WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sebastes nigrocinctus AUPR00000000.2 (AUPR02) 13 3 1 3 2 4 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sebastes nigrocinctus V12 igkv AUPR02091907.1 2253 SSGEIILTQSPGSQSVVPGQTVSIRCKASSSTGNHLQWYLQKPGEAPKLLIYDAVTRFSGVSDRFSGIGSGTDTTDYTLIISGVQTADAGVYYCQQDESFP
Sebastes nigrocinctus V11 igkv AUPR02091669.1 4483 SSGEIILTQSPGSHSVVPGQTISIKCKASSSTGNSLHWYLQKPGEAPKLLIYAATNRQTGVSDRFSGSGSGTGYTDYTLTISGVQNEDAAVYYCQS
Sebastes nigrocinctus V10 igkv AUPR02080906.1 2175 STANPTVTQSPASKSAGVGETVSLSCTASTGVDDDLSWYLQKAGQPPKLLFYKISSRQSGTPSRFSSSGSEPGFTLTISGVQAEDAGDYYCMGAYVGL
Sebastes nigrocinctus V9 ighv AUPR02071630.1 1187 LNGQALESIPSTSVVKTPEEALSLSCRGTGFDFSQSGMHWIRQPEGKALEWMGLIYYDASKTVYASNVQGRTEITRDNSNSMTYLRLSNLKPEDSAVYYCA
Sebastes nigrocinctus V8 trbv AUPR02046142.1 694 ASLSGSVLQTPPFIIKRTDESVASEINCSHNITNYDLILWYKQDERKALKLLGYLNVNYPYPEDDVKGKISFDGNGREHSSLNISDLSLSDSGVYFCAASQHSAADS
Sebastes nigrocinctus V7 trbv AUPR02046142.1 2310 LIDGSGVTQTDTLWKDEGDDATIHCSHTKGLQYSQMYWYRQRQGETMKLIVFTTYGKENHDFGDFDKGKFSATKPDLVSGTFTVKNLQPEDKGLYFCAVSQ
Sebastes nigrocinctus V6 iglv AUPR02045909.1 1431 VSGVAVVTQKPPVVTVRKGGTATMDCNLETLTGSAARWYKQTPGGVPQYMLSLHHSISSPEYGSGYSSPKFTSTHQSQTDYRLIINNVEEGDSAVYYCKTF
Sebastes nigrocinctus V5 ighv AUPR02037397.1 3338 LSPCKEVHQGPPAILGRLHDSATISCSHSIGSYNTMLWYQQPTGDSELKLIGYVFYSSPIVEKPFSDNFKVTGDGSKKAELHVLKLRHPEDSGVYYCAAAAATVV
Sebastes nigrocinctus V4 trbv AUPR02077577.1 6712 FSFCVKIHQPSSILIHEGEPAVTFQCEQDDSEYLYMFWYRRISSGRIQMVTYSLGKDVWNVEAPFNKSKYSMSRPAVLQSSLQIHPVEAADSAVYYCASRR
Sebastes nigrocinctus V3 ighv AUPR02077576.1 393 VSLGLDVRQSSSDLITTPGDKVQIFCSHDKTDYRVILWYQRSPGDTAMKLIEYLSHTDVTMEEPHKEDFDMSGDLTGSTAKNGSLIVNLVKQEHGAVYYCAARE
Sebastes nigrocinctus V2 trav AUPR02077575.1 257 VCLSLDVHQSPSDVITKPGDKVQISCSYDKTDYRVMLWYQRSPGDTAMKLIGYLNVQAVTMEGPYKEHFNMSGDLSVNTVKTGSLIIQVTGREQGAVYYCAASR
Sebastes nigrocinctus V1 trav AUPR02077574.1 222 VSLGLDVRQSPSELITKPGDKVLIFCSHDKTDYRVILWYQRSPGDTAMKLIGYLNYQAVTMEGPYKEHFNMSGNLGGDAVKNGSLIIQVIGREQGAVYYCAASK
Sebastes nigrocinctus V0 trbv AUPR02077573.1 277 VCLGVEVHQTPPELLRRPGDKVQLVCSHEKTDYTQMYWYQKSPGDLALKRIGHVYYGTIEHEESFKEHFNITGDMSGSTAKNGSLFISNLKAPEHSAVYYCAASY