WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sinocyclocheilus anshuiensis LAVE00000000.1 (LAVE01) 267 40 0 39 119 39 15 15
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sinocyclocheilus anshuiensis V35 trav LAVE01024225.1 31211 KVDQHTKIQSAFEGDTVTIDCTYQTAYANPTLFWYQQKDNGNPKYMLNKYSKSGNSEEEFKERFNVNLNKTAVPLTIQDVRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V34 trav LAVE01024225.1 26172 NSFGDTIQPWFPEKHDSDGENVTLSCNYSLTSGTNANIQWYRQYPGAKPEFLLLVTEYSSKSEPELRLYSEAKKEIKRVDLVIFSAAVSDSALYYCALR
Sinocyclocheilus anshuiensis V33 trav LAVE01024225.1 16671 SRSEDKVDQPEEYVTEAEGRSVTLQCKYKTDSAQEDLFWYIQRAKDFPKYILRRSKYGGENGTEYQERFHSKLSSNSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus anshuiensis V32 trav LAVE01024225.1 11786 CRSEDTVDQPDKHMTEVEGRSVEFKCKYKTDSAQDYLFWYIQRANDFPKYILRRSKYGGEDNDAQFQERFHSEVSSDSVPLTIKDARVSDSAVYYCALR
Sinocyclocheilus anshuiensis V31 trgv LAVE01012920.1 938 QTSAHIVLQSTRFMSALPGDDVTLDCSMAAGVSMSSYTMYWYKQDHYGQPIQFIIKEYDKPTQNYEAILNTMDSRFSLNISKLTPQDSGTYYCAA
Sinocyclocheilus anshuiensis V30 trbv LAVE01012919.1 15589 FSDGVLITQWPKYISSLPSSSAEMHCYQNDTDYNYKYWYRQIKGEGPVLIGSNNFNSPSNEKGFENGFTISGTETKKWTLTVDVKKGIDAVYLCAAS
Sinocyclocheilus anshuiensis V29 trbv LAVE01012919.1 10846 FSDGVLITQWPKYISSLSGSSVEMHCYQNHTDYDYKYWYRQIKGEGPVLIENIIGTAELNEKGFDTGFKVSGTETKKWTLKVDVKQGIDAVYLCAAS
Sinocyclocheilus anshuiensis V28 trbv LAVE01012919.1 2689 ISLGSSIDQPADMLKHQGDTVNISCTHTYSSYYYLYWYQQTTQEESFKLLGYLYMKKFNPEKNYDRFYIYGNSQTHGTLQISTVTSEDSAMYFCAVS
Sinocyclocheilus anshuiensis V27 trbv LAVE01012919.1 1578 CVVCSPVIQQSPKHLLRTVEEKEAKLFCRHGDNDYPYLYWYQKKSNGGSFELIGMLSYGTDSEEEKFKSRFNITGHAKEDAFLLISNIAAEDSAVYFCAAS
Sinocyclocheilus anshuiensis V26 trav LAVE01012918.1 1857 CVVCSPVIQQSPKHLIRIVEEKEAKLSCHHGVSSYQYMYWYQQKSNDGSLELIGMLNYGTAYQEEKFKSRFNITGHAKEDAYLLISSIAVEDSAIYFCAAS
Sinocyclocheilus anshuiensis V25 trbv LAVE01012917.1 24427 CVVCSPVIQQSPKYLLRTVEENEAKLSCHHRDSSYPYLYWYQQKSNMGSLELIGMLTHDSFSPEEKFKSRFNITGHATQDAFLIISSISAEDSVVYFCAAS
Sinocyclocheilus anshuiensis V23 trbv LAVE01012917.1 21768 LCMMLNVTQTPTELFLVIGATMNLTCSHHDKSYDKIFWYQQSNGQNLEHLGFLSFKQQLVDRKGFTITGDAEKEAYLLVSSVKAEHSAVYFCAVST
Sinocyclocheilus anshuiensis V22 trdv LAVE01012917.1 19918 FSVNSAIKQTPSDLLSKNNVESVTLHCSHTNPNFNVILWYKQPLSGEMQLMGYLYRTNNNSEPVFKEKIELLGNGASNSNLILKKLSSDDNAIYYCAAS
Sinocyclocheilus anshuiensis V21 trav LAVE01012917.1 14854 CLICEKVHQSPSDVLCKPKESVNLTCRHKIINYDTILWYQRSYGDSSLKLIGYARYNSLKEIEASYKDNFNVTGNGEEEVTLKILQARPDQDSAEYFCAAYYAQ
Sinocyclocheilus anshuiensis V20 trbv LAVE01012917.1 13450 HLLSSVDQTPSEVIVRSGQAYTLSCSHSISSYNTILWYYQHEHGQGMHIIGYSFHSTHNAENADDKKYKLEGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus anshuiensis V19 trbv LAVE01012917.1 12288 FSYTYTVDQSPPDVIKKPKESAKIQCSHSVPNYNQISWYRQIQDQGFTFMGYLFLKEQNPEKEFTKKIEMSGDGNSNGYLTIKDLSSNDSAVYFCAAC
Sinocyclocheilus anshuiensis V18 trbv LAVE01012917.1 1877 FSLSNKVDQTPSDVIETQGETAKIQCLHSVPNYNQINWYRQNQDHGFTLMGYLLGKEPYKENDFKDKIEMSGDGNNNGYLNIKSLSSNDNAVYFCAAY
Sinocyclocheilus anshuiensis V17 trbv LAVE01012916.1 11423 FSFSYNVDQSPPDVIKRRGESAKIRCSHSVPSYNQINWYRQNQEGFTLMGYLLATSNTSEKEFMDKIEMSGNGNSNGLFTIKNLASSDSAVYFCAAC
Sinocyclocheilus anshuiensis V16 ighv LAVE01012916.1 10392 LVRSQKVDQSPPDLIRKLTESAVLTCSHSDQGFAHILWYKRSDDKGFIFLGYLNNNFPNPEDEFKLKIDLAGDGRSSATLTIKDLTEDNSGVYYCAAR
Sinocyclocheilus anshuiensis V15 trbv LAVE01012916.1 9234 SSQSNKVDQSPPDVIKKQGESAKIQCSHNVPNYNQINWYRQHQGQEFTFMGYLLLTSPNPENEFTAKIEMSGNGNSNGAVTIKNLSSSDSAVYFCAAY
Sinocyclocheilus anshuiensis V14 trbv LAVE01012916.1 5648 EKGDMTVHQKPRDLIINYRESPEIKCFHKIPNYDRLLWYKQSQSKELTFMGNLIGDTGYPEKAFQNKIKILGHSNKFHGSLTLINSTSENSAVYFCAAY
Sinocyclocheilus anshuiensis V13 trav LAVE01012916.1 4103 STLSDKVFQEPRDMIVDIKDSPVLQCSHSISSYDRILWYKQTQDGQLVFLGYLLGLIDQLEPEVKNKFKLDGNGNNNGKLAIKSLEFNDTATYFCAASTQ
Sinocyclocheilus anshuiensis V12 trbv LAVE01012913.1 664 ACFGKTVFQSPGDLIKNQDESAIITCTHNILNYERIFWYKMGIIDLKLMGYLNLDHKYPESEFESKINLEGDGRNNGTLTIKTLSLTDSAVYFCAAY
Sinocyclocheilus anshuiensis V11 trbv LAVE01012912.1 7437 ACLGKTVLQTPDNLIKNQDESAVIMCSHKIPSYYQILWYKQSPDMLGLKLMGYLNNDAKNKEPEFDKKIKLDGDGRNDGNLTISNLTLTDSAVYFCAAC
Sinocyclocheilus anshuiensis V10 trbv LAVE01012912.1 6038 ACLGKTVLQTPNDILKKQDESAVITCTHKIQSYNQILWYKQSQDSLGLKLMGNLYVESKTKEPGFENKIKLEGDGRNKGILTISNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus anshuiensis V9 trbv LAVE01012908.1 19553 ACLGKTVLQMPDKLIKNQYESAVIICTHNIPSYYTILWYKQSPEVLGFKLMGFLNYDAENKEPEFENKIKLDGDGQKNGTLMISNLKLTDSAVYFCAAYYTVLR
Sinocyclocheilus anshuiensis V8 trbv LAVE01012908.1 16509 SVFSTKVHQNPPVLYKTKGDDAQLECQHSISSNNVILWYKQTPGQGLILLGHLMMRIGQREDDFIGKVELKGDATKSGSLTIQYLSDKDSAVYFCAAS
Sinocyclocheilus anshuiensis V7 trbv LAVE01012908.1 14329 ACLGKTVLQTPDDLLKKQDESAVITCTHKIQSYNQILWYKQSQDSLGLKLMGYLHYNNKNKEPEFENKIKLEGEAQTNGNLTISNLTLTDSAVYFCAAY
Sinocyclocheilus anshuiensis V6 trbv LAVE01012908.1 12643 DVIQEPKIIWEPKNGSTTLNCKHNKGISYYQMYWYRQRPGETMRLIVFTTTGSKPDFGDVDEKKFEAQKSDAESESLKVKDLEPDDSGIYFCAVS
Sinocyclocheilus anshuiensis V5 trbv LAVE01012908.1 11644 STFGNIVYQTPSKSIKDRDESAVFICTHNIASYFQMMWYKQTQGTLGFKLMGHLNGETDQIETDFKNKIFLNGNGRRNGTLTIKNLRVDDSAVYFCAAYDTVL
Sinocyclocheilus anshuiensis V4 trbv LAVE01012908.1 6562 ACLGKTVLQTPDDLLKKQNESAVITCTHSIQSYDRILWYKQSQDVLGFELMGNLFYEDETKEPGFEKKIKLEGDGRNKGILTISNLMLTDSAVYFCAAYYTVLR
Sinocyclocheilus anshuiensis V3 igkv LAVE01002643.1 14857 ITVTQPEAVTVSEGQDATIECKTDAGIDSWGLAWYQQKPGETPKLIIYLVNDLYDESFSRFSGNGAEGGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V2 igkv LAVE01002643.1 8250 SIGQVTVTQTPSVLLAQTGRSVTVTCTFSRNPDCCYNGKPALSWYLQKPGEAPKLLIYYTSTLQSGTASRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V1 igkv LAVE01002643.1 3193 ITVTQPEAVTVSEGQDATIECKTDPKISGWGLAWYQQKPGETPKLIITGVNDRYGTSFSRFSGNGEQGGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V0 igkv LAVE01002642.1 9125 TQTPAVKPVQPGDTVTMSCKTSPEVYQGWGYQPLSWYLQKPGEAPKLLIYKANILQSGTPSRFSGSGSKTDFTLTISGVQTEDAGHYYCLS
Sinocyclocheilus anshuiensis V72 trgv LAVE01132123.1 17287 DGNVKMQQKISLTKSVDKTVVIDCNFPSDCIGYIHWYQLKEGQTLRRILYSSISGGATNNDAGFESFKIDRKPSNLALKIPELKKEHSAVYYCACWVSG
Sinocyclocheilus anshuiensis V71 trgv LAVE01132123.1 15450 DGAVVLQQKISLTKAEEKLAIIDCHFSSDCRYYIHWYQQKDRETLKRILYADIDDGSTKVNDAGDESIKSEKKELNHFVLKITKLKKEHSAMYYCACWVWSSV
Sinocyclocheilus anshuiensis V70 trgv LAVE01132123.1 14437 DGAVALQQKISLTKAEEKLAIIDCHLHISCWDYIHWYQQKDRETLKRILYADINDGSAKNDVGFESIKSEKKASNHFALKITKLKKEHSAMYYCACWVSG
Sinocyclocheilus anshuiensis V69 trgv LAVE01132123.1 6410 VESLSLKQPQKVLVKQKGKSVSFKCEVTDLGSGNFVHWYHKKDGETFKRLLYITHSGIITTEAKDFVSEKIGDSYGIKIATTKEEHAGMYYCASWES
Sinocyclocheilus anshuiensis V68 trav LAVE01114435.1 63570 CHGEDSVDQPDKNITEFEERSVTLQCKYKTALSQPELFWYIQRANDFPKYILMRNKYGGADNDAQFQERFHSEVSSDSVPLMIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V67 trdv LAVE01114435.1 54203 PSKGDTITPDKTEEFAAEGSNVTLSCSYSSAWSLLWYRQYPRSAPEFLVLISDSAKQAQMSGVDHRLTTKIRKKEKQNRVDLEISSAAVSDYALYYCALE
Sinocyclocheilus anshuiensis V66 trav LAVE01114435.1 52643 SINQPTRVQKASEHEMVKLHCTYSTSDQYPSLYWYQHKTKGFPVYMLRKLSTGSSSSEKEFEERFHADLDKSSSTVSLSIQDVRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V65 trdv LAVE01114435.1 50907 YTLAQSITPQENKAHATVGQKVTLSCKYEGAITNLHWYRQYPRSKPEFLAWIYPQGATSNPLPPRIIPKVDKNLVSLEISDAEVTDSALYYCALT
Sinocyclocheilus anshuiensis V63 trav LAVE01114435.1 40572 SSGQERVEQSSRVMPESEGAQVILMCNYTTTSTSPNLFWYKQLPNRSPTFILNQYTTEPDFINKYSATLNSTSRTFPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus anshuiensis V62 trav LAVE01114435.1 38595 SLGQGRVEQSSRVMPESEGAQVILMCNYTTTSTSPNLFWYKQLPNRSPTFILNQYTTEPDFINKYSATLNSTSRTFPLMIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V61 trdv LAVE01114435.1 36422 TSFADTIQPLSSEKYIVEGKNVTLSCNYSSTGTVNSLQWYRQYLGAKPEFLLQVNEYSSKSEPDLRLYSKATKEIKRVDLIIFSAAVSDSALYYCALRPTVTG
Sinocyclocheilus anshuiensis V60 trav LAVE01114435.1 6884 CNSQDKVDQHTRIQSAFEGATVTINCTYQTAFTNPTLFWYQQKVSGIPKYMLNKFSKSGNSEEEFKDRFHANLSKTSVPLTIQDVRVSDSAVYYCALQPTVTE
Sinocyclocheilus anshuiensis V59 trav LAVE01114432.1 5825 EETVSQPERHQTELEGKSVTLNCKYSSASAAPDLFWYIQRANYIPKYILRRDNFGTGETGTEFQERFHSKLSSDSVPLTIQDVHVSDSAVYYCALR
Sinocyclocheilus anshuiensis V58 igkv LAVE01110839.1 32201 TQNPSKKTVESGQSVTITCQTSLDVGNWCNSKYCLRWYLKKPGDAPKLLIYHGHIRYSSIPSRFSGNGINKNFQLVINGAQNEDSGEYYCFSDLRGHR
Sinocyclocheilus anshuiensis V57 igkv LAVE01110839.1 30445 SNGQVTVTQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHTPKLLIYLIRERHSNIPSRFSGNGAHTDFNLTISGVHKEDEAQYYCMT
Sinocyclocheilus anshuiensis V56 igkv LAVE01106745.1 2019 QITVTQSPSITAAQPGQEVRINCKTSSRVHNGNYLHWYLQKPGEAPKLLIYYATILYTGTPSRFSGSGSGSDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V55 igkv LAVE01105606.1 30888 SHQEVQSPESLSVKAGDSASISCTASSGIGYRMSWYLLKPGKAPKLLIYSTSNLASGVSNRFSGNYSGYEFMLNIHRVQLEDEGDYYCMGFYSKTV
Sinocyclocheilus anshuiensis V54 igkv LAVE01084266.1 475 IWGQMTVTQNPEIKSIKQGETVTISCKTSQTLSSCSNCVSWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSGTDFSLTISGVQTEDTGDYYCYY
Sinocyclocheilus anshuiensis V53 igkv LAVE01083858.1 362 TQNPEIESIKQGETVTISCKTSQPISGCSDCVSWYQQKPGEAPKLLIYYTSSLQSGTPSRFSGSGSSYGSDFSLTISGVQTEDTGDYYCMS
Sinocyclocheilus anshuiensis V52 trbv LAVE01080976.1 5695 VLGVSLDQGQKALVKAVGKTVYLPCKVTDLQSWNYIHWYQIKEGEAPSRLLYITQGGSVARDTNNPQATDFTVDKTKLYDLKLSDTQKSHAAVYFCAYW
Sinocyclocheilus anshuiensis V51 trbv LAVE01080975.1 23792 AVLGVSLNQGPKVLVKGVGKTIYLPCKVTDLGTSDYIHWYQVKEGEAPSRLLYITQGGSVARDTNNPESTDFTVDKTKLYDLKLSNTQKSHSAVYFCAYWDTSS
Sinocyclocheilus anshuiensis V50 igkv LAVE01070252.1 6008 VTLTPPEVKTVQQGQTATIECHIDVGIYSNGLAWYQKKPGEAPKRLIYYINTLQSGTPSRFSGSGTVNTGRDFTVTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V49 trav LAVE01058412.1 7663 SSGQDRVEQSSEEMTASEGAQVIVWCKYITTDTDPYLFWYQQLPNRSPTFILNKFTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKNLRMSDSAVYYCALRPTVSG
Sinocyclocheilus anshuiensis V48 trav LAVE01058412.1 5704 LVDQPDQHIAEFEARSVTLQCKYKTTSPQPELFWYIQKENDFPKYMLRRNKYGGEDNDAQFQERFHSEVSSDSVPLTIKNLCVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V47 trav LAVE01058412.1 1736 AVFGNGIKSNKTDVVYEEGSNVILSCSHSPAATDYIHWYRQYERSKPEFLVLTYGSAKEAAVSDVDPRFSVKAEKREQIHVDLKISSAAVSDSALYYCALR
Sinocyclocheilus anshuiensis V46 igkv LAVE01057085.1 4969 VTLTQPKVKTVQQGQTATIECNIDVGIYGSYLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGTANTGKDFTLSIRGVQTEDTGDYYC
Sinocyclocheilus anshuiensis V45 ighv LAVE01046489.1 349 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTAWIRQPAGKALEWIGLIDSAGNLAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARD
Sinocyclocheilus anshuiensis V44 ighv LAVE01044839.1 992 ITVTQPKVKTVQLGQTASIECSLDVGLTSNDLAWYQQKPGEAPKLLIYDINSLQSGTPSRFSGSGTSYGSDFTLTISGVQTEDTGDYYCMS
Sinocyclocheilus anshuiensis V43 trav LAVE01024229.1 3158 CHGEDSVDQPDKHITEFEGKPVTLQCKYKTSSSQPDHFWYIQRANDFPKYMLRRNKYGGEDNDAQFQERFDSEVSSDSVPLTIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V42 trav LAVE01024228.1 15177 CDSLDSIEQKTRVQTAVEGETVTINCTYSTTDSFPYLFWYQQEINGYPRYMLKKFPGSGEVDKQFEGRFDANLNTSRTTVPLTIQDVCVSDSAVYYCALKPTVTE
Sinocyclocheilus anshuiensis V41 trav LAVE01024228.1 12637 CNSQDKVDQHTRIQFAFEGDTVMIDCTYQTAYSGPTLFWYQQKDNGNPKYMLNKVSKSGNSEEEFKERFHANLSTTSVPLTIQDVCVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V40 trav LAVE01024228.1 5060 EQPSREMTANEADRVTLMCNYTTKATNTDAYLFWYKQLSNKSPAFILNKYPFSEGTTEPDFKKRFSATLDTTSKTVPLMIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V39 trav LAVE01024227.1 19096 SSAQDRIEQTSREMTESEGAQVILMCNYTTASTNPYLFWYKRLPNRSPTFILNQYTTEPDFTKKYSATLNSTPRTFPLMIKNLHVSDSSVYYCALKPSD
Sinocyclocheilus anshuiensis V38 trav LAVE01024227.1 18175 KVDQHTRIQSAFEGDTVMIDCTYEATYTGPTLFWYQQKDNGNPKHMLNKFSKSGNSEEEFKERFHANLSKTSVPLTIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V37 trav LAVE01024227.1 12246 SQDSVEQKTRVQTVYEGGTVIINCTYQTQLTPTLFWYQQKVNRVPKYMLQRVGKTGAEDEEFKDRFNAHIDTSSKSVPLTIQDVRVSDSAVCYCALK
Sinocyclocheilus anshuiensis V109 igkv LAVE01018304.1 2683 VTLTQPEVKTVQQGQTATIECQIDIGIRYSYLAWYQQKPGEAPKLLIYQISSLQSGTPSRFSGSGTANTGKDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V108 igkv LAVE01018302.1 5952 FSGQVTVTQTPSVKMIQIDESVTINCKTNTVVSNDCPGSYTCMAWYQQKPEEAPKLLIRYAVQRESNTPSRFSGSGSRTDFTLTISGVQTEDTGDYYCLS
Sinocyclocheilus anshuiensis V107 igkv LAVE01018302.1 6608 TVTQTPSVKTVQIGESVTINCKTNTVVSNDCPGSYTCMAWYQQKPEEAPKLLIRYAVQRESNTPSRFSGSGSRTDFTLTISGVQTEDTGDYYCLS
Sinocyclocheilus anshuiensis V106 trbv LAVE01012924.1 3361 SSDVTQTPILWVPQGESAQMNCSHTKGADYFYMYWFRQRKGETMRLIAFTTTTNIKPDFGEYSDDKYSAEKTVAERGSFTVKKLQPDDSGVYFCAVS
Sinocyclocheilus anshuiensis V105 ighv LAVE01010155.1 108 IECQTFTQSEAVVKKPGESHKLTCTITGFTFSDLYLSWIRQSPGKGLEWIAYISTSSSPIYYSQSVQGRFTVSRDDSSSQLYLQMNSLKSEDTAVYYCARE
Sinocyclocheilus anshuiensis V104 trav LAVE01005848.1 10422 LQCQKMESIESTTVKRPGETLTLSCRGSGFSFDYCSMHWIRHQAGKPLVWMGLGYSSGSGHKAESFKGRLEITRDDSKSMMYLKLSGLTEEDSAVYFCARESQ
Sinocyclocheilus anshuiensis V103 ighv LAVE01005848.1 11452 QNLESISSVAEVKPGEALSLSCRGSGFTFGSYDMHWVRQQPGKALVWMGRVWSNGQGQDYAKSFEGRIEITRDNSKTMVYLKLSGLTEEDSAVYYCARQ
Sinocyclocheilus anshuiensis V102 ighv LAVE01005846.1 222 IDSNELPQPESLTVRPDATLTINCKVSYSVTSEDTGWIHQPAGKALEWIGVIWSDGSVAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus anshuiensis V101 ighv LAVE01189556.1 440 INSQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTSMYWIRQAPGKGLEWIIYYYDDSSKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus anshuiensis V100 trav LAVE01179249.1 8065 DQPHPHMSIRLHDNKSVDLEISSAATTLSCTYDGSAYSLHWYWQKPGSKPDFLLLIAESSKYVTRADQPHPHMSIRLHDNKSVDLEISSAAVSGSAVYYCALQ
Sinocyclocheilus anshuiensis V99 trav LAVE01179248.1 10872 SLGDLITSHDSEKQAQDGNSVTLSCNYTGAAYNLLWYRQYQRSKPELLLSMTESGDPVKEDPSAHWLSAKVDKHRKLMELEISPAKVSDSAQYYCALR
Sinocyclocheilus anshuiensis V98 trdv LAVE01179248.1 9716 ISFADTIQPLSSEKHIFRGDNVTLSCNYSGFVYSLQWYRQYVGSRPEFLILVNENSEASEPSLRLSAKDSKEKKQVNLTISSAEVTDSALYYCALR
Sinocyclocheilus anshuiensis V97 trdv LAVE01179246.1 806 GIAPLSSSELVTNGDSITLVCNYNGTYNSDSLLWYRQYSSSKPEFLFLVSEAKFEQPADPPIPGVFANLKKEKNRVVLEISSASVSDSALYYCALQ
Sinocyclocheilus anshuiensis V96 trav LAVE01179245.1 393 SVFANAITPLFTEKHASEGEKATLSCNYSGSNIQGWQWYRQYPNTAPEFLLQAFESLGPEQKDRHVAEAQKDKKHLNLEISKTEVADSAIYYCALV
Sinocyclocheilus anshuiensis V95 trav LAVE01179239.1 5222 GRFESPITSDQTEVFDEEGANITLSCSYLTAISLHWYRQYPRSAPEYLLLILQISGRVQSTENLDSRFSARLNEKKNRVDLIISSVKVTDSALYYCALE
Sinocyclocheilus anshuiensis V94 trav LAVE01179236.1 12741 KDVITPYSDAAFATETESVKLSCNYTGSVDSLHWYRQYAGSPPQFLILDYYGATTHANPPVSGISISHRKEENSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus anshuiensis V93 trav LAVE01179236.1 7312 KDVITPYSDAAFATETESVKLSCNYTGSVDSLHWYRQYAGSPPQFLILDYYGATTHANPPVSGISISHRKEENSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus anshuiensis V92 trav LAVE01179232.1 12125 CDSLESVDQNTRVQTAVEGRSVMINCRYETSDLSPYLFWYQQKMNGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSVPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus anshuiensis V91 trav LAVE01179231.1 47 CDSLDSVEQNTTVLTALEGAVVTISCQYETTDILPIFFWYQQKVNGAPEFMLDKFDNHAIHFKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V89 trav LAVE01179230.1 14248 EQPSGGMTANEADQVTLICNYTTKTTNADVYLFWYKQLPNKSPIFILNKYPFSEGITEPDFKKRFSATLDSTSRTVPLMIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V88 trav LAVE01179230.1 5437 VSFGVEITPDSTEESAAAGSTVTLSCSYSSAHSLQWYRQYPGSAPQFLVLIIESVKETKTSDVDPRFSTKLRKEKQVTKEIKRVDLVISSAVQKDSAMYYCDLT
Sinocyclocheilus anshuiensis V87 trav LAVE01179230.1 4005 SSGQDRVEQSSEEITASERDQVIVRCNYFTTGINIYLFWYKQLPNKSPTLILNQYTTEPDFKKRFSATLNSSSRTFPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus anshuiensis V86 trav LAVE01179230.1 1508 SSAQDRIEQSSGEMTESEGAQVILMCNYTTTNPYLFWYKQLPNRSPTFIQNQYTTEPDFKKRFSATLDSTSRTFPLTIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus anshuiensis V85 trav LAVE01179229.1 1711 CWGQDRVEQPSGEMTESEGAQVILMCNYTTTNPYLFWYKQLPNRSPTFIQNQYTTEPDFKKRFSATLDSTSRTFPLTIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V84 trav LAVE01179228.1 6587 SSGQDRVEQSPGEITESEGAQVILMCNYTTTSTAPYHFWYKQLPNRSPTFILNQYTTEPDFTKQFSATLNSTSRTFPLMIKDVRVSDFAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V83 trav LAVE01179226.1 5623 TSFADTIQPLSSEKYVVEGKNVTLSCNYSTTGTVDSLQWYRQYLGAKPEFLLLVNEYSSKSEPDLRLYSKATKEIKRVDLEIFSAAVSDSALYYCALRPT
Sinocyclocheilus anshuiensis V82 trav LAVE01179224.1 41 CDSLDSVEQNTTVLTALEGAVVTISCQYETTDILPIFFWYQQKVNGAPEFMLDKFDNHAIHFKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V81 ighv LAVE01171475.1 6425 LFMWSQATESLTNTAVTLGADVNISCDLDIEEIYWYRQKSPDPPVFILRTFDSTYEEGIHQNSIFKLKYLVKTNSRLFIRNITTDELGVYYCVKTSE
Sinocyclocheilus anshuiensis V80 ighv LAVE01171357.1 2188 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYATGWIRQPARKALEWIGLIDSAGNLAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARD
Sinocyclocheilus anshuiensis V79 ighv LAVE01171357.1 509 IDSNELTQSESLTVRPDATLTINCKVSYSVTSEDTGWIHQPAGKALEWIGLIDSAGNLAYKDSLKNKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus anshuiensis V78 igkv LAVE01155488.1 1023 IWGQVTVTQNPEIKSIKQGETVTISCKTSQLTSDCNVCLSWYQQKPGEAPKLLIYVINSLQSGTPSRFSGSGSSLGTDFSLTIRGVQTEDTGDYYCMS
Sinocyclocheilus anshuiensis V77 ighv LAVE01154149.1 4814 IDSNELTQSESLTVRPDATLTINCKVSYSVTSYATAWIRQPAGKALEWIGLISSGGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Sinocyclocheilus anshuiensis V76 ighv LAVE01154149.1 1333 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTGWIRQPAGKALEWIGLISSGGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARD
Sinocyclocheilus anshuiensis V75 igkv LAVE01145370.1 65 SRGVILTQPEVKTVQLGQTATIECHTDVGIYSSYLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSSYGSDFTLTISGVQTEDTGDYYCMS
Sinocyclocheilus anshuiensis V74 igkv LAVE01140185.1 7370 TQTPAVKPVQPGDTVTMSCKTSPEVYQDYSVQPLSWYLQKPGEAPKLLIYWANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V146 trav LAVE01112208.1 2468 ESNGNVIRPNQPSVVLTEGSSTTLSCSYDGSAYSLHWYRQKPGSKPEFLLLIVESTKYVNKADQPHPHMSIRLHDNKSVDLEISSAAVSDSAVYYCALE
Sinocyclocheilus anshuiensis V145 trdv LAVE01112208.1 3397 TAGEDVIKPVFTEKQVLEGKDVTLICNYTGTVNNLQWYRQYPGSKPEHIIMFFETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAMYYCALV
Sinocyclocheilus anshuiensis V144 trav LAVE01112206.1 1178 TAGEDVIKPVFTEKHVLAGKDATLICNYTGSVQNLQWYRQYPGTKPEHIIMFFETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSATYYCALV
Sinocyclocheilus anshuiensis V143 trav LAVE01112206.1 4053 NAGEDVIKPVFTEKQVLEGKYVTLICNYTGTVNNLQWYRQYPGSKPEHIIMFFETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALQ
Sinocyclocheilus anshuiensis V142 trav LAVE01112205.1 2250 TAGEDVIKPVFTEKHVLAGKDATLICNYTGSVQNLQWYCQYPRTKPEHLILYIETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALQ
Sinocyclocheilus anshuiensis V141 trav LAVE01112204.1 80714 NAGEDVIKPVFTEKQVLEGKDVTLICNYTEAVHNLQWYRQYPGSKPEHLILFFETNPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALQ
Sinocyclocheilus anshuiensis V140 trgv LAVE01110046.1 4534 CLNGQITHPDPVIIKASGRAARIQCKVDSSTLQSSVLHWYRAPPKGALQRLMYFEAGSSKAKKDPDTPRRFSGSVNGDLVALTISKLELSDAGSYYCALWSGD
Sinocyclocheilus anshuiensis V138 trav LAVE01110045.1 4551 AVLGVTLEQGQQILVKAVGKTSYLPCKVTGLQSWHYIHWYQKREGEAPSRLLYISAVGSFIHDTNNPQANDFTVDRTQLHNLKLSNTKPIHAAVYFCAYWDSN
Sinocyclocheilus anshuiensis V137 trgv LAVE01110043.1 278 VGSLSLKQPQKVLVKQKGKSVSFKCEVKDLGSSNYVHWYHKKDGETFKRLLYISHSGIATNEAKDIVSEKNGNSYGIKLKETKEEHAGMYYCACWDG
Sinocyclocheilus anshuiensis V136 trav LAVE01107280.1 722 GVFCVELNQPPSLVAKPQESFSISCRISVSSYCIHWIHQPTGKALEWLGYLCSDGRTNIKDSVKNKISFTQDTSKNTVFLQGNNFQTEDSAVYYCAIQSQ
Sinocyclocheilus anshuiensis V135 ighv LAVE01106985.1 2749 CWCQTLTESESVVIKPGGSHRLTCTFSGFSSDPDLAWIRQTAGGGLEWLSYISASSTIYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Sinocyclocheilus anshuiensis V134 ighv LAVE01106985.1 3747 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGDADISWIRQAEGKALEWISYISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTTLQTEDTAVYYCARK
Sinocyclocheilus anshuiensis V133 ighv LAVE01106699.1 306 VSGISLTSSPAQTKAPGQSVRLSCQISGYALTDYGTAWIRQPPGKALEWIGIIWGSGSIDSGNSFKSRFTISRDTGRNELYLDINSLQTEDTAVYYCAKT
Sinocyclocheilus anshuiensis V132 trav LAVE01083443.1 370 FVVGNRAKDVITPYSDAAFATETESVKLSCNYTGSVDSLHWYRQYAGSPPQFLILDYYGATTHANPPVSGISISHRKEENSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus anshuiensis V131 ighv LAVE01070722.1 560 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTAWIRQPAGKALEWIGLILSDGSVACKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus anshuiensis V130 ighv LAVE01070722.1 1649 WTRSPLKVVKKPGETLTLSCIGSGSSFGCCSMHWTRQQAGKPLVRLGRVHSHGNSHDFSDSFSRRIEITRDNSKGMVYLKLGLTAEDSAVYYCARDSL
Sinocyclocheilus anshuiensis V129 ighv LAVE01055388.1 5105 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTGWIRQPAGKALEWIGLISSGGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARQ
Sinocyclocheilus anshuiensis V128 igkv LAVE01044721.1 2072 SRGVTLTQPKVKTVQQGQTATIECHIDVGILSSYLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V127 ighv LAVE01044527.1 3492 CRSQTLVESDAIVIKPGESHKLTCSASGFNFGGSWMAWIRQAAGKGPEWVATLSDGNSYIYYSDKVKGRFTISRDDNKNQLYLQMSSLKTEDTAVYYCAR
Sinocyclocheilus anshuiensis V126 ighv LAVE01044527.1 4870 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSMSSYWMGWIRQKPGKALEYIGRIDGGTSTVFAQSLQGQFSITKDTSKNMLYLEIKSLKTEDTAVYYCA
Sinocyclocheilus anshuiensis V125 ighv LAVE01028881.1 1741 IHCQTFTQSQDVVKKPGESFRLVCTASGYSFSSYWAGVVRQAPGKGLEWVSTIGGSSSQKYYSQSVQGRFTVSRDDSSSQLYLQMNSLKSEDTAVYYCARE
Sinocyclocheilus anshuiensis V124 ighv LAVE01028881.1 6704 IDSNELTQPESLTVRPDATFTINCKVSYSVTSYATGWIRQPAGKTLEWIGVIWSNGILYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARD
Sinocyclocheilus anshuiensis V123 ighv LAVE01028880.1 1335 IHCQTFTQSQDVVKRPGESFRLVCTASGYSFSSNWAGVVRQAPGKGLEWVSAISTSNTPYYSQSVQGRFTVSRDDSSSQLYLQMNSLKSEDTAVYYCARE
Sinocyclocheilus anshuiensis V122 ighv LAVE01028880.1 4392 IHCQTFTQSQDVVKKPGESFRLVCTASGYSFSSYWAGVVRQAPGKGLEWVSTIGGSSSQKYYSQSVQGRFTVSRDDSSSQLYLQMNSLKSEDTAVYYCARE
Sinocyclocheilus anshuiensis V121 ighv LAVE01028878.1 1113 IYSQVVLTQSEQSVTVSPGASYKLTCACSGFTLSSYRMHWIRQVPGKGLEWILHYYRDSDKGSAQSVQGRFMASTDSSNFYLHMSQLKTEDTAVYYCARD
Sinocyclocheilus anshuiensis V120 ighv LAVE01028878.1 2017 LFCIELDQPPVMVVKPGETFTIACKITGYSASGGGYTNWIRHSSGKLMEWIGWYYTSSSNGVKDSLKNKISFSSESSSNAVILTGRNFHTEDSAVYYCARN
Sinocyclocheilus anshuiensis V119 ighv LAVE01028878.1 3906 CWCQTLTESESVVIKPGGSHRLTCTASGFSGDQHLAWIRQTAGGGLEWLSYISASSTIYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Sinocyclocheilus anshuiensis V118 ighv LAVE01028878.1 12044 VHCIELNQPALMVIKPGESFSIGCKITGYSASGGGCTNWIRHSAGKAMEWIGWFCSSGDTGTSDTMKNKISFTAETSSNTVFLRGQSFQTEDTAVYYCARNTQ
Sinocyclocheilus anshuiensis V117 ighv LAVE01028878.1 14830 GVFCVELNQPPSLVVNPQESFSISCRISVSSYCIYWIRQPTGKALEWLEYLCSGGGTDIKDSVKNKISFTQDTSKNTVFLQGNNFHTEDTAVYYCARQ
Sinocyclocheilus anshuiensis V116 ighv LAVE01028877.1 591 ISGDEIRLDQSPAEIKRPGETVKISCKISGFTMTDYLMHWIRQKPGKALEWIGRVYTGGSSRSDYLTYADSMKNHFTMSEDVSQSTQYLEAKSLREEDTAVYYCARE
Sinocyclocheilus anshuiensis V115 ighv LAVE01028877.1 3311 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSVSSYYMHWIRQKPGKALEWIGRIDGGTGTIFAQSLQGQFSITKDTSKNMLYLQVKSLKTEDTAVYYCARESQ
Sinocyclocheilus anshuiensis V114 ighv LAVE01028877.1 5079 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTSMHWIRQAPGKGLEWIIYYYDDSSKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCATE
Sinocyclocheilus anshuiensis V113 ighv LAVE01028877.1 11629 VYSQVVLTQSEQSVTVSPGGSIKLTCACSGFTVSSTNMYWISQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMSQLKTEDTAVYYCARG
Sinocyclocheilus anshuiensis V112 ighv LAVE01028877.1 14620 AIDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTSMHWIRQAPGKGLEWIIYYHSDSYKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus anshuiensis V111 ighv LAVE01028876.1 9 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGDADISWIRQAEGKALEWISHISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTTLQTEDTAVYYCARK
Sinocyclocheilus anshuiensis V183 trav LAVE01112216.1 2605 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILQGTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYYCALT
Sinocyclocheilus anshuiensis V182 trav LAVE01112215.1 234 ANAIIPLSPFMSTVVGENVTISCSYKGFTGRVLNAQWYRQYARSKPKFLIYSYPQGGTSLPLTRGSVKFDQDLQQVHLKISNFKWTDSAVYYCALE
Sinocyclocheilus anshuiensis V181 trgv LAVE01112215.1 4305 SVFANAITPLSTENHAFEGGKATLSCNYSGNNIQSWQWYREYPNSAPEFLLQALENLGPEKKDRHVAEAQKDKKLLNLEISKTEVSDAAIYYCALV
Sinocyclocheilus anshuiensis V180 trav LAVE01112215.1 8862 ANAIFPLSPFMSTVVGENVTISCSYKGFAGRVLNAQWYRQYPRSKPDFRTYSYSHKGPDLPITISRFSSKFDQDLQQVDLQISKVFLTDSAVYYCALQ
Sinocyclocheilus anshuiensis V179 trav LAVE01112215.1 12483 TFAQSIRPLQNDIHVTEKKPVMLSCKYEGSANSLHWYRQYPGSKPEFVLLVMEASTKHVTYADPRIPGMDGKMSMKDKQVDLEISSAEVSDSALYYCALQ
Sinocyclocheilus anshuiensis V178 trav LAVE01112215.1 16589 ECFAKTITPLQDRTQVTEGKSVNLACTYDGSVQSLLWYRQYRGSGLEFLLLVVESSTKSVVYADPPIPRLDGEMSMKDKRVDLIISSAEVTDSALYYCALV
Sinocyclocheilus anshuiensis V177 trav LAVE01112215.1 18126 DILTNMITLHDSQKQVLEGKNVTLTCNYSGAPDNLHWYHQYPRSTPKFLLYIYESGLMSDNIPQRLTPRINKNTKRVDLEISSAAVTDSAVYYCALR
Sinocyclocheilus anshuiensis V176 trav LAVE01112215.1 19784 GRSEDVITPVQTEVYGKSGDKITLSCNYSTALSLYWYRQYPRSTLGFLLLILQNSGESETMQPGMSVKLNEKKTSVDLEISSAKVTDSAVYYCALK
Sinocyclocheilus anshuiensis V175 trav LAVE01112215.1 23743 QHTVRQSPSSSSAYTGETATLNCEYNMTDTMPALLWYRQTKNLSPEYILVRHNFGNGSNSKDFPNKRFQSQLDSAARRISLTIQNLHLSDSSLYFCALR
Sinocyclocheilus anshuiensis V174 trav LAVE01112215.1 27545 GRFESPIKSDQTEVFDEEGANITLSCSYSTAISLHWYRQYPKSAPEYLLLILQTSGRVQSAEKLDSRFSARLNENKNRVELIISSVKVTDSALYYCALE
Sinocyclocheilus anshuiensis V173 trav LAVE01112215.1 28212 VTHAETITPEHPEVRVNETENITLSCSYSSAYSLLWYRQHHTSAPQFLMLILQNSGKVIQTSDERLSGKLNVDKNRVDLEIPFSTVKDSAVYFCALR
Sinocyclocheilus anshuiensis V172 trav LAVE01112215.1 34931 VSFGNVITPVQTEVFGTEGGNITLSCNYSSAISLQWYRQYPNSAPEYLLVIMHATGQVSHKSKLVDQEPRFTGKLNEKKTHVILEISSAKVTDSAMYYCALT
Sinocyclocheilus anshuiensis V171 trav LAVE01112215.1 40173 FVVGNRAKDVITPYSDAAFAETESVKLSCNYTGSVKSLHWYRQYAGSPPQFLILDSYGSITQANPPVSGISISHRKEDNSVDLIISSASVSDSALYYCALQ
Sinocyclocheilus anshuiensis V170 trav LAVE01112215.1 46249 KDVITPYSDAAFATETETVKLSCNYTGSVESLHWYRQYAGSPQFLILDSYGSITQANPPVSGISISPRKEDNSVDLIISSAAVSDSALYYCALK
Sinocyclocheilus anshuiensis V169 trdv LAVE01112215.1 49464 VSFANVITPVQTEVSKKEGENVTLSCSYSSASTLQWYRQYPGSAPEFLLIILHATGKVSQKSEIVDRDPRFFGKVNGEKTHVILEISSTKLTDAALYYCALTPTVTG
Sinocyclocheilus anshuiensis V168 trav LAVE01112215.1 54099 KDVITPYSDAAFDTETETVKLSCNYTGSVESLHWYRQYAGSPQFLILDHSGYVIEANPPISGISISHRKEDNSVDLIISSAAVSDSALYYCALK
Sinocyclocheilus anshuiensis V167 trav LAVE01112215.1 60437 KDVITPYSDAAFATETETVKLSCNYTGSVDSLHWYRQYAGSPQFLILDYSGYVTHANPPVSGISISHRKEDNSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus anshuiensis V165 trdv LAVE01112215.1 63883 SEVITPKSDREFALEGDNVTLSCNYSSSARGVHWYRQYAGSPPQFLILEDSGVTTPANPPVPGISINHRKTEIHVDLIISSAKVSDSALYYCALQPTVTG
Sinocyclocheilus anshuiensis V164 trav LAVE01112215.1 70651 VSFGDVITPVETHVSGTEGDIISLSCSYSSARSLFWYRQYPGSAPEFLFLILHATGEVLQKSKTVDQDPRFSAKLNEKKTHVDLEISSAKVTDSALYYCALE
Sinocyclocheilus anshuiensis V163 trav LAVE01112215.1 71843 SEVITPKSDREFALEGDNVTLSCNYSSSARGVHWYRQYAGSPPQFLILEDSGVTTPANPPVPGISINHRKTESHVDLIISSAKVSDSARYYCALR
Sinocyclocheilus anshuiensis V162 trav LAVE01112215.1 76487 VSFGNVITPVETHVSGTEGDIISLSCSYSSARRLFWYRQYPGLAPEFLFLILHATGEILQKSKTVDQDPRFSAKLNEKKINVDLEISSAKVTDSVMYYCALE
Sinocyclocheilus anshuiensis V161 trgv LAVE01112214.1 1512 NVLANAITSRSTKQHVLEGGKVTISCNYSGSNINSLQWYRQSSNTAPEFILQAFEGLGPQQKDRYVAEVRKNEKQIDLEISKTEMADAAVYYCALV
Sinocyclocheilus anshuiensis V160 trgv LAVE01112214.1 4234 SVFANAITHISTENHAFEGGKVTISCNYSGNDIRSWQWYKQYPNSAPEFLLQALETLGPEQKDRYVAEAQKDKKLLNLKISKTEVSDAAIYYCALV
Sinocyclocheilus anshuiensis V159 trav LAVE01112212.1 1336 NIFAYEIITRYTEKHVLEGGKVALSCNYVRDNIRSWQWYKQYPNTAPKFILEAFENLGPEKKDRHVAEAQKGKKQVDLEISKTEMADSAIYYCALV
Sinocyclocheilus anshuiensis V158 trdv LAVE01112211.1 1352 NADANTINPLVPEKHVTAGDNVTLTCDYSGRVNTLQWYRQYPGTRKEFLIFVTELSGRSEPTLRLSSVADKRNKHMNLSIFQTEMEDSALYYCALV
Sinocyclocheilus anshuiensis V157 trav LAVE01112211.1 2599 RTDANTIKPLSLNENRHVGDSVTLSCSYKDYTGNIKNLQWYRQYPRSKPEFLLYIFPQGLMSEDRPPRFTAAVNQDNKQVDLEISSAVETDSAIYYCALV
Sinocyclocheilus anshuiensis V156 trav LAVE01112211.1 5278 YSFADTIQPLSSEKHILRGDNVTLSCNYSGLVYDLQWYRNTGGSRPEFLIPVNENSEASEPSLRLSAKDSKKQVNLTISSAEVTDSAVYYCTLR
Sinocyclocheilus anshuiensis V155 trav LAVE01112211.1 6086 ADTIKPLSLNENRHVGDSVTLSCSYKDYTGNIKNLQWYRQYPRSKPEFLLYIFPQGLMSEDRPPRFTAEVNQDDKQVDLKISSAVETDSAIYYCALV
Sinocyclocheilus anshuiensis V154 trav LAVE01112211.1 7254 EANKSPISSDKASVSLNEGSNATLSCTFDESAYRLHWYRQKTGSKLEFLLLIDKSTKFVVPASPPLPHISTSFHNNNRVDLIISSAAVSDSALYYCALE
Sinocyclocheilus anshuiensis V153 trav LAVE01112211.1 9056 NSFADTIQPLSSERHIFRGENVTLYCNYSGLVYNLQWYRQYVGSRPDFLILVNENSEATEPSLRLLAKDSKEKKQVNLTISSAEVTDSAVYYCALR
Sinocyclocheilus anshuiensis V152 trav LAVE01112211.1 9831 SADAYTIESLLPEQRVSVGQSAVISCKYSGIGPSFQWYRQYPGSRPEYLIFNAETAVSSEPTLRLKAQAKKEITEVELEISSTEVKDSAVYYCALV
Sinocyclocheilus anshuiensis V151 trav LAVE01112211.1 11135 SFANTIQPLYSEKHVVRGKNVILSCNYSGDVNNLQWYRQYPGSQPEYLILITEYSEADLSLRLSAKASKDIKQVNLTISSAEETDSALYYCALE
Sinocyclocheilus anshuiensis V150 trav LAVE01112209.1 2462 ESNGNVIRPNQPSVVLTEGSSTTLSCSYDRSAYSLHWYRQKPGSKPEFLLLIVRSTKTVVPASPPHTHMSIRLHDNKSVDLEISSAAVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V149 trav LAVE01112209.1 3424 TAGEDVLKPVFTEKHVLAGKDATLICNYTGNIQNLQWYRQYPGSNPEHLILYLETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAMYYCALV
Sinocyclocheilus anshuiensis V148 trav LAVE01112209.1 4764 NADAEVIIPFLTEQYVLAGKDITLSCNYSGYVQNLQWYRQYPRSKPENIIFHTASNGHSEPKLRLYAVADKGIKLMNLSISTTKLEDSALYYCALQPTVTG
Sinocyclocheilus anshuiensis V220 trbv LAVE01133025.1 1407 FSDGVLITQWPNYISSLPGSSVEMHCYQNDTDYDYKYWYRQIKGEGPVLIGSYNFNSPSNEKGFETGFTMSGTETKKWTLTVDVKEGIDAVYLCAASF
Sinocyclocheilus anshuiensis V219 trbv LAVE01133025.1 3434 FSDGVLITQWPKHISRLPGSSVEMHCYQNDTHYDYKYWYRQIKGELVLVGSYIVNSGSTEKDFESGFTVSSTEKKKWTLKVNITDGIDAVYLCAAS
Sinocyclocheilus anshuiensis V218 trav LAVE01133025.1 4908 MGRCVNVQQNLTPLLFNKNDMAEITCIYDDSGKPNMLWYQQKDTAMALIVLSYGAGSDHIYEDGFKGRFELKRTETLNGALKISDLSQSDSAVYYCAVS
Sinocyclocheilus anshuiensis V216 trdv LAVE01133024.1 45472 GITIIQNDQVSKTQLIIQRDKEVTLKCNHDDGSYYYMYWYRQRGQGELSLVAISLAKDSKETVAPFTKTKYIMERPEIKESSLEIKNLTEEDSGIYFCASSI
Sinocyclocheilus anshuiensis V215 trdv LAVE01133024.1 45472 GITIIQNDQVSKTQLIIQRDKEVTLKCNHDDGSYYYMYWYRQRGQGELSLVAISLAKDSKETVAPFTKTKYIMERPEIKESSLEIKNLTEEDSGIYFCASSI
Sinocyclocheilus anshuiensis V214 trgv LAVE01133024.1 46097 KSNGEILQEPEMFANRSSTVTLTCQHDNSDHYRLFWYKQAKGTVGLSLLVFSAGQNQAYIEEPFKTQDSKYAATRPEIKMSTLQINNLETEDSALYYCAT
Sinocyclocheilus anshuiensis V213 trgv LAVE01133024.1 48448 QTSAHIVLQSTRFISALPGDKVTFDCSMAAGVSVSSYTMHWYRQDHYGQPIQFIIKEYDKTTQNYEAILNTKDNMFSLIVSNLTAQDSSTYYCAA
Sinocyclocheilus anshuiensis V212 trav LAVE01112218.1 4703 SSGQDRVEQSLRELTASERDQVIVMCNYFTTVTNINLFWYKQLPNRSPTLILGQYTTEPDFKKRFSATLNSTSRTFPLMIQDVCVSDSAVYYCALQPTVTE
Sinocyclocheilus anshuiensis V211 trav LAVE01112218.1 6642 QDSVEQSSREMPANEGAQVILMCTYTTSGTPYIFWYKQLPNRSPTFILSQYTTESDFKKRFSATMNSTSRTFPLMIKNLHVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V210 trdv LAVE01112218.1 8063 YGNKIKPTKTLEFADEDSSAKLSCSYSSAYALHWYRQYAGSAPEFIVLILDSGKQAQESNVDSRFTAKVTKDKENLVYLEISSASISDSALYYCALEPTVTG
Sinocyclocheilus anshuiensis V209 trav LAVE01112218.1 9215 VSFGGEITPESTEESAAVGSTVTLSCSYSSAQSLQWYRQYPGSAPQFLVLIMESVKETKTSDVDRRFSTKLRKEKQVTKEIKRVDLEISSAAVSDSALYYCALR
Sinocyclocheilus anshuiensis V208 trav LAVE01112218.1 10336 QDRIEQSSGEMTESEGAQVILMCNYTTTSTTNYLFWYKQLPNRSPTFILNQYTTEFFTTRFSATLDSTSRIFPLMIEDVHVSDSAVYYCALR
Sinocyclocheilus anshuiensis V207 trdv LAVE01112218.1 11370 ASNGDTITPDKTEEFVAEGSSVKLSCSYSSAWSLLWYRQYPGSAPEFLVLISDGAKQAQKSNVDQRFSTNNRKEKQNHVDLIISSAALSDSALYYCALR
Sinocyclocheilus anshuiensis V206 trav LAVE01112218.1 12158 TSSADTIQPFTLEKHVFEGENVTLSCNYSTTGVTVNSLQWYRQYLKAKPTFLLLLTEYSNKSEPDLRLYSKATKEIKRVDLIIFSVAVTDSAVYYCALQPTVTG
Sinocyclocheilus anshuiensis V205 trav LAVE01112218.1 14066 CDSLDSVEQNTTVQTAVEGAAVTISCQFETTDISPNLFWYEQKANGVPEFMLSKFGSRIQFKERFNGDLNTISKSFPLTIQDVRVSDSAVYYCALRPTVT
Sinocyclocheilus anshuiensis V204 trav LAVE01112218.1 14992 CKSEDAVHQNMRVQTADEGAAVIINCSYTTTDPSPTLFWYQKQVNGFPKYMLNRVATYGNNEEEFKKRFNASLNTQTKSVPLTIQDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus anshuiensis V203 trav LAVE01112218.1 17971 RVEQPLGEITAIKGDPVTLQCNYSTSATNAYLFWYKQLPNRSPTFILSEFTIGKGTTEDEFKERFSATLDSKSSTVRLTIKNLRVSDSAVYYCALK
Sinocyclocheilus anshuiensis V202 trav LAVE01112218.1 21744 KVEQASRQMTANEAAQVTLLCNYSTSFSNAYLFWYKQLPNRSPTFILSEFTIGKGTIENAFKERFSATLDSTSRTVPLMIKNLHVSDSAVYYCALQPTVTE
Sinocyclocheilus anshuiensis V201 trav LAVE01112217.1 3935 AEVITPYSALQFAVEGDSVTLSCSYTGSVRGLHWYRQYSGSPPKFLILESYGTVTKADPPVAGVSINHRKDNSSVDLKISSAAVTDSALYYCALE
Sinocyclocheilus anshuiensis V200 trav LAVE01112217.1 5356 SEVITPKSDREFALEGDNVTLSCNYSSSARGVHWYRQYAGSPPQFLILEDSGVTTSANPPVPGITIKHRKKESHVDLIISSAKVSDSALYYCALQ
Sinocyclocheilus anshuiensis V199 trav LAVE01112217.1 7631 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILQGTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYYCALE
Sinocyclocheilus anshuiensis V198 trav LAVE01112217.1 9878 QDSVKQPKSFQSAYEEEGSVTLDCKYNTTSSNPTLLWYRQNSYDSPKYILRRHKFGDGDEASEFKGRFHSRHDSTSKSVPLTIENPRVSDSALYYCALQ
Sinocyclocheilus anshuiensis V197 trav LAVE01112217.1 11822 CFGEDTVNQPNENITAAEGQQVTINCEFKTLQLTPYLYWYIQRSKGPEYVLMRYKFGSSNSSEFEERFDARLDSNSVPLTIKNLRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V196 trav LAVE01112217.1 13631 EDSVTQPTKVQTATAGETVTIDCTYKTNAFPTLYWYQYKANQAPKYMLKRYAGSSDEDEDFKERFNANLQTSSTSVPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V195 trav LAVE01112217.1 14808 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDPSPYLFWYQQKMNGIPKYMMMIFAKTVQNEKDFEERFNANHDKTSKSVPLMIQDVHVSDSAVYYCALR
Sinocyclocheilus anshuiensis V194 trgv LAVE01112217.1 21012 CWGQDSVEQHLREKTSAEGNQVTLLCNYTLVSSTNAYLFWYKQLPNRSPTFILSDFSIGKGTTEPEFQERFHAKLDSTLGTVPLMIQDVRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V193 trav LAVE01112217.1 22303 CDSLESVDQNTRVQTAVEGRSVMINCRYETSDPSPYLFWYQQKTNGIPKYMMTIIATNVQNDKDFEERFNANHDKTSKSVPLMIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V192 trav LAVE01112217.1 26563 CQSDDTVDQPHKHVIKFEGESVTLDCKYTTASTSQELFWYIQRTEESPKLVLQRNSYGGGSNGTEFQERFYSEVKPSKSVPLIIQRLCVSDSAVYYCALR
Sinocyclocheilus anshuiensis V191 trav LAVE01112217.1 33427 CKSENAVHQNIRVQTADEGTAVIINCSYTTTDPLPTLFWYQQKVNGFPKYMLSTYGNNEEEFKKRFNARLNTITKSAPLTIQDVHVSDSAVYYCALKPTVTE
Sinocyclocheilus anshuiensis V190 trav LAVE01112217.1 34724 KVEQASRQMTANEAAQVTLLCNYSTSFPSAYLFWYKQLPNRSPTFILSEFTVGKGTTEDEFKERFSATLDSTSRTVPLMIEDVRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V189 trav LAVE01112217.1 39524 CKSEDAVSQNMRVQTADEGAAVIINCSYTTTDPTPTLFWYQKQVNGFPKYMLNRVATYGNNEEEFKKRFNASLNTQTKSVPLTIKNLCVSDSAVYYCALKPTVTK
Sinocyclocheilus anshuiensis V188 trav LAVE01112217.1 40843 RVEQPSGEMTTNKGDPVTLQCNYSTSATNVYIYWYKQLPNRSPTFMLSVFSFGKGTTEDEFKDRFSATLNSKSTTVPLMIEDVRVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V187 trav LAVE01112217.1 43648 SSGQDRVEQSSEEMTASEGAQVIVWCKYITTDTNPYLFWYQKLPNRSPTFILNKLTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKDVCVSDSAVYYCALRPTVTG
Sinocyclocheilus anshuiensis V186 trdv LAVE01112217.1 44851 HGNEIKPTKTLEFADEGSSVKLSCSYLSALTLYWYRQYPGSAPEFIVFISDRSKQAQESNVDSRFTAKVTKDKENLVDLEISSAAVSDSALYYCALE
Sinocyclocheilus anshuiensis V185 trav LAVE01112217.1 45743 CHGEELVDQPDKNIAEFEGRSVKLQCKYKTTSSQPELFWYIHRANDFPKYILWRNKFGAKDNDAQFQERFDSEVSSDLVPLTIKNLRVSDSAVYYCALR
Sinocyclocheilus anshuiensis V257 trav LAVE01164673.1 18092 SDGIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCTERSENGSSTQSCVYSLSQTELRPSDAGIYYCAVVTCGK
Sinocyclocheilus anshuiensis V256 ighv LAVE01155506.1 1737 AHGQSLTSSGSEVKRPGESVTLSCVVSGLSLSWLHWIRQKPGRGLEWIGRIDSGTGTVFAQSLQGQFSITKDTSKNMVYLEIKSLKTEDTAVYYCAKE
Sinocyclocheilus anshuiensis V255 igkv LAVE01142497.1 801 SIGQVTVTQTPSQLLAQTGQQVKIKCTTSSATPCCCGGTACLSWYLQKPGEAPKLLTYGANQVQSGTPSRLSGSGSKSDFSLIISGVQTEDTGDYYCLS
Sinocyclocheilus anshuiensis V254 igkv LAVE01142496.1 11420 HFNSESPSITAAEGQNVRIKCKTSSSAYWGDRLSWYLQKPGEAPKLLIYRATSRNTGTPSRFSGSGSHTDFTLTISGVQTEDTGDYYCQMYNSGPT
Sinocyclocheilus anshuiensis V253 igkv LAVE01142496.1 16242 SSGQITVTQTPAVQTTEAGKTVVMRCTCSTPLTDCSPPCLSWYLQKPGEAPKLLIYRVNSLQSGTPSRFSGNGSGSDFSLTISGVQTEDTGDYYCLS
Sinocyclocheilus anshuiensis V251 igkv LAVE01141784.1 7527 SHEEVQSPESLSVKAEDSVSISCTGTSGVGDDMSWYLQKPGEAPKLLIYDASNLASGVSDRFSGTYSGYEFTLNIRGVQLEDAGVYYCMGYYSGGV
Sinocyclocheilus anshuiensis V250 igkv LAVE01140250.1 37329 SAAEVTVTQTPAVKPVQPGDTVTMSCKTSPEVYQGWGYQPLSWYLQKPGEAPKLLIYRTNTLQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V249 igkv LAVE01140250.1 39678 CKAQITVTQTPSLKTATPRENVEMSCKFSSSDTACSPPCVSWFLQKPGEAPKLLIYHTTHRQSGTPSRFSGSGSDKDFTLTISGVQTEDAGHYYCLESFRGPV
Sinocyclocheilus anshuiensis V248 igkv LAVE01140250.1 42881 QITVTQTPSVKTVTPRENVEMSCTFSTAPACSPPCVFWYLQKPGEAPKLLIYLTNRLQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCLS
Sinocyclocheilus anshuiensis V247 igkv LAVE01140250.1 45902 SRGQISVTQSPSTTAAQPEETVKINCKTSTDVYRWSDGDEELAWYLQKPGEAPKLLIYLTNRLQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V246 igkv LAVE01140250.1 48851 ITVTQPEVLTVSKGQDATIECKTDAGIDSWGLAWYQQKPGETPKLIITGVNDRYGNSFSRFSGNGEQGGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V245 igkv LAVE01140250.1 52358 SAAEVTVTQTPAVKPVQPGDTVTMSCKTSPEVYQGWGYQPLSWYLQKPGEAPKLLIYKANVLQSGTPSRFSGSGSKTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V244 igkv LAVE01140250.1 60092 TTGHISVTQTPSVAAVQPGETVTLNCQTSRGIGDRSQGCSDCFSWYLQKPGEAPKLLIYYISSRQSGTPSRFSGNGANYGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V243 igkv LAVE01140250.1 61274 TTGHISVTQTPSVAAVQPGETVTLNCQTSRGIGDRSQGCSDCFSWYLQKPGEAPKLLIYRTNTLQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus anshuiensis V242 igkv LAVE01140250.1 62623 TQTPAVKPVQPGDTVTMSCKTSPEVYQGWGYQPLSWYLQKPGEAPKLLIYKANVLQSGTPSRFSGSGSKTDFTLTISGVQTEDVGHYYCLS
Sinocyclocheilus anshuiensis V241 trbv LAVE01133035.1 170 ACLGKTVLQTPDNLIKNQDESAVIMCSHKIPSYYQILWYKQSPDMLGLKLMGYLNNDAKNKEPEFDKKIKLDGDGRNDGNLTISNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus anshuiensis V240 trbv LAVE01133035.1 3194 ACLGKTVLQTPDNLIKNQDESAVIMCSHKIPSYYQILWYKQSPDMLGLKLMGYLNNDAKNKEPEFDKKIKLDGDGRNDGTLIISNLTLTDSAVYFCAAYDTVLR
Sinocyclocheilus anshuiensis V239 trav LAVE01133035.1 7667 ANHAKTVLQSPDDLIKNQNELAVIVCSHNIQNYNQMLWYKQSQDMPGLKLMGYLYADQNIEPEFTNKIKLEGDAKRNGTLTINNLTPQDSAVYFCAAY
Sinocyclocheilus anshuiensis V238 trav LAVE01133035.1 17762 SVVNGSVNQSPSNLIKSERDTAELVCEHNIPSYTMIFWYKQTLSRDLTLLGYTWNKNSIPEDNFNKKIKLDGDGTKNGSLKILQLEASDSAMYYCAAS
Sinocyclocheilus anshuiensis V237 trbv LAVE01133035.1 19642 PVFSTKVHQSPPDLFKMKGDDAQLECQHSISSNNVILWYKQTPGQGLILLGHLMMQIGQKEDDFIGKVELKGDATKSSSLTIKYLSDNDSAVYFCAAS
Sinocyclocheilus anshuiensis V236 trbv LAVE01133035.1 20908 ISDVSQVPSVLMAVKGSSAQLNCTHKKDFTFNQMYWYRQRPGQTMTLIVFTSTASSKHDYGDSDPNKFPVIKTVPESGSLTVNNVKSDDSAIYFCSVS
Sinocyclocheilus anshuiensis V235 trbv LAVE01133035.1 24500 AGISDVSQVPSVLMAVKGSSVQLNCTHKKDSSFVQMYWYRQRPGQTMTLIVFTSTLSSKHDYGDSDPNKFPVIKTVPESGSLTVNNVESDDSAIYFCSVS
Sinocyclocheilus anshuiensis V234 trav LAVE01133031.1 4091 TVGADDVIQEPKILWGQKDSSVHMNCTHNKGSTYRQMYWYRQRQGQTMRLIAFTTSYTKPEYEDSELNKFVANKTVAESGSLTVNNLQPNDSATYFCSVSE
Sinocyclocheilus anshuiensis V233 trav LAVE01133031.1 5242 DSDVSQVPSVLMAVKGSSAQLNCTHKKDFTFTQMYWYRQRLGQTMSLIVFTSTASSKHDYGDSDPNKFPVIKTVPESGSLTVNNVKSDDSAIYFCSVR
Sinocyclocheilus anshuiensis V232 trbv LAVE01133030.1 10322 EKGDMTVHQKPHNLIINYGESPEIKCFHKIPDYDRLLWYKQSESKELTFMGNLLGDSGYPEKAFQNKIKIRGDANKFHGSLTLINSTSENSAVYFCAA
Sinocyclocheilus anshuiensis V231 trbv LAVE01133030.1 15713 SILGKSVLQTPSDLLKKEDEFVEIKCSHSIQNYYVIQWYKQSQSITVLQLMGHINVEQETTEPEFKGKIKLDGDGRNNGTLTINTLTLNDSAVYFCAAY
Sinocyclocheilus anshuiensis V230 ighv LAVE01133029.1 1050 LVQSQKVDQTPQDLTRNLTESAVLTCSHSIQGFDLILWYKQSDDKGLIFLGYLNIDHAYPEDEFKHKINLAGDGRSSATLAIKDLTEDNSGVYYCAAR
Sinocyclocheilus anshuiensis V229 ighv LAVE01133029.1 7124 LIRSKKVDQTPQDLIRNLTESAVLTCSHSDQGFELILWYKRSDDKGFIFLGYLNNNFPNPEEDFKHKIDLAGDGRSSATLTIKNLTEDNSGVYYCAAR
Sinocyclocheilus anshuiensis V228 trav LAVE01133029.1 9432 ESLSDQVHQNPPHLITKAEKTVQISCSHTIKDYNMILWYEQLKGNSALNLIGYVYYKDPTTENQYKNQFSIGGNGEESSTLNVTLEREHVGSTAVYYCAASK
Sinocyclocheilus anshuiensis V227 trbv LAVE01133028.1 3063 CVVCSPVIQQSPKHLLQTVEEKEANISCHHGDSSYLYLFWYQQKNEGGSLELIGMQTGDSGTPEENFKPRFALSGHATKDAFLLISSISAEDSAVYFCATS
Sinocyclocheilus anshuiensis V226 trbv LAVE01133028.1 3710 LCLMLNVTQTPRNLFLVTGATMNITCSHHDKTYDKIFWYQQSNGQNLEHLGFLSFKQDLVDKKGFTITGDAEKEAYLLVSSVKAEHSAVYFCAVSA
Sinocyclocheilus anshuiensis V225 trgv LAVE01133028.1 4918 NSTIIQTPTHLLSKNNAESVSLHCSHKNPTLNVILWYKQALSGEMQLMGHLYRTNNISEPDFKEKIELLGNGASNSTLTLKKLSSDDSAIYYCAAR
Sinocyclocheilus anshuiensis V224 trav LAVE01133028.1 7712 HLICEKVHQSPSDVLCKPKESVSLTCRHKITSYDTILWYQRSHGDSSLKLIGYARYSSIKEFEPSYKDHFNLTGNGEEEVTLKILQARPDQDSAEYFCAASYAQ
Sinocyclocheilus anshuiensis V223 trbv LAVE01133028.1 9189 HLFSSVVQTPAEVIVRSGQTFTLSCSHSISTYNTILWYYQNEHGQGMHIIGYSFHGAHNVEKDDKKYNLVGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus anshuiensis V222 trbv LAVE01133028.1 13459 FSLSNKVNQSPPDVIERQGETAKIQCLHSVSSYNQINWYRQNQDHGFTFMGYLLGKDPYKENDFKDKIEMSGDGNSNGYLNIKSLSSNDNAVYFCAAY
Sinocyclocheilus anshuiensis V265 igkv LAVE01189071.1 2648 VTVIQTPTEKHVQNGQTVTLSCKTSSAIGRQSDGHCKNCFSWYLQKPGESPKLLVYFIKILQSGTPSRFSGNGADHGTDFTLTLSGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V264 igkv LAVE01178870.1 1745 IWGQVTVTQNPAIKSIKQGETVTISCKTSQPISGCSDCVSWYQQKPGEAPKLLIYQISSLQSGTPSRFSGSGSSYGSDFSLTISGVQTEDTGDYYCMS
Sinocyclocheilus anshuiensis V263 trav LAVE01170603.1 3863 FVVGNRAKDVITPYSDAAFATETESVKLSCNYTGSVNSLHWYRQYAGSPPQFLILDYYGTTTHANLPISGISISHRKEENRVDLIISSAAVSDSALYYCAFE
Sinocyclocheilus anshuiensis V262 igkv LAVE01170591.1 612 VTLTQPKVKTVQQGQTATIECHIDVGILSSYLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGTANTGKDFTLTIRGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V261 igkv LAVE01166419.1 2925 QYTVTQSPSITAAQPGQEVRINCKTSSSVHGGSYLHWYLQKPGEAPKLLIYYATILYTGTPSRFSGSGSDTDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V260 igkv LAVE01166419.1 4921 SSGQVTVIQTPTEKNVQNGQTVTLTCKTSSSIGRQSDGWCKSCFFWYFQKPGETPKLLVHSIKTLHTGTPSRFSGSGADTDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V259 trav LAVE01164673.1 3017 KDSAIGSIVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCMEKSENGSSTQSCVFNLSQTELRPSDAGIYYCAV
Sinocyclocheilus anshuiensis V266 igkv LAVE01189568.1 148 QITVTQTQSIIAAQTGQEVRINCKTSSSVYGDNRLAWYLQKPGEAPKLLIYYATSRYTGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus anshuiensis V258 trav LAVE01164673.1 3017 KDSAIGSIVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCMEKSENGSSTQSCVFNLSQTELRPSDAGIYYCAV
Sinocyclocheilus anshuiensis V252 ighv LAVE01141785.1 14682 SHEEVQSPEYLLVKARDSASISCTASSGIGYDMSWYLLRPGKTPKLLIYRTSNLASGVSDRFGGTYSGYEFTLNIRGVQTEDAGVYYCMGYYSGGV
Sinocyclocheilus anshuiensis V221 trav LAVE01133025.1 601 KAKCVHVQQKVTSLLANQNDTTEIKCSHDDSSMLNMLWYQQKDTAMVLSGYTYSMGEPSYEDGFKGRFELKRKDTLNGALEIPDLSLSDSAVYYCADS
Sinocyclocheilus anshuiensis V217 trav LAVE01133025.1 8269 KVTCVTVQQNPKHILAKKNNMVEIKCSHDDSNMLNMLWYQQKDTAMVLIVFSYGATGDPNYEDEFKDRFKLERTETLNGALKISDLSQSDSAVYYCAVS
Sinocyclocheilus anshuiensis V184 trav LAVE01112216.1 412 SEVITPKSDREFALEGDNVTLSCNYSSSARGVHWYRKYAGSSPPQFLILEDSGATIQANPPVPGITIKHRKKEIHVDLIISSAKVSDSALYYCALQ
Sinocyclocheilus anshuiensis V166 trgv LAVE01112215.1 61812 DIFGNVITPVHNEVYKTEKDIISLSCNYSSAASLYWYRQYPGSAPEFLLVILHANGKVLQKSKFVELDPRFSGKLNKEKTHTYLEISSAKVTDAATYYCALE
Sinocyclocheilus anshuiensis V147 trav LAVE01112208.1 1214 NVDAELITSFFTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIYYTESSSQSEPKLRLYAVADKGIKLMNLSISSTQMDDSALYYCALQPTVTG
Sinocyclocheilus anshuiensis V139 trbv LAVE01110045.1 2544 AVLGVSLDQGQKALIKTEGKTVYLPCKVTGQSYIHWYQMKDGEAPSRLLYISQRGDVTRDTNNPQANDFTVDKTKLYDLKLSDTQKSHAAAYFCAYWDSS
Sinocyclocheilus anshuiensis V110 ighv LAVE01028876.1 1158 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSMSSYYMHWIRQKPGKALEWIGYIDTGSSAYYAQSLQGQFSITKGTSKNMLYLELKSLKTEDTAVYYCARESQ
Sinocyclocheilus anshuiensis V90 trav LAVE01179230.1 16388 CDSLDSVEQNTTVLTALEGAVVTISCQYETTDILPIFFWYQQKVNGAPEFMLDKFDNHAIHFKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCALQ
Sinocyclocheilus anshuiensis V73 igkv LAVE01140182.1 8654 TAGQISVTQTPSVAAVQPGETVTLNCQTSRGIGDRSQGCRDCLAWYLQKPGETPKLLIYDISSQQSGTPSRFSGNGADYGTDFTLTISGVQTEDAAHYYCQS
Sinocyclocheilus anshuiensis V64 trav LAVE01114435.1 49752 CDSQDSVEQKTRVQTAFEGEPVTINCTYSTTDSFPYLFWYQQEIKGYPRYMLKKFPGSGEVDKQFEGRFDANLNTSTTSVPLMIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus anshuiensis V36 trav LAVE01024227.1 2542 CNSQDKVDQHTRIQSAFEGDTVTIDCTYQTAYPSPTLFWYQQKDNGNPKHMLNKFSKSGNSEEEFKGRFHANLNKTAVPLTIQDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus anshuiensis V24 trbv LAVE01012917.1 23189 CVVCSPVIQQSPKHLLRTVEEKEAKLSCRHGDSSYQYMYWYQQKRNGGSLELIGMLQYGTDSEEEKFKPRFNITGDATKDAFLLISNINTEDSAVYFCAAS