WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhincodon typus LVEK00000000.1 (LVEK01) 16 0 0 1 8 5 2 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhincodon typus V15 igkv LVEK01854928.1 829 TQSPVAVTRKECQSVSINCVFNSRNSYHYFESGSFFRQTREATEWERISGDGRFVVSMNKAQETFSLEIRDIRIEDSATYYCKAQYYVHSDGP
Rhincodon typus V14 trav LVEK01830705.1 3081 SPSLVSRSPAVQTSVTGDTVTLSCEYSGSCQYTVYWYRQSLGEGLKYLLQSYTSGEQNKENAAGGRISAAIDSSAKISRLKISTIRLSDSAVYYCALGQRSA
Rhincodon typus V13 trav LVEK01901750.1 497 SASQTVAAFAVNEGDDIQLFCNYSTISNNPDLFWYRQHSSGAMQFLLQKNQYSGTPASILRDRISSDFELMNHTIQLKVLETELSDSAVYYCTLNPI
Rhincodon typus V12 trbv LVEK01887427.1 5676 ILASRVEQSPSIMSISRGDYDTFKCTLKNTDCSFMYWYRQRPDREIEALFYSAAKGAVTNYTSESYQAERLSETQFNLEVTSASTSQTAVYFCACSN
Rhincodon typus V11 trbv LVEK01883170.1 2561 FSDGVSVTQRDPSLTETAGEDVYLTCTYTGNVYELLWYRQYPGRKPEFAVRKVESGGTEFKSDFAQKRFSSTVQRSEKLFRLTISELLLSDSAVYFCAAR
Rhincodon typus V10 trbv LVEK01878021.1 2471 ILASYVEQSPYIISIAEGESKTLRCRLMDTSYPQMYWYRQQPNRAIEALFYSAATGAVTNYTSENYQAKRPSQTLFSLDLRSASSSHTAVYFCACSN
Rhincodon typus V9 trgv LVEK01816174.1 3485 APHTALSMPSATVLRQEEGSVTFECLSSNEKLLMKWGYVTPGSSETKWLMYWNPGEKKAIRMPGIEPRFSQSKSSKYGLKIDALRLEDSATYYCQSGEEGNDWCACG
Rhincodon typus V8 trav LVEK01815275.1 3254 SISQTAAAIAVNEGDDVLLFCNYTTTNSNPYLFWYRQHSRSSMHFLLQKNRYGEKGASFLKDRLSSDFDHVNRTIQMRVLKTELSDSAVYFCALNPT
Rhincodon typus V7 trav LVEK01737527.1 2370 SQQNTVEQPDPEMTVKEGDNVTVTCSLKTSDSTVYIYWYSLFPGQPPQHMVYMIAAKIMNRNPDLSDRFSFKFTQSTKVTELVINSTIFYDSAVYFCAMQ
Rhincodon typus V6 trav LVEK01710870.1 2511 ADSQTIHQTPVVVSSSAEDELELKCTVQGTSNPNMCWYREDPRKGLRFMFYSTGTDHINPDQPVDGFTAKRPSDSEFYLHTSSLRADHSATYYCAWS
Rhincodon typus V5 trgv LVEK01600915.1 366 KSIAQSLTQSPMSMIRAPGNTIWLDCKYEGSNFDNAVIHWYRQIPGQRLQRILYFKNPSETQSDIADITVFAEKNSETKTCSLLMRNVKEDDSGVYYCAFW
Rhincodon typus V4 trav LVEK01593492.1 1232 VTEGLQPVQSPLRLVIARDNVTTINCNERESTLQSMLWYRQSAGQGLTLIGYIRYGGTIQYEEKVQTRFEITGDGDRNSALKLLKAAPADSAMYFCATSD
Rhincodon typus V3 trbv LVEK01541976.1 110 NLSFYVEQSPSIVSITRGDSDTLKCMLKNTAYSYMYWYRQQPSRAIEALFYSTGEGLATNYTSESYQAKRPSETTFTLELKGASPSHTAVYFCACS
Rhincodon typus V2 trbv LVEK01535238.1 610 TSGQDSVSQHPSELSIREEETVILNCSYTAKYTGETLFWYIQYPGKSPKYILKRYDKAQGEILSEFSNRFSANLDKDKKTVPLSIARARFSDSAIYLCALSSTLIQG
Rhincodon typus V1 trav LVEK01525508.1 303 LCRGDSVSQTAAAISVNEGDDVQLFCNYSTISNDPDLFWYRQHTSGSMYFVLLKNQYSETPASFLQDRLSSDFDHVNCTIQLRVLKTELSDSAVYYCALS
Rhincodon typus V0 trav LVEK01478100.1 44 DSVSQPIANIKVNEGDDVQMFCNYTTTDSNPYLLWYRQNPRGSVEYLLQRSKYVANTQRFPGDRLSSEFDHVNRTILLIVLKTELIDCTVYYCALR