVNLSISSTAVSDSALYYCALR
Pygocentrus nattereri V406 trdv MAUM01042092.1 2688 DGSSQKIAPLDNKTQVHAHEDETVTLSCKYEYSGSVESLQWYRQYPGSRPEYLLMIFPASKIVSHATPPFPRLNATENNKTVDLIISSAAVSDSALYYCAMK
Pygocentrus nattereri V405 trdv MAUM01041980.1 3710 SCVSQSIGPLDNKVLVHAREDETITLSCKYESSGTGNYLHWYRQYPGSRPEYLLMKLSGSDVINYATPRFPRLDITENNKTVTLNISSAEVSDSALYYCAME
Pygocentrus nattereri V404 trgv MAUM01041980.1 8000 GIYSINPLETEKQVSVGDSVSLSCRYSSSNVHSIHWYRQYPSSKLDFLLRITESGSVWGSPPPGFYARVENKKVDLEISSAKLSDSALYYCAWR
Pygocentrus nattereri V403 trav MAUM01041754.1 365 NSSAQSIEPLGNKTKVHAREDETVTLSCEYVDSGTVQSLQWYRQYPGSRPEYLLLKYPGSADVTRADPTFLRLDATDDNTDDKKLWKLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V402 trav MAUM01041753.1 2670 NSSAQSIEPLGNKTKVHAREDETVTLSCEYVDSGTVQSLQWYRQYPGSRPEYLLLKYPGSADVTRADPTFLRLDATDDNTDDKKLWKLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V401 igkv MAUM01041606.1 496 IIMTQTPGSQTISPGDSVTISCRASQSINNWCAWYLQKPGEAPKLLIYKASTRQSGVPDRFSGSGSGSDYSLKISGVQSDDAGDYYCQQG
Pygocentrus nattereri V400 iglv MAUM01041600.1 2837 VSGVTVVTQKPPVLTPTKGETTTMHCNLGTVTGNVAAWYKQVPGEAPQYVLANYHGWSSPRYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSAVYY
Pygocentrus nattereri V399 trav MAUM01041489.1 1209 NTAADGIYPLSSEKHVLEGRDVTLSCNYNATSVQGLQWYRQYPGSRPEFLLFLTEFGGGSDPALRLTAEANRQMKRVDLNISHTVVSDSALYYCALV
Pygocentrus nattereri V398 trav MAUM01041369.1 679 DSFENVITSHGSVKHARDGETVTLSCNYSVTPYGLFWYRQYSRSKPEYLLSTTESGGSVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALT
Pygocentrus nattereri V397 iglv MAUM01041100.1 231 VSGVTVVTQKPPVLTPTKGETTTMHCNLGTVTDDSAKWYKQVPGEAPQYVLRNYHSFSSPRYGSGFSSPKFTSTHSSQSDYTLIISNVEVGDSALYYC
Pygocentrus nattereri V396 trav MAUM01040878.1 1003 NCVSQSIEPQENKIHAVKDETVTLSCKYNGSVDNLQWYRQYPGSRPEYLLMIYPATKAVSHATPPFPRLNVTVKKSRMNLIISSAAVSDSALYYCAMQ
Pygocentrus nattereri V395 trav MAUM01040876.1 452 NCVSQSITPLENKVLVHAREDETVTLSCKYVYSGTASSLQWYRQYPGSKPEYLLMILPASKSVNYAMPHFPRLYITEKNKTVNLIISSAEVSDSTLYYCAME
Pygocentrus nattereri V394 trav MAUM01040874.1 1725 SCVSQSIAPLENKVLVHAFEDETVTLSCKYEYGGSVNNLQWYRQYPGSRPEHLMMIIPTSKNENNAIAPFPRMDAKEYNKTMNLTISPAAVSDSALYYCAMV
Pygocentrus nattereri V393 trav MAUM01040638.1 11301 NSSAQSIEPLENKIQVHAREDETVTLSCEYNGDMRSLQWYRQYPGSRPEYLLQKYPGSADVTRADPTFLRLDATYDNTNTKKLWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V392 trav MAUM01040638.1 14485 NSSAQSITPLENKTQVHACEDETVTLSCEYEGSVDSLQWYRQYPGSRPEFLLWKYPGSNFITHADPPFPRLNAVDNNTKMNLIISSAEVPDSALYYCAVR
Pygocentrus nattereri V391 igkv MAUM01040549.1 1068 IIMTQTPASQTVSPGDSVTLSCRASQSIYSNLAWYLQKPGEAPKLLIYGATSRQSGVPDRFSGSGSGSDYSLKISGVQSEDAGDYYCQQYQSYP
Pygocentrus nattereri V390 igkv MAUM01040539.1 142 SSGQVTVTQTPSVKIVSPGDSLTISCRISTAVYKDDYLSWYQQKPGEAPKPLIYRATSKQSGVPARFSGSGSGTDFTLTISNVQIEDVGDYYCQS
Pygocentrus nattereri V389 igkv MAUM01040536.1 674 SSGQVTVTQPPVISSLPKETVQITCKTSPAVYRWSDGNEGLAWYQQKPGEGPKLLIYSIDDRASGIPARFSGSGSGSDFTLTISNVQTEDAGDYYCQSEHEISG
Pygocentrus nattereri V388 trav MAUM01040285.1 1212 NCVSQSIEPLENKVHALEDETVTLSCRYGSIDIGNYLHWYRQYPGSRPEYLLMIYAATKAVSHATPPFPRLNATENNKTVDLIISSAAVSDSALYYCALK
Pygocentrus nattereri V387 trav MAUM01040285.1 5795 NCVSQSIEPLENKIHALEDETVTLSCRYGSSATDNYLYWYRQYPGSRPEYLLMIYTALKAVSHATPPFPRLNATENNKTVNLIISSAAVSDSALYYCALK
Pygocentrus nattereri V386 trav MAUM01040285.1 9077 ICVSQSIKPLENTTQALENEKVTLSCKYVFDRVAKSLQWYRQYPGSRPEYLLMFIPATKAVSHATPPFPRLNVTENNKTVDLLISSAAVSDSALYYCALQ
Pygocentrus nattereri V385 trav MAUM01040223.1 821 KDTVLQPRRQQWASERETVTLDCEYNTTRTDPTLLWYQQKDHHSPKYILLTNSYGTGDTAAEFKERFHSNLSTRTAPLMIQKLSVRDSAVYYCALQ
Pygocentrus nattereri V384 trbv MAUM01040206.1 9518 SAQAVKNSETSVISVEPGKAVTLNCTLEGKSGEDVKMWYKQRLEHVPLEVGSQLEGKSAMISKEFGISKRFKINRIASGISLSIERVTKEDEGMYFCGSAGS
Pygocentrus nattereri V383 trav MAUM01040163.1 1010 SSKQDSVTPTSSAVSGKEKQTVILSCNYDYKVSMNNLQWYHQNTGAAPEFLVLVMESGQNQTADPPHPRLSTEVQKNVKRLDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V382 trav MAUM01040163.1 4270 VSSEDLITSHGSVKQARDGETVTLSCNYSVSQYGLFWYRQYSRSKPEFLLSTTESGGTVKADPAAQFSATVDKIQNSKVLNVVISSAAVSDSALYYCALQ
Pygocentrus nattereri V381 trav MAUM01040161.1 712 KDTVFQPRRQQWASERETVTLDCEYNTTNLDPTLLWYQQKDHHSPKYILLTNSYGAGDTAAEFRERFHSSLNSSTRRAPLMIQKLSVSDSAVYYCALQPTVTT
Pygocentrus nattereri V380 trav MAUM01040160.1 2597 NTAADGIYPLSSEKHVLEGGHVTLSCNYNATSVQGLQWYRQYPGSRPEFLLFLTEVGGGSDPALRLTAEANRQMKRVDLNISHTVVSDSALYYCALV
Pygocentrus nattereri V379 trav MAUM01039944.1 170 ETSAQTIEPLVREVHVSEGDHVTLSCNYSSTTYPLQWYRQFPRSKPEFLLYIYPQGGTSQSVPPRMSAEVEGNKRVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V378 trav MAUM01039943.1 11335 DTSAQTIESLAGEMPVSEGTNVTLSCSYSTSYTNDPLQWYRQFPRSRPEFLLYIYPKGDMSKPLPPRMSAEVEENKRVNLKISSAAVSDSALYYCALQ
Pygocentrus nattereri V377 trav MAUM01039943.1 17061 NTAAVGIQPLFFEKHVLEGEDVTLSCNYSAATGDTFQWYRQYPGSRPEFLLYLTEFNIASDSALRLTAEVKKQFEHVDLNISHTVASDSALYYCALQ
Pygocentrus nattereri V376 trdv MAUM01039299.1 1186 GVSSISPLETEKQVSVGDTVTLSCSYSTSNVYIDWYRQYPSSKLDFLLYTNESWGWDGSPPPGFSAKVENKRVDLLISSAKLSDSALYYCAET
Pygocentrus nattereri V374 trav MAUM01039297.1 3336 GVYSISPLETKKQVSVGDGVSLSCSYSTSNVYISWYRQYPSSKLDFLLYTDESGGWDGSPPPGFSAKVENKKVDLLISSAKFSDSALYYCALEPR
Pygocentrus nattereri V373 trav MAUM01039297.1 6066 KCAAQSIEPLENKIHALEDETVTLSCNYESTAISNYLHWYRQYPGSRPEYLLMIYPASKAVSHAAPPFPRLNVTENNKTVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V372 trav MAUM01039094.1 2445 ETADIIKQNQTSMLVSEGSNATLSCTYDGNVYSLHWYQQKPGSRPEFLLLIMESNRHITKAETLDERLSTLLNKQNKTVDLIISSAAVSDSALYYCAME
Pygocentrus nattereri V446 trav MAUM01047282.1 493 ETSAQTIEPLVGEVHVSEGDHVTLSCNYSSTSYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRMSAKVFTDKMQVDLEISFAAVSDSALYYCAQQ
Pygocentrus nattereri V445 ighv MAUM01047013.1 1310 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFTLSSYRMHWIRQAPGKGLEWIIYYHSNSYKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V444 trav MAUM01046854.1 1177 NSSAQSIEPLENKTQVHAREDETVTLSCEYNGDMRSLQWYRQYPGSRPEYLLMKYRGSADVTRADPTFLRLDATDVHTNNGTFWNLSISSTAVSDSALYYCALT
Pygocentrus nattereri V443 trdv MAUM01046843.1 1146 SCVSQSIGPLDNKVLVHAREDETVTLSCTYKFSGNVNYLHWYRQYLGSRPEYLLMILPGSNVINYATPRFPRLNVTENNKTVTLIISSAEVSDSALYYCAME
Pygocentrus nattereri V442 trav MAUM01046825.1 429 DSFENVIRSYGSVIPARDAETVTLSCNYSVSPYGLFWYRQYSRSKREFLLFITESRDPVKEAQLFATSDKNSKVMRLTIFPAAVSDSALYYCALQ
Pygocentrus nattereri V441 trav MAUM01046533.1 493 NCVSQSIEPLENKVHALEDETVTLSCTYKYDRVADSLQWYRQYPGSRAEYLLMIIPTTKAVSHATPRLPRLNVTENNKTVDLIISSAEVSDSALYYCALR
Pygocentrus nattereri V440 trav MAUM01046514.1 1823 NRAAELISPYTAAVFTNEGESVTLSCNYSGSVRRLYWYLQNSASPPQFLIADYSPPVTRISVKHRKEATSVDLIISSAAVSDSALYYCALE
Pygocentrus nattereri V439 trav MAUM01045884.1 1067 ETSAQTIEPLVGEMHVSEGDHVTLSCNYSSTSYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRMSAKVFTDKMHVHLEISSAAVSDSALYYCAQQ
Pygocentrus nattereri V438 trav MAUM01045713.1 749 DTSAQKIAPLVEELHVSEGDNVTLSCNYNTSTNDALQWYRQFPRSRPEFLLYIYSHGTLSDPLPPRMSAEVKDKKRVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V437 igkv MAUM01045507.1 91 IIMTQTPGSQTVSPGDSVTISCRASQGINNWLAWYLQKPGEAPKLLIYYATNRQSGVPGRFSGSGSGSDYSLKISGVQSEDAGDYYCQQYQSFP
Pygocentrus nattereri V436 igkv MAUM01045473.1 730 IIMTQTPGSQTVSPGDSVTISCRASQSINNWLAWYLQKPGEAPKLLIYGATTRQSGVPDRFSGSRSGTDFTLKISGVQSEDAGDYYCQQYQSFP
Pygocentrus nattereri V435 igkv MAUM01045439.1 2429 SSGQVTVTQTAVKTVSPGDSVTISCRTSPAVYNNNRLSWYQQKPGEACKLLIYWATSRQSGIPARFSGSGSGSDFTLTISNVQTEDAGDYY
Pygocentrus nattereri V434 iglv MAUM01045372.1 231 VSGVTVVTQKPPVLTPNKGEKTTMYCNLGTVTNIAAGWYKQVPGEAPQYVLVNYHGWSSPRYGSGFSSPKFTTTHSSQSDYTLIISNVEVGDSAVYYC
Pygocentrus nattereri V433 ighv MAUM01045253.1 83 CRCQTLTESEPALVTPGGSHTLTCTFSGIGVDDADISWIRQAPGKGLEWIAFISAPSGVAKEYCPSVQGRFTISRENSKKQVYLQMSSLKTEDTAVYYCARE
Pygocentrus nattereri V432 trav MAUM01045161.1 1250 SCSAQSIAPLENKMQVHAYEGETVTLSCTYEYDGVVSNLQWYRQYPGSRPEYLLMIIPASNNVIHATPPFPRLNADVDVNVRVDLLISSAAVSDSALYYCVMR
Pygocentrus nattereri V431 trav MAUM01045141.1 299 SCVSQSIAPLENKVLVHAFEDETVTLSCKYEYSVTVNNLQWYRQYPGSRPEHLMMIILTSKNENNAIAPFPRMDAKEYNKTMNLTISPAAVSDSALYYCAMQ
Pygocentrus nattereri V430 trdv MAUM01045074.1 1144 SCVSQSIGPLDNKVLVHALEDETVTLSCKYEFSGTGYLHWYRQYPGSRPEYLLMKLSGSNVINYATPRFPRLDITENNKTVTLIISSAEVSDSALYYCAMK
Pygocentrus nattereri V429 igkv MAUM01045021.1 1342 SSGQVTVTQTPAVKTVSPGDSVTISCRTSTSVLGGNYLAWYQQKPEEAPKLLIYYASSRQSGVPARFSGSGSVSDFTLTISNVQSEDAGDYYCQS
Pygocentrus nattereri V428 igkv MAUM01044962.1 886 SFGDIIMTQTPGSQTVSPGDSVTISCRSSQSISNDLAWYLQKPGEAPKLLIYYATSRHSGVPDRFSGSYSGTSFTLKISGVQPEDAGDYYCQQGYSRP
Pygocentrus nattereri V427 trav MAUM01044747.1 802 NSSAQSITPLENKTQVHAREDETVTLSCEYEGSVDSLQWYRQYPGSRPEFLLRKYPGSNFITHADPPFPRLNAVDNNTKMNLIISSAEVPDSALYYCAVT
Pygocentrus nattereri V426 trdv MAUM01044736.1 1033 SCVSQSIGPLDNKVLVHAPEDETVNLSCKYESSVTGNYLHWYRQYPGSRPEYLLMKLSGSDVINYATPRFPRLDITENNKTVTLIISSAEVSDSALYYCAME
Pygocentrus nattereri V425 trav MAUM01043919.1 3239 NSSAQSIEPLENKTQVHAREDATVTLSCEYVYSGTDNSLQWYRQYPGSRPEYLLLKYPGSTDVTRADPTFLRLDATDDNTDNKKFWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V424 trav MAUM01043768.1 1947 SCVSQSIGPLDNKVLVHAREDETITLSCKYESSGTGNYLHWYRQYPGSRPEYLLMKLSGSDVINYATPRFPRLDITENNKTVTLNISSAEVSDSALYYCALQ
Pygocentrus nattereri V423 trav MAUM01043553.1 911 NSSAQSITPLENKTQVHAREDETVTLSCEYEGSVDSLQWYRQYPGSRPEFLLRKYPGSNFITHADPPFPRLNAVDNNTKMNLIISSAEVPDSALYYCAVR
Pygocentrus nattereri V422 ighv MAUM01043547.1 378 FQSQTLTQSEAVVKKPGESHKLTCTTSGFTFSSYPMVWVRQAPGKGLEWIAFIHTASTPIYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V421 ighv MAUM01043546.1 372 FQSQTLTQPEAVVKKPGESHKLTCTASGFTFSSYRMVWVRQAPGKGLEWIAYISTASSPIYYAQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARRD
Pygocentrus nattereri V420 trav MAUM01043342.1 1259 SCVSQSIAPLENKVQLHALEDETVTLSCVYNGSVTNLQWYRQYPGSRPEYLLMIFPSNKVMHAIPPFPRLNATVKKSGVNLTISSAVVSDSALYYCAME
Pygocentrus nattereri V419 trav MAUM01043132.1 1681 SSISPLETEKQVSVGDTVTLSCSYSSSNVNRLYWYRQYPSSELDYLLYIFESWSLSDPLLPGFSAKVRNKRVDLLISSAKSSDSALNYCALE
Pygocentrus nattereri V418 trav MAUM01043132.1 5284 TADIIKQNQTSMLVSEGSNATLSCTYGGNVYILHWYQQKPGSRPEFLLLVDETTQHITKAETLERLSISLNKQSKTVDLLISSATVSDSAIYYCAMQ
Pygocentrus nattereri V417 igkv MAUM01043014.1 3991 SFGDIIMTQTPGSQTVSPGDSVTISCRASQNIDNWLAWYLQKPGEAPKLLIYYATNRQSGVPDRFSGSSSGTDFTLKISGVQSEDAGDYYCQQYNSRP
Pygocentrus nattereri V416 igkv MAUM01042966.1 317 SSGQVTVTQTPAVKTVSPGESVTISCRTSPAVYYDGSDYILAWYQQKPGEAPKLLIYWANRRQSGVPARFSGSGSGSDFILTISNVQTEDAGDYYCQS
Pygocentrus nattereri V415 trav MAUM01042895.1 712 NSSAQSIEPLDNKVLIHAREDETVTLSCQYEGSMDSLQWYRQYPGSRPEYLLLKYRGSTDVTRADPTFLRLDATDDNTNTKKFWNLSISSAAVSDSTLYYCAMR
Pygocentrus nattereri V414 trdv MAUM01042876.1 749 GLGDQIEPDQFNVIMKEEETVKLSCSYGSSSEDVDLYWYRQYPNRALQYLLQKGARSRGHLGHSPDPQFESVTSQSSTELTVKNLNLADSALYYCALWR
Pygocentrus nattereri V413 trav MAUM01042803.1 2331 GVYSIDPLETEKQVSVGDRVSLSCRYSSSNVYLYWYRQYPSSKLDLLLYTDESGNVWGSPPPGFTAKVQNKIMNLEVSSAKLSDSAPYYCASS
Pygocentrus nattereri V412 trav MAUM01042751.1 1715 DTSAQKIAPLVEELHVSEGDNVTLSCNYSTSPNDALQWYRQFPRSRPEFLLYIYSHGTLSDPLPPRMSAEVEDKKRVDLIISAAVSDSALYYCAL
Pygocentrus nattereri V411 trav MAUM01042725.1 682 NCSAQSVAPLDNKTQVHAVEDEIVTLSCRYEGRADNLQWYRQYPGSRPEFLLLKYPGAGGVVPADPPFPRLDATLHKDIVNLSISSAAVSDSALYYCALR
Pygocentrus nattereri V410 trav MAUM01042705.1 241 DTSAQKIAPLVEELHVSEGDNVTLSCNYSTSPNDALQWYRQFPRSRPEFLLYIYSHGTLSDPLPPRMSAEVEDKKRVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V484 ighv MAUM01057100.1 648 GFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSHFGTAWIRQPAGKALEWISTIYFDGNTQAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARQ
Pygocentrus nattereri V483 trav MAUM01057023.1 657 DSFENVITSHGSVKQARDGETVTLSCNYSVSPLSLFWYRQYSRSKPEFLLSTTESGVTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALR
Pygocentrus nattereri V482 trav MAUM01056789.1 124 DTSAQKIMPLTEEVQVSEGDNVTLSCTYSSSSSNDALQWYRQFPRSTPEFLLYIYPQGGMSDPLPPRMSAEAEENKHVNLSISSTAVSDSALYYCALR
Pygocentrus nattereri V481 igkv MAUM01056685.1 567 SSGQVTVTQTPAVKTVSPGDSVTISCRTSTAPACSPPCISWYQQKPEEAPKLLIYRATSRQSGVPARFSGSGSGSDFTLTINNVQTEDAGDYYCQS
Pygocentrus nattereri V480 trav MAUM01056440.1 681 KDTVLQPRRQQWASERETVTLDCEYNTTSLDPTLLWYQQKDQHPPKYISLKSKFGAGDTAAEFRERFHSNFSTRTAPLMIQKLSVRDSAVYYCALQ
Pygocentrus nattereri V479 trdv MAUM01056193.1 401 GVFSINPLETEKQVSVGDTVTLSCSYSTSDVYINWYRQYPSSKLDFLLYTDESGGWGGSPPPGFSVKVENKRVDLLISSAKLSDSALYYCAET
Pygocentrus nattereri V478 trdv MAUM01055864.1 401 GVFSINPLETEKQVSVGDTVTLSCSYSTSDVYINWYHQYPSSKLDFLLYTDESGGWGGSPPPGFSVKVENKRVDLLISSAKLSDSALYYCAET
Pygocentrus nattereri V477 ighv MAUM01055836.1 5 VGSQTLTESEPVVAKPGESHTLTCTASGLDVSSYYMGWNRQAAGKRLEFVGMRYSSSTYYAQSVQGRFTITRDDSKKQVSLHMTSLKPEDTAVYYCARG
Pygocentrus nattereri V476 trav MAUM01055786.1 477 GVSSINPLETEKQVSVGDTVTLSCSYSSSNVYIDWYRQYPSSKLDFLLYTDESGGWGGSPPPGFSAKVENKRVDLLISSAKLSDSALYYCAET
Pygocentrus nattereri V475 trav MAUM01055533.1 549 NTSGEGIEPSSSTVNVLEGDSITLSCKYNGSTTTDELLWYRQYSRSRPEFLILVNEANITQKAVPPVAGVSAKVNEQKNRVDLLISSATVSDSALYYCALR
Pygocentrus nattereri V474 igkv MAUM01055379.1 587 SSGQVTVTQPPVISSLPKETVQISCKTSPAVYRWSAGNEGLAWYQQKPGEAPKLLIYSIDDRASGIPARFSGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V473 igkv MAUM01055062.1 557 SSGQVTVTQTPAVKTVSPGDSVTISCRTSPAVYNNNRLSWYQQKPGEACKLLIYWATSRQSGIPARFSGSGSGSDFTLTISNVQTEDAGDYY
Pygocentrus nattereri V472 trav MAUM01055023.1 693 TADIIKQNQTSMLVSEGSNATLSCTYGGDVYSLHWYQQKPGSRPEFLLLIMESNQHITKAETLDERLSISLNKQNKTVDLEISSAEVSDSALYYCAME
Pygocentrus nattereri V471 trav MAUM01054432.1 238 VHCAELTQPASMVINPGQSMSLTCKVSGYSLTDSSYCTDWIRQPAGKALEWIGEICGDGSTDYSDKLKSRFEVSRASSSNTVTLRGQNMQTGDTAVYYCARD
Pygocentrus nattereri V470 trav MAUM01054193.1 277 NRAADVITPYTAAVFTNEGENATLSCNYSGSVRSLYWYLQNSASPPQFLIADYSPPVTGISVKHRKEATSVDLIISSAAVSDSALYYCALE
Pygocentrus nattereri V469 trav MAUM01053995.1 476 DSFENVITSHGSVKQARDGETVTLSCNYNVSPFGLFWYRQYSRSKPEFLLSTTESGVTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V468 trav MAUM01052882.1 549 NTSGEGIEPSSSTVNVLEGDSITLSCKYNGSTANENLLWYRQYSRSRPEFLILVNEANFTQKAVPPVAGVSAKVNEQKKHVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V467 ighv MAUM01052216.1 258 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSDRTAWIRQPAGKALEWINLIYFDGDTRAKDSLKSKFRISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V466 ighv MAUM01051788.1 945 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSYDSAWIRHPAGKALEWIGYITDGGSTAYNDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V465 trav MAUM01051244.1 374 EDVITPSRDVVFAVESQNVTLYCNYNGTAYGLHWYRQYSGSPPQFLILDYNGVITKAQPPVPGISINHVKEMNKVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V464 ighv MAUM01051205.1 469 VHCAELTQPASMVINPGQSMSLTCKVSGYSLTDSSYCTDWIRQPAGKALEWIGEICGDGSTDYSDKLKSRFEVSRDTSSNTVTLRGQNMQTGDTAVYYCARE
Pygocentrus nattereri V463 trdv MAUM01051168.1 796 NCVSQSISPLEDKMQVHALEGERANLSCKYDKADYLFWYRQYPGSRPEYLLTIIPSTKSVTPVLQQLKAEVDGKRVDLLISSAAVSDSALYYCAMT
Pygocentrus nattereri V462 trav MAUM01050995.1 463 NCVSQSIEPLENKIHALEDETVTLSCTYKYDRVAGSLQWYRQYPGSRPEYLLMFIPATKAVSHATPRLPRLNVTENNKRVDLIISSAAVTDSALYYCALR
Pygocentrus nattereri V461 trav MAUM01050647.1 427 YCSAQSIAPLENKTHIYALEDETVNLSCTYDGDVRTLYWYHQYPGSRPENLLLIVPGSKDESHERLKAKVDVKDNRVDLLISSAAVSDSALYYCALQ
Pygocentrus nattereri V460 ighv MAUM01050339.1 218 GVHSVELTQPASMVINPGQSMSLTCKVSGYSVTDSSYCTDWIRQPAGKALEWIGEICGDGRTYYSDKLKSRFAVSRDTSSNTVTLRGQNMQTGDTAVYYCARG
Pygocentrus nattereri V459 igkv MAUM01049546.1 212 SSGQVTVTQTPAVKTVSPGDSVTISCRTSPAVYNNNYLAWYQQKPGDAPKLLIYWATSRQSGIPARFSGSGSRSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V458 trdv MAUM01049042.1 784 NCVSQSIAPLEDKMQVHALEGERANLSCKYDKADYLFWYRQYPGSRPEYLLTIIPSTKSVTPVLQQLKAEVDGKRVDLLISSAAVSDSALYYCAMT
Pygocentrus nattereri V457 ighv MAUM01048959.1 1155 VQSQVVLTQSERPVTVTPAGSHKLTCACSGFNVGDYWMGWIRQAPGKGLEWIIGYYSESSKSSAQSVQGRFTASKDSSNLYLHMIQLKPEDTAVYYCATG
Pygocentrus nattereri V456 trdv MAUM01048922.1 266 NSSAQSIEPLKNKIQVHAREDETVTLSCEYNGDMRSLQWYRQYPGSRPEYLLLKYPGSTDVTRADPTFLRLDATYDNTNNRKFWNLSISSTAVSDSALYYCALT
Pygocentrus nattereri V455 trav MAUM01048809.1 731 NSSAQSIEPLDNKVLIHAREDETVTLSCEYKYSATPNSLLWYRQYPGSRPEYLLLKYLGSADVTRADPTFLRLDATDDNKNNKKLWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V454 ighv MAUM01048759.1 1097 VKCQNMESLQTAVQLKPGETLSLSCRGSGFTFSSYNMHWIRQQAGKPLEWMARVSDGGGSKSYPASFQGRTEITRDNSNSMVSLKLSGVTVEDSAVYYCARS
Pygocentrus nattereri V453 igkv MAUM01048418.1 764 SFGDIIMTQTPGSQTISPGDSVTISCRSSQSISIYLHWYLQKPGEAPKLLIYGATTRQSGVPDRFSGSGSGTDFTLKISGVQSEDAGDYYCQQSNSSP
Pygocentrus nattereri V452 ighv MAUM01048085.1 816 VKCQSMESLQTAVQLKPGETLSLSCRGSGFTFSSYSMHWIRQQAGKPLEWMGWTAGSYAKPFQGRTEITRDNSNSMVSLKLSGVTVEDSAVYYCAKQ
Pygocentrus nattereri V450 trav MAUM01047771.1 632 ESVDSIRPNETSMFVSEGSRTTLSCTYDGSPNSLHWYQQKPGSRPEFLLLIHVSTRRVTEAKIADPRLSITLPKDQNEVDLIISSAAVSDSALYYCAME
Pygocentrus nattereri V449 trav MAUM01047550.1 344 ETSAQTIEPLVGEVHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPEFLLYVTLQGTMSDPRPPRMSAKVFTDKMHVHLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V448 trav MAUM01047530.1 1598 DSFENVITSHGSVKQARDGETVTLSCNYSVSPYGLFWYRQYSRSKPEFLLSTTESGVTVKADPTAPFSATVDKSQSNKILSLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V522 trav MAUM01068182.1 52 NTSGEGIKPSSSTVNVLEGDSITLSCKYNGSTATDELLWYRQYSRSRPEFLIWVNEANFTQKAVPPVAGVSAKVNEQKNRVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V521 trav MAUM01068166.1 121 NTAAVGIQPLVFEKHVLEGADVTLSCNYSAATGDTFQWYRQYPGSRPEFLLFFNEHNNVSEPALRLTAGANRPVKFVDLNISRTAMSDSALYYCALV
Pygocentrus nattereri V520 ighv MAUM01067776.1 237 VHGISLSSSPAQLKPPGESVRLSCEVSGYRLSDYGTCWIRQPPGKAMEWIGIIWGSGSIDTGASFKSCFKISRDTSSNVLFLDISSLESGDTAVYYCAKT
Pygocentrus nattereri V519 ighv MAUM01067390.1 378 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDRSHLATAWIRHPAGKALEWINTIYYEGSKDAKDSLKSKFSVSRDTSRNTVTLQGQNLQAEDTAVYYCARR
Pygocentrus nattereri V518 trav MAUM01067326.1 8 GIEPSSSTVSVLQGDSVTLSCNYTGSASTDYLLWYRQYPRSRPEFLILVSETNITQNADPPVAGVGTNIIQEKNRVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V517 trav MAUM01067245.1 63 SCVSQSIGPLDNKVLIHALEDETVTLSCKYEYSATPNSLQWYRQYTGSRPEYLLLKYAGSADVTRADPTFLRLDATDNNNKWNLSISSAAVSDSALYYCAMQ
Pygocentrus nattereri V516 igkv MAUM01066662.1 404 VSSQKVLTQSPSVLTDQGRTVSLDCNIAKDENYVSWYKQIPQTAPQFVLSFYYSLSSPNLYGDNFPSSRFTSKASSSIDYQLIISNVEVGDAAVYYCGTWDSSASGGV
Pygocentrus nattereri V515 trav MAUM01066633.1 80 QTVVPHAGEIHVSEGDNVTLSCNYNTSDSNDVLQWYHQFPRSRPEFLLYIYLQGIKSHPLPPRMSAEVDKDNKRVDLLISSAAVSDSALYYCALK
Pygocentrus nattereri V514 trav MAUM01066096.1 386 KDTVLQPRRQQWASERETVTLDCEYNTTDTNPTLLWYQQKDHHSPKYISLKSKFGAGDTAAEFKERFHSKLNSSTRRAPLMIQKLSVRDSAVYYCALQPTVTT
Pygocentrus nattereri V513 trav MAUM01066020.1 32 GVYSINPVETEKQVSVGDSVSLSCRYSSSNVYRIHWYRQYPSSKLDFLLRITESGSVSGSPPPGFSAKVENKKVDLEISSTKLSDSALYYCALE
Pygocentrus nattereri V512 trav MAUM01066007.1 126 SCVSQSIAPLENKVLVHAFEDETVTLSCKYEYSGTVNNLQWYRQYPGSRPEYLMMIIPTSKNENNAIAPFPRMDAKEYNKTMNLTISPAAVSDSALYYCAME
Pygocentrus nattereri V511 ighv MAUM01065688.1 422 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSSAMAWIRQAPGKGPEWIAFLETSTYSYASSYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARG
Pygocentrus nattereri V510 ighv MAUM01065584.1 423 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSYYMAWIRQAPGKGLEWIAYIGTASSPIYYSQSVQGRFTVSRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V509 trav MAUM01065550.1 342 KDTVLQPRRQQWASERETVNLDCEYNTTDTDPTLLWYQQKDQHSPKYILLKRTFGAGDTAAEFRERFHSKLNSSTRTAPLMIQKLSVRDSAVYYCALQPTVTT
Pygocentrus nattereri V508 trgv MAUM01065182.1 360 YCSTQSIAPLENKTHIYALEDETVNLSCTYDGDVRTLFWYHQYPGSRPENLLLIVPGSKDESHERLKAKVDVKENRVDLLISSAEISDSALYYCALQ
Pygocentrus nattereri V507 ighv MAUM01065131.1 430 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSYAMAWIRQAPGKGLEWIAFIHTASTPIYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARRD
Pygocentrus nattereri V506 trdv MAUM01065024.1 313 GLGDQIEPDQFNVIMKEEEIVKLSCSYGSSSEDVDLYWYRQYPNRALQYLLQKGARSRGHLGHSRDPQFESVTSQSSTELTVKNLNLADSALYYCALWR
Pygocentrus nattereri V505 trav MAUM01064899.1 188 SCVSQSIAPLDNKVLVHAHEDETVTLSCKYESSGTGNYLHWYRQYPGSRPEYLLMIYPASKTVSHATPPFPRLNATENNKTVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V504 ighv MAUM01064653.1 444 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFNVGGYWMGWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCALD
Pygocentrus nattereri V503 trav MAUM01064419.1 298 NTSGEGIKPSSSTVNVLEGDSITLSCKYTGSTTNDDLLWYRQYSRYRPEFLILVNEANITQKAVPPVAGVSAKVNEQKNHVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V502 trav MAUM01064184.1 326 ESVDPIRPNETTISSSEGSRTTLSCTYDGSPYRLHWYQQWPASKPEFLVLVFVSNKLVTKAETLDPRLSITLQKESNKVDLEISSAAVSDSALYYCASE
Pygocentrus nattereri V501 iglv MAUM01063995.1 391 VSGVTVVTQKPPVLTPTKGEKTTMHCNLGTVTNYAAHWYKQVPGEAPKHVIRNRHSWSSPYYGSGFSSPKFISTCSSYSDCSVIISNVEVGDSAVYYC
Pygocentrus nattereri V500 ighv MAUM01063702.1 50 VKCQSMESLETAVQKKPGEALSLSCRGSGFNFGGNAMHWVRQQAGKPLEWIGIIWYDASKTIYAKPVEGRIEITRQNSQNMVYLKLTGLTEQDSAVYYCAK
Pygocentrus nattereri V499 trav MAUM01062949.1 419 NCVSQSIEPLENKIHALEDETVTLSCTYKYDRVAGSLQWYRQYPGSRPEYLLMFIPATKAVSHATPRLPRLNVTENNKTVDLIISSAAVSDSALYYCALQ
Pygocentrus nattereri V498 trav MAUM01062476.1 121 NTAAVGIQPLVFEKHVLEGADVTLSCNYSAATGDTFQWYRQYPGSRPEFLLLFNEHNNVSEPALRLTAGANTPVKFVDLNISRTAMSDSALYYCALV
Pygocentrus nattereri V497 trav MAUM01062034.1 150 NTAAVGIQPLVFEKHVLEGADVTLSCNYSAAPGATFQWYRQYPGSRPEFLLFFNEHNNVSEPALRLTAGANRPVKFVDLNISRTAMSDSALYYCALR
Pygocentrus nattereri V495 trav MAUM01061362.1 425 SCVSQSIAPLENKVLVHAFEDETVTLSCKYEYSVTVNNLQWYRQYPGSRPEHLMMIILTSKNENNAIAPFPRMDAKEYNKTMNLTISPAAVSDSALYYCAMQ
Pygocentrus nattereri V494 ighv MAUM01060930.1 193 VQCFELTQPGSMVVRPGQSLTIDCKVSYSVTSYYSAWIRQPAGKALEWIGRITSSGGTAYNDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V493 trav MAUM01060562.1 308 NSSAQSIEPLENKTQVHAREDETVTLSCEYVYSGTVDSLQWYRQYPGSRPEYLLLKYPGSTDVTRADPTFLRLDATDDNTDDKKLWNLSISSTAVSDSALYYCAMR
Pygocentrus nattereri V492 ighv MAUM01060157.1 269 VLSQTFIQSEAVIKRPGDSHKLTCTASGYTFSSYWAAVVRQAPGKGLEWVATIGTSSSPIYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V491 trav MAUM01059971.1 301 NSSAQSIEPLESKTQVHAREDETVTLSCEYNGDMRSLLWYRQYPGSRPEYLLMKYRGSADVTRADPTFLRLDATDVHTNNRTFWNLSISSIAVSDSALYYCALT
Pygocentrus nattereri V490 ighv MAUM01059375.1 229 VQSQVVLTQSERSVTVTPGGSHKLTCACSGFTLSSTWMGWIRQAPGKGLEWIINYYSESSKYSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCAIG
Pygocentrus nattereri V489 trav MAUM01059004.1 6 GAYSNTVSPLETKKQVSVGDSVSLSCSYSSSNMDSIHWYQQYPSSKLDFLLYITPSGRLSSSRPPGFSAKVENSRVDLLISSAKLSDSALYYCALE
Pygocentrus nattereri V488 trav MAUM01058186.1 150 NTAAVGIQPLVFEKHVLEGADVTLSCNYSAATGDTFQWYRQYPGSRPEFLLLFNEHNNVSEPALRLTAGANRPVKFVDLNITRTAMSDSALYYCALR
Pygocentrus nattereri V487 ighv MAUM01057829.1 118 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTSYNTAWICQPAGKALEWINLIFYDGDIRAKDSLKSKFSISTDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V486 trav MAUM01057715.1 277 NRAAELISPYTAAVFTNEGENATLSCNYSGSVRSLYWYLQNSASPPQFLIADYSPPVTGISVKHRKEATSVDLIISSAAVSDSALYYCALE
Pygocentrus nattereri V560 ighv MAUM01088017.1 55 IIRAEIRLDQSSAEVKKPGEAVKISCKISGYSMTSKYLHWIRQKPGQALEWIGRMNTGSNSATYADSVKDHFTMTEDVSTSTQFLEAKSLRAEDTAVYYCARY
Pygocentrus nattereri V559 trav MAUM01087732.1 195 EDVITPSRDVVFAVESQNVTLSCNYNGTTYGLHWYRQYSGSPPQFLILDYNGVITKAQPPVPGISINHVKEMNKVDLIISSAAVSDSALYYCALE
Pygocentrus nattereri V558 ighv MAUM01087190.1 50 VKCQSMESLETAVQKKPGEALSLSCRGSGFNFGGYAMHWVRQQAGKPLEWIGIIWYDASKTIYAKPVEGRIEITRQNSQNMVYLKLTGLTEQDSAVYYCAR
Pygocentrus nattereri V557 igkv MAUM01086133.1 67 VCGQIGFDQPAHLAVQPGQSLTIGCKISGYSLTDSSYCTNWIRHPAGKAMQRIGHVCGGGGTGYTDSLKSRFSITQDTSSSRVTLQGQNMQTEDAAVYYCVRYRN
Pygocentrus nattereri V556 trav MAUM01085435.1 151 KDTVLQPRRQQWASERETVTLDCEYNTTSTGPTLLWYQQKDQHSPKYILLKRTFGAGDTAAEFRERFHSKLNSSTRTAPLMIQKLSVRDSAVYYCALQPTVTT
Pygocentrus nattereri V555 trav MAUM01084570.1 181 GVYSINPVETEKQVSVGDSVSLSCSYSSSNVYLYWYRQYPSKLDFLLRVTESGRVSGSPPPGFSAKVENKRVDLEISSAKLSDSALFYCAEA
Pygocentrus nattereri V554 ighv MAUM01083748.1 83 CRCQTLTESEPALVTPGGSHTLTCTFSGIGVDDADISWIRQAPGKGLEWIAFISAPSGVAKEYSPSVQGRFTISRENSKKQVYLQMSSLKTEDTAVYYCARE
Pygocentrus nattereri V553 ighv MAUM01082792.1 79 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSYWSAWIRQPAGKALEWIGYITSSGSTAYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V552 trav MAUM01080582.1 244 NRAADVITPYTAAVFTNEGESATLSCNYSGSVRSLYWYLQNSASSPQFLIADYSPPVTGISVKHRKEATSVDLIISSAAVSDSALYYCALE
Pygocentrus nattereri V551 ighv MAUM01080205.1 220 FQSQTLTQSEAVVKKPGESHKLTCTASGFTFSSYRMVWVRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARE
Pygocentrus nattereri V550 ighv MAUM01079737.1 73 VKCVDLIQPSSELIKPGGSLTISCKVSGYSVTDNDYGTGWIRQPAGKTLEWINHIWGGGGIIQKESLKSKFSVSKDASSSTVTLQGQNMQPEDTAVYYCARLR
Pygocentrus nattereri V549 ighv MAUM01079034.1 228 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSYHGAAWIRQPAGRTLEWVNTFYYDGNKKTKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARR
Pygocentrus nattereri V548 ighv MAUM01078584.1 217 VQSQIVLTQSERSVTVTPGGSHKLTCACSGFTLSSTWMGWIRQAPGKGLEWIIYYYSESSKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCATG
Pygocentrus nattereri V547 ighv MAUM01078481.1 228 GFCATELIQPDSVLIKPAEPLTITCTVSGASITDRSYHGAAWIRQPAGRTLEWVNTFYYDGNKKTKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARE
Pygocentrus nattereri V546 trav MAUM01076737.1 115 KDTVLQPRRQQWASERETVTLDCEYNTTRTGPTLLWYQQKDQHSPKYILLKHTFGAGDTAAEFRERFHSNLNSSTRRAPLMIQKLSVRDSAVYYCALQPTVTT
Pygocentrus nattereri V545 ighv MAUM01076223.1 243 VQSQIVLTQSERSVTVTPGGSHKLTCACSGFSVRNTNMHWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCALD
Pygocentrus nattereri V544 ighv MAUM01075937.1 230 VFCATELIQPDSVLIKPAEPLTITCIVSGASITDRSYHGAAWIRQPVGRTLEWVSTFYYDGNKKTKDSLKSKFSVSQDTRRNTVTLQGQNLQAEDTAVYYCARQ
Pygocentrus nattereri V543 trav MAUM01075922.1 235 KDTVLQPRRQQWASERETVTLDCEYNTTRPDPTLLWYQQKDQHSPKYILLKRTYGAGDTAAEFRERFHSKLNSSTRTAPLMIQKLSVSDSAVYYCALQPTVTT
Pygocentrus nattereri V542 trav MAUM01075592.1 300 NSSAQSIEPLESKTQVHAREDETVTLSCEYNGDMRSLLWYRQYPGSRPEYLLMKYRGSADVTRADPTFLRLDATDVHTNNRTFWNLSISSIAVSDSALYYCALT
Pygocentrus nattereri V541 ighv MAUM01074690.1 193 VHCEELTQPGSMVVRPGQSLTIDCKVSYSVTTFYSAWIRQPAGKALEWIGRITSSGGTAYNDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAGE
Pygocentrus nattereri V540 trav MAUM01074493.1 92 NSVSQSIAPLENKIQVHALEDETVTLSCKYEYSGTMSGLQWYRQYPGSRPEYLLMIFPTTKAVSHATPPFPRLNATEHDKIVDLIISSAAVSDSALYYCTLQ
Pygocentrus nattereri V539 trav MAUM01073514.1 281 DSFENVITSHGSVIPARDGETVTLSCNYSITPYGLFWYRQYSRSKPEFLLSTTESGGTVKADPTAPFSATVDKSQSNKILSLVISSAAVSDSALYYCALQ
Pygocentrus nattereri V538 trav MAUM01073034.1 12 NTSGEGIKPSSSTVNVLEGDSITLSCKYNGSTTTDDLLWYRQYSRYRPEFLILVNEANFTQKAVPPVAGVSAKVNEQKNHVDLLISSAAVSDSALYYC
Pygocentrus nattereri V537 trav MAUM01072412.1 103 ESVDSIRPNETSVFVSEGSRTTLSCTYDGSPNSLHWYQQKPGLRPEFLLLIHVSSRHVTEAKIADPRLSIILPKDKNEVDLIISSAAVSDSALYYCAME
Pygocentrus nattereri V535 ighv MAUM01072286.1 334 VKCQSMESLETAVQKKPGEALSLSCRGSGFDFGGYYMHWVRQQAGKPLEWIGIIWYDASKTIYAKPVEGRIEITRQNSQNMVYLKLTGLTEQDSAVYYCAR
Pygocentrus nattereri V534 ighv MAUM01071948.1 153 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFNVGGTNMYWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V533 ighv MAUM01071751.1 303 VQSQVVLTQSERPVTVTPGGSHKLTCACSGFNVGGTNMYWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCARD
Pygocentrus nattereri V532 ighv MAUM01070926.1 71 CWSQTLIQSEAAVITPGGSHKLTCTASELHFDNYWMGWVRQAAGKGLEWVASISDNSQSKYYSQSVQGRFTISRDNSKDQLYLQMSSVKTEDTAVYYCVRE
Pygocentrus nattereri V531 igkv MAUM01070624.1 129 SSGQVTVTQTPAVKTVPPGDSVTISCRTSTSVHGGSYLAWYQQKPGEAPKLLIYYATSRQSGVPDHFSGRGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V530 igkv MAUM01070175.1 226 SSGQVTVTQTPAVKTVSLGDSVTISCRTSPSVGTCSGSPCLAWYQQKPGEAPKLLIYAATSRQSGVPARFSGSGSGSDFTLTISNVQTEDAGDYYCQS
Pygocentrus nattereri V529 ighv MAUM01070137.1 258 VHCFELTQPGSMVVRPGQSLTIDCKVSYSVTSDRTAWIRQPAGKALEWINLIYFDGDTRAKDSLKSKFRISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V528 ighv MAUM01068917.1 158 VQCFELTQPGSMVVRPGQSLTIDCKVSYSVTSYYSAWIRHPAGKALEWIGFIYSDGSTDYSDKLKSKFSISRDTGTNTITLQGQNLQTEDTAVYYCAR
Pygocentrus nattereri V527 trdv MAUM01068649.1 357 GASKIDVPCADGLKYIQNGENITLNCPFLSFDVKATAWLKQTAGEKPLVIAYAYRTTTVKYYDGFHESGRFNALREISSFTLSISNAEPSDSATYYCVAADYT
Pygocentrus nattereri V526 ighv MAUM01068620.1 63 VESQTLTESEPVVAKPGESHTLTCTASGLDVSSYYMGWNRQAAGKRLEFVGIRHSSTTYYAQSVQGRFTITRDDSKKQVSLHMTSLKPEDTAVYYCARGTQ
Pygocentrus nattereri V525 ighv MAUM01068552.1 249 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSYWSAWIRQPAGKALEWIGYITSSGSTGYSDKLKSKFSISRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V524 igkv MAUM01068215.1 67 VCGQIGFDQPAHLAVQPGQSLTIGCKISGYSLTDSSYCTNWIRHPAGKAMQRIGHVCGGGGSGYTDSLKSRFSITQDTSSSRVTLQGQNMQTEDAAVYYCVRYRN
Pygocentrus nattereri V579 ighv MAUM01136937.1 11 INCIELTQPGSMVLTPGQSMSLTCKVSGYSVTDSSYCTHWIRQPAGKALEWIGDICGNGNTYYSDKLKSRFQVSRDTSTSTVTLRGQNLQIGDTAVYYCA
Pygocentrus nattereri V578 trav MAUM01136026.1 23 ETSAQTIEPLVGEMHVSEGDHVTLSCKYSSTSYPLQWYRQFPRSRPEFLLYITLQGTMSDPRPPRMSAKVFTDKMQVDLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V577 trav MAUM01127403.1 25 NTAADGIYSLSSEKHVLEGADVTLSCNYSAATGNRFQWYRQYPGSRPEFLLYLTEFNNASDSALRLTAEVKKQFEHVDLKISHTVMSDSALYYCALQ
Pygocentrus nattereri V576 trav MAUM01123616.1 3 QTVVPHAGEIHVSEGDNVTLSCNYNTSDSNYVLQWYHQFPRSRPEFLLYIYPQGIKSHPLPPRMSAEVDKDNKRVDLLISSAAVSDSALYYCALK
Pygocentrus nattereri V575 trav MAUM01112959.1 37 GIEPSSSTVSVLQGDSVTLSCNYTGSAFTDYLLWYRQYPRSRPEFLILVSETNITQNADPPVAGVGTNIIQEKNRVDLLISSAAVSDSALYYCALR
Pygocentrus nattereri V574 trav MAUM01112007.1 35 QTVVPHAGEIHVSEGDNVTLSCNYNTSDSNDVLQWYHQFPSSRPEFLLYIYPQGIKSHPLPPRMSAEVDKDNKRVDLLISSAAVSDSALYYCALK
Pygocentrus nattereri V572 trdv MAUM01104126.1 76 ADVITPYTAAVFTNEGESATLSCNYSGSVRNLFWYLQNSASSPQFLIADYSPAVTGISVKHRKEATSVDLIISSAAVSDSALYYCALEPTVTA
Pygocentrus nattereri V571 ighv MAUM01102466.1 80 LTQPGSMVVRPGQSLTIDCKVSYSVTSYYSAWIRQPAGKALEWVGYISWDSSGSTSYSDKLKSKFSISRNTGTNTITLQGQNLQTEDTAVYYCA
Pygocentrus nattereri V570 trav MAUM01102037.1 31 NRAAELISPYTAAVFTNEGESATLSCNYSGSVRNLYWYLQNSASPPQFLIADYSPPVTGISIKHRKEATSVDLIISSATVSDSALYYCALQ
Pygocentrus nattereri V569 ighv MAUM01102005.1 77 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSSHYGTGWIRQPAGKALEWINTIYYDGSIAAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARD
Pygocentrus nattereri V568 ighv MAUM01101870.1 70 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSRHWGTSWIRQPAGKALEWINMIYYDGSKNAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARQ
Pygocentrus nattereri V567 ighv MAUM01101524.1 77 VFCATELIQPDSVLIKPAEPLTITCTVSGASITDSSSHYGTAWIRQPAGKALEWINTIDYDGSIVAKDSLKSKFSVSRDTSSNTVTLQGQNLQAEDTAVYYCARD
Pygocentrus nattereri V566 trav MAUM01101322.1 52 KDTVLQPRRQQWASERETVTLDCEYNTTNLDPTLLWYQQKDHHSPKYILLKCTFGAGDTAAEFRERFHSKLNSSTRTAPLMIQKLSVSDSAVYYCALQPTVTT
Pygocentrus nattereri V565 trav MAUM01101027.1 74 NTSGEGIEPSSSTVNVLQEDSVTLSCKFNGSAGSDYLLWYRQYSRSRPEFLISVSETNFTQNADPPVAGVSAKVNKEKDRVDLLISSAEVSDSALYYCALR
Pygocentrus nattereri V564 trav MAUM01097148.1 103 ESVDSIRPNETSVFVSEGSRTTLSCTYDGSPYSLHWYQQKPGSRPEFLLLIHVSSRRVTEAKIADPRQSIILPKDKNEVDLIISSAAVSDSALYYCAME
Pygocentrus nattereri V563 ighv MAUM01093236.1 132 VHCFELTQPGSMVVRPGQSLTIDCKVSYSVTSYTTAWIRQPAGKALEWVGYISSDSSGSTAYSDKLKSKFSISRDTGTKTITLRGQNLQTEDTAVYYCAKG
Pygocentrus nattereri V562 trav MAUM01093036.1 121 EDVITPSRDVVFAVEGQNVTLSCNYNGTAYGLHWYRQYSGSPPQFLILDYTGVITKAQPPVPGISINHVKEMNKVDLLISSAAVSDSAHYYCALQ
Pygocentrus nattereri V580 trdv MAUM01139551.1 25 SCVSQSIAPLDNKVLVHAREDETVTLSCTYKSSGNVEYLHWYRQCLGSRPEYLLMILPGSNIVNYATPPFTRLNTTENHKTVNLIISSAAVSDSALYYCAMK
Pygocentrus nattereri V573 trdv MAUM01108394.1 22 GASKIDVPCADGLKYIQNGENITLNCPFLTFDVMVTAWLKQTPGEKLLVIAYAYRTTTVKYYNGFHESGRFNALRELSSFTLSISNAEPSDSATYYCVAADYT
Pygocentrus nattereri V561 ighv MAUM01091692.1 7 TYGQSLTSSESVVEKPGTSVTLSCSVSGLSLSWLHWIRQKPGQGLQWIGRIDDGTGTRFAQSLQGQFSITKDTSKNMVYLQVKSLKAEDTAVYYC
Pygocentrus nattereri V536 ighv MAUM01072293.1 295 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTGYSTAWVRQPAGKALEYIGYIYSGGSTYYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCARD
Pygocentrus nattereri V523 trav MAUM01068209.1 292 KDTVLQPRRQQWASERETVTLDCEYNTTAQTPTLLWYQQKDHHSPKYILLKRTYGAGDTAAEFRERFHSNLNSSTRRAPLMIQKLSVRDSAVYYCALQPTVTT
Pygocentrus nattereri V496 ighv MAUM01061422.1 243 VQSQIVLTQSERSVTVTPGGSHKLTCACSGFSVRNTNMHWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCALD
Pygocentrus nattereri V485 iglv MAUM01057162.1 660 VSGVTVVTQKPPVLTPTKGEKTTMHCNLGTVIDKAVWYKQVPGEAPQYVLRNYHGWSSPNYGSGFSSPKFTSTCSSNSDCSVIISNVEVGDSAVYY
Pygocentrus nattereri V451 trav MAUM01047839.1 685 NSSAQSIEPLDNKVLIHAREDETVTLSCQYEGNVKSLLWYRQYPGSRPEYLLLKYPGSTDVTRADPNFLRLDATDDNTDDKKLWNLSISSTAVSDSSLYYCALT
Pygocentrus nattereri V447 trdv MAUM01047474.1 278 NCASQSIAPLDNKTQVHALEDERVILSCTYNGRVTNLQWFRQYPGSRPEFLLLKYPGASGVIPADPPFPRLDAKVNGSTVDLLISSAAVSDSALYYCALQ
Pygocentrus nattereri V409 trav MAUM01042624.1 1847 GVYSINPLETEKQVSVGDRVSLSCRYSSSNVYLYWYRQYPSSKLDFLLYTDESGRVSGSPPPGFTAKVQNKIMNLEISSAKLSDSAPYYCASR
Pygocentrus nattereri V375 trav MAUM01039298.1 5919 SCVSQSIGPLDNKVLVHAHEDETVTLSCNYESSLTGYLHWYRQYPGSRPEYLLMKRSGSDVISYATPRFPRLDITENNKTVTLIISSAAVSDSALYYCALK
Pygocentrus nattereri V371 trdv MAUM01039094.1 3449 SCVSQSIAPLDNKVLVHAREDETVTLSCKYESSGNVDYLQWYRQYLGSRPEYLLMILPGSNVINYATPPFPRLNTTENNKTVNLIISSAAVSDSALYYCAMK
Pygocentrus nattereri V352 trav MAUM01037856.1 795 DCSAQSIAPLENKTQAHAHEDDTVTLSCKYEYSFTVNSLQWYRQYPGSRPEYLLMIVPGSTTVSHATPPFPRLNAKENNKTVNLIISSAAVSDSALYYCAMQ
Pygocentrus nattereri V333 trav MAUM01037495.1 551 DCSAQSIAPLENKMQVHALQHETVTLSCRYDGNVYNLQWYRQYPGSRPEHLLMIFPESKAVIHADPPFPRLNATADKSTVDLLISSATVSDSALYYCALQ
Pygocentrus nattereri V306 ighv MAUM01034096.1 8142 VKCQSMESLETAVQRKPGETLSLSCRGSGFTFSSYYMNWIRQQAGKPLEWMGYISGSGGSKGYAASFQGRTEITRDNSNSMVYLKLSGVTVEDSAVYYCAR
Pygocentrus nattereri V295 ighv MAUM01034092.1 12794 VYSVELTQSGPTIVRPGQSMSLTCKVSGYLLTDGRYCTGWIRQPAGKALEWIGVICANGYTSHSNELNSRFEVTRDTSSNTVFLRGQNLQTGDTAVYYCARE
Pygocentrus nattereri V283 trav MAUM01032741.1 4033 NSSAQSIAPLENKTQVHAREDETVTLSCQYEGSVNNLQWYRQYPGSRPEFLLLKYPGSADVTRADPNFLRLDATDDNKNNPKLWKLSISSAAVSDSALYYCAMR
Pygocentrus nattereri V257 trdv MAUM01026329.1 14135 IDIPCLNGLKSIPNGGNIHLTCFFSSADASATTWFKQVPGEKPLLIASAFHSGKVTYHNNANKRGHFNALRDRSSFNLSISNAEPSDSATYYCAVAYYASVALLD
Pygocentrus nattereri V246 trgv MAUM01014093.1 2739 VLGVTVEQNELFWTKQAGKSVYISCKVRDLTTDYIHWYQQKDGNALKRILYIKHDDTRPTYDPNFQEAREFSMKVDKKSNAYDLKVDTLKTSHSAVYYCACWERD
Pygocentrus nattereri V219 trav MAUM01002189.1 62823 AQVIQVHQNPEELIVSPGSPLKVFCSISGIANPYLYWYQWTPAAGFTLVFTSLSSGSVNPQRKDQFKSSRPGELQIVLESDGVSESDSAVWYCAAS
Pygocentrus nattereri V183 ighv MAUM01071486.1 413 VQSQIVLTQSERSVTVTPGGSKKLTCACSGFTLSSSRMHWIRQAPGKGLEWIMHYYTDSDKGSSQSVQGRFTASKDSSNLYLHMSQLKPEDTAVYYCATG
Pygocentrus nattereri V181 ighv MAUM01071014.1 369 VHCVELTQPGSMVVRPGQSLTIDCKVSYSVTSYRTDWIRQPAGKALEWIGGIDSSGSTAYSDKLKSKFSFSRDTGTNTITLRGQNLQTEDTAVYYCAR
Pygocentrus nattereri V150 ighv MAUM01050022.1 86 FQSQTLTQSEAVVKKPGESHKLTCTASGSSFSSYYMAWIRQAPGKGLEWIAYIETSTYSYRSYYSQSVQGRFTISRSDSSSQLYLQMNSLKSEDTAVYYCARD
Pygocentrus nattereri V143 trav MAUM01047458.1 1139 ETSAQTIEPLVGEVHVSEGDHVTLSCKYSSTSYPLQWYHQFPRSRPEFVLYVTLQGTMSDPRPPRMSAKVFTDKMHVHLEISSAAVSDSALYYCALQ
Pygocentrus nattereri V105 trbv MAUM01039735.1 2212 GVYSINRLEAEKQVSVGDSVSLSCSYSRGSVYRLYWYRQYPSSKLDYLLYITPTGGLSGNEPPGVSARVENNRVDLVISSAKLLDSALYFCASR
Pygocentrus nattereri V82 trav MAUM01034494.1 9601 VECIELVQPAAMAVKPGQSFSIACKVTGYSVTVRYCTNWIRHSAAKAPEWIGYFCSTSNTGTKGPLRSKISFTADSSSNTVYLRGQNFQSADSAVYYCARD
Pygocentrus nattereri V67 igkv MAUM01023630.1 25413 QVVLTQSGDQTVQAGKTVTITCNHHPISNCINNQEEKKECISWYHQIPGEAPKLLMYYIDVRASGVSSRFSGSTSGNEVDFSLTISEVQPEDSGVYYCQS
Pygocentrus nattereri V42 trbv MAUM01002188.1 288147 LSAAVNVNQSPLHITKNRTESDEIMCSHNHKDYDRILWYKHSNQTFELMGNVYSTLPNIEPHYQGKIILEGDAVRYSLTMMNLSFEDTAVYFCAARR
Pygocentrus nattereri V6 trav MAUM01002188.1 167264 SAASDEVSQTPLDLFKKPGKSAELQCSHKSSSYNTILWYKQTRTRQLQLMGYLFTTSNNSEPEFSKKITLAGSGQNTGILTINTLTSNDSAVYYCAA