WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sinocyclocheilus grahami LCYQ00000000.1 (LCYQ01) 344 47 1 55 143 52 20 26
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sinocyclocheilus grahami V28 igkv LCYQ01051145.1 20138 SRGQISVTQSPSTTAAQPEETVKINCRTSTDVAEYSAPRYYLSWYLQKPGEAPKLLIYYANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V27 igkv LCYQ01051145.1 9873 SRGQISVTQSPSTTAAQPEETVKINCRTSTDVYLSGSDHYLAWYLQKPGEAPKLLIYYANTLQSGTPSRFSGSGSKTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V26 igkv LCYQ01051145.1 8521 QISVTQSPSTTAAQPEETVKINCRTSTDVYLSGSDHYLAWYLQKPGEAPKLLIYYANTLQSGTPSRFSGSGSKTDFTLTISVVQTEDAGHYYCLS
Sinocyclocheilus grahami V25 igkv LCYQ01051145.1 6607 SIGQVTVTQTPSVLLAQTGQSVTVNCKLNSDANCCNNGNHFLNWYLKKPGEATKFLIYATSTLQPGVPSRFSGSRSSGRDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V24 igkv LCYQ01051145.1 1678 SRGQISVTQSPSTTAAQPEETVKINCRTSTDVYLSGSDHCLAWYLQKPGEAPKLLIYYANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V23 igkv LCYQ01051141.1 1165 TQTPSVLLAQTGQSVTVTCIFNSDPTCCCSGKQCLSWYLQKPGEAPKLLIYGTSTLQSGTPSRFSGSGSNSDFSLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V22 trgv LCYQ01048634.1 3321 LTAYNLSQEKSKSVKLGDKVSILCTAEDDKYYISWYQQKAGAPPQFLFFNNTRASDLPDRFTFADSGNQDYLTIDGVRAEDEAVYYCACIGCAG
Sinocyclocheilus grahami V21 trav LCYQ01040985.1 18921 CSSDADVVQEDNVKIGQAGEDMNLTCTFSKLLQTTTAWFKQTADRKNVQIVSLYLNQQPSWNEDFDKTNRFNVIKGDDHFNLTILKTKPSDSATYYCVVSSY
Sinocyclocheilus grahami V20 trdv LCYQ01040985.1 199 CSSDADIVQEDNVKLGQAGEDVNLACTFSKLLQTTTAWFKQTADRKNVQIVSLYLNQQPSWNEDFDKTNRFNVIKGDDHFNLTILKTKPSDSATYYCVVSSY
Sinocyclocheilus grahami V19 trdv LCYQ01040984.1 10623 CSSDADIVQEDNVKLGQAGEDVNLACTFSKLLQTTTAWFKQTADRKNVQIVSLYLNQQPSWNEDFDKTNRFNVIKGDDHFNLTILKTKPSDSATYYCVVSSY
Sinocyclocheilus grahami V18 trgv LCYQ01036423.1 2491 QTSAHIVLQSTRFISALPGDKVTFDCNMAAGVSVSSYTMHWYKQDHYGQPIQFIIKEYDKTTQNYEAILNTKDNTFSLIISNLTAQDSSTYYCAA
Sinocyclocheilus grahami V17 trdv LCYQ01036423.1 894 TADCVKFEQTPLLISNQSSEAQISCRHDDSSLLVMLWYRQQRTGMSLDLIGYSYSGSSPNNEPEFTDRFKQTRQDKVTGSLTISELVLPDSAIYYCAAS
Sinocyclocheilus grahami V16 trbv LCYQ01036422.1 1915 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTDYDYKYWYRQINDEGPVLIGSYNFNSPSNEKGFGTGFTMSGTETKKWTLTVDVKEGIDAVYLCAASF
Sinocyclocheilus grahami V15 trav LCYQ01036421.1 6434 MVKCVNVQQNPTAILASTNKMAEIKCSYDDSSKPYMLWYQQKDTAMALIVLSYGATGDPNYEDGFKDRFKLERTETLNGVLKIPDLSQSDSGVYYCAVS
Sinocyclocheilus grahami V14 trbv LCYQ01036421.1 4924 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTNYDYKYWYRQIKGELVLVGSYIVNSGSVEKDFESGFTVSSTEKKKWTLKVNITDGIDAVYLCAAS
Sinocyclocheilus grahami V13 trbv LCYQ01036421.1 3289 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTNYDYKYWYRQIKGELVLVGSYIVNSGSVEKDFESGFTVSSTEKKKWTLKVNITDGIDAVYLCAAS
Sinocyclocheilus grahami V12 trbv LCYQ01036420.1 9902 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTDYDYKYWYRQINGEGPVLIASIIGTAESIEKGFDTAFKVSSTETKKWILKVNITDGIDAVYLCAAS
Sinocyclocheilus grahami V11 trbv LCYQ01036420.1 5933 CVVCSPVIQQSPKHLLQTVEEKEAKLFCRHGDNDYPYMYWYQQKSNGGSLELIGMLNYGTASQEDKFKPRFNITGHAKEDAFLLISNISVEDSAVYFCAAS
Sinocyclocheilus grahami V10 trbv LCYQ01036420.1 4884 CVVCSPVIQQSPKYLRTVEEKEAKLFCRHGDNNYQYMYWYQQKSNGGSLELIGMLNYGTASQEDKFKPRFNITGHAKEDVFLLISSISVEDSAMYFCAAS
Sinocyclocheilus grahami V9 trbv LCYQ01036420.1 2318 CVVCSPVIQQSPKHLLQTVEEKEANISCHHGDSSYLYLFWYQQKNEGGSLELIGMQTGDSGTPEEKFKPRFALSGHATKDAFLLISSISAEDSAVYFCATS
Sinocyclocheilus grahami V8 trbv LCYQ01036420.1 1688 LCLMLNVTQTPRNLFLVTGASMNITCSHHDKTYDKIYWYQQSNGQNLEHLGFLSFKQDLVDKKDFTITGDAEKEAYLLVSSVKAEHSAVYFCAVSA
Sinocyclocheilus grahami V7 trbv LCYQ01036418.1 5065 HLLSSVVQTPAEVIVRSGQTFTLSCSHSISTYNTILWYYQHEHGQGMHIIGYSFHGAHNVEKDDKKYNMVGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus grahami V6 igkv LCYQ01034800.1 101923 SNGQVTATQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHAPKLLIYYIYERHSNVPSRFSGNGAHTDFNLTISGVQKEDEAQYYCMT
Sinocyclocheilus grahami V5 trgv LCYQ01001108.1 8378 DGNVKLQQKMSLIKALDKTVVIDCNYPSDCRDYIHWYQLKEGQTLRRILYSGISSTTTSNDAGFESFTIDRKPSNLALKIRELKEEHLAVYYCACWVSS
Sinocyclocheilus grahami V4 trgv LCYQ01001108.1 4845 DGAVALKQKISLTKAVEKLAVVVCQLHVSCWGYIHWYQQKDQETLKRILYADINDGSAKWNDAGDEFKSEKKASNHFALKITKLKKEHSAMYYCACWDYNSI
Sinocyclocheilus grahami V3 trgv LCYQ01001108.1 3377 VESLSLKQPQKFSVKQKGKSVSFKCEVTDLGSSNYVHWYHKKDGETFKRLLYISHSGIATNEAKYIVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Sinocyclocheilus grahami V2 trbv LCYQ01001107.1 81766 AVLGVSLDQGPKALIKTEGKTVYLPCKVTGQSYIHWYQMKDGEAPSRLLFISQRGDVTRDTNNPQANDFTVDKTKLYDLKLSDTQKRHAAVYFCAYWDSS
Sinocyclocheilus grahami V1 trgv LCYQ01001107.1 72685 CLNGQITHPDPVVIKPSGRAARIQCKVASSTLQSSVLHWYRAPPKGALQRLMYFEAGSSKAKKDPDTPRRFSGSVSGDVVALTISKLELSDAGSYYCALWSGD
Sinocyclocheilus grahami V0 trbv LCYQ01001107.1 70653 AVLGVTVDQGPKALVKGEGKTVYLPCKVTGLGSSDYILWYQIKEGEAPSRLLYINQGGIITLDTNNPQANDFTVEKTKLYDLKLRNTQKSHAAAYFCAYWDSS
Sinocyclocheilus grahami V64 igkv LCYQ01115645.1 2075 SSGITVTQPKLKTVQQGQTATIECNIDVGIYSNYLAWYQQKPGEAPKLLIYYINSLQSGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V63 igkv LCYQ01114462.1 1501 ASRGITVTQPEAVTVSEGQDATIECKTDPEISGWGLAWYQQKPGETPKLIIYHVKDRYGNSFSRFSGNGEQGGTDFTLTISGVQTEDAAHYYCQS
Sinocyclocheilus grahami V62 igkv LCYQ01114461.1 1974 ASRGITVTQPEAVTVSEGQDATIECKTDPEISGWGLAWYQQKPGETPKLIITGVNDLYDESFSRFSGNGARGGTDFTLTISGVQTEDAAHYYCQS
Sinocyclocheilus grahami V61 ighv LCYQ01112574.1 2000 AHGQSLTSSGSEVKKPGESVTLSCVVSGLSLSWLHWIRQKPGRGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNMVYLEIKSLKTEDTAVYYCARESQ
Sinocyclocheilus grahami V60 igkv LCYQ01110710.1 1954 TVTQTPSVKTVQIGESVTINCKTNTVVSNGCPGSYTCMAWYQQKPEEAPKLLIRYAVQRESNTPSRFSGSGSRTDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V59 igkv LCYQ01109562.1 2074 IWGQMTVTQNPEIKSIKQGETVTISCKTSQTLTSCSTCVSWYLQKPGEAPKLLIYYINTLQSGTPSRFSGSGSGTDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V58 igkv LCYQ01109557.1 1886 SRGITVTQPKVKTVQLGQTATIECSLDVGLTSNDLAWYQQKPGEAPKLLIYDINSLQSGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQSYHSGFV
Sinocyclocheilus grahami V57 igkv LCYQ01109556.1 269 SRGVTLTQPKVKTVQLGQTATIECNIDVGIYSSYLAWYQQKHGEAPKLLIYYINTLQSGTPSRFSGSGTENTGKDFTLTISGVQTEDTGDYYCQSYHSGGV
Sinocyclocheilus grahami V56 trav LCYQ01107987.1 3447 QKKPGETLTLSCRGSGFSFGCCSMHWIRQQAGKPLVWMGRVNSDSSGYDYSESFKSRTEITRDNSKSMVYLKLSGLTADDSAVYYCAKQAQ
Sinocyclocheilus grahami V55 ighv LCYQ01105461.1 54218 CWCQTLTESESVVIKPGGSHRLTCTASGFSGDQHLAWIRQTTGGGLEWLAYISGGSSYIYYSQYVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARQ
Sinocyclocheilus grahami V54 ighv LCYQ01105461.1 51222 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSVSSYWMGWIRQKPGKGLEWIGLRHDSTVYYAQSLQGQFSITTDTSKNMLYLELKSLKTEDTAVYYCARQSQ
Sinocyclocheilus grahami V53 ighv LCYQ01105461.1 49144 CWCQTLTQSEAAVMKPGQSHKLTCTASSLDMANYWMAWIRQKTGKELEWLAAIRYDSQSIYYSQSVQGQFTISRDNSRKQVYLQMNSLKNEDTAVYYCARE
Sinocyclocheilus grahami V52 ighv LCYQ01105461.1 34675 IYSQVVLTQSEQSVTVSPGASYKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYYTDSSKGSAQSVQDRFMASTDSSNFYLHMSQLKTEDTAVYYCARD
Sinocyclocheilus grahami V51 ighv LCYQ01105461.1 32930 IYSQVVLTQSEQSVTVSPGASYKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYYTDSSKGSAQSVQDRFMASTDSSNFYLHMSQLKTEDTAVYYCARD
Sinocyclocheilus grahami V50 trav LCYQ01105461.1 32021 LFCIELDQPPVMVVKPGETFTIACKITGYSASGGGYNTNWIRHSSGKPMEWIGWYHTSSSNGVKDSLKNKISFSSESSSNTVILTGRNFHTEDSAVYYCAHNAL
Sinocyclocheilus grahami V49 ighv LCYQ01105461.1 24921 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTYMHWIRQAPGKGLEWLIYYYSDSNKGSALSMQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus grahami V48 ighv LCYQ01105461.1 24117 CWCQTLTQSEAAVMKPGQSHKLTCTASSLDMANYWMAWIRQKHGKELEWLAVIRHDSQSIYYSQSVQGQFTISRDNSRKQVYLQMNSLKNEDTAVYYCARE
Sinocyclocheilus grahami V47 ighv LCYQ01105461.1 19791 GVFCVELNQPPSLVVKPQESFSISCRISVSSYYINWIRQPTGKALEWLGYLCSGGGTDIKDSVKNKISFTQDTSKNTVFLQGENFETEDSAVYYCAR
Sinocyclocheilus grahami V46 ighv LCYQ01105461.1 4861 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGDAVISWIRQAGGKALEWISHISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTTLQAEDTAVYYCARK
Sinocyclocheilus grahami V45 ighv LCYQ01105458.1 2394 IDSQVVLTQSEQSVVVAPGASYKLTCACSGFTASSTSMHWIRQAPGKGLEWIIYYYSDSYKSSAQSVQDRFTASKDSSYLYLHMNQLKTEDTAVYYCARE
Sinocyclocheilus grahami V44 ighv LCYQ01105450.1 339 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSYSMHWIRQAPGKGLEWIIYYYSDSSKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCATE
Sinocyclocheilus grahami V43 igkv LCYQ01099910.1 20084 CRGVTLTQPEVKTVQLGQKATIECSMDVALSYDDLIWYQQKPGEAPKLLIHDINSLYSGTPSRFSGSGTAYTGRYFTLTISGVQTEDTGDYYCLS
Sinocyclocheilus grahami V42 igkv LCYQ01099906.1 12963 QITVTQSPSITAAQPGQEVRINCKTSSSVYGGSYLHWYSQKPGEAPKLLIYYATNRYTGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V41 igkv LCYQ01099905.1 38183 QITVTQSPSITAAQPGQEVRINCKTSSSVYNGNYLHWYSQKPGEAPKLLIYYTTSRYTGAPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V40 igkv LCYQ01099905.1 22998 SAGQVTVIQTPTEKHVQNGQTVTLTCKTSSSNGRQSDGWCKSCFSWYLQKPGETPKRLVHSIKTLHTGTPSRFSGSGADTDFSLTISGVQTEDTGHYYCQS
Sinocyclocheilus grahami V39 igkv LCYQ01099905.1 16875 SRGVTLTQPEVKTVQQGQTATIECQIDTGIRYNHLAWYQQKPGEAPKLLIYYINTLQSGTPTRFSGSGTRDTGRDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V38 igkv LCYQ01098318.1 4254 SIGQVTVTQTPSVPLAQTGRSVTVTCTFNRDPDCCYNAKPALSWYLQKPGEAPKLLIYYTSTLQSGTASRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V37 trav LCYQ01073197.1 17765 ESNGNVIRPNQPSEVLTEGSSTTLSCSYDGSAYSLHWYRQKPVSKPEFLLLIVESTKYVNKADQPHPHMFIRLHDNKSVDLEISSAAVSDSAVYYCALE
Sinocyclocheilus grahami V36 trav LCYQ01073193.1 7018 TFAQSIRPLQNDIHVTEKKPVMLSCKYEGSANSLHWYRQYPGSKPEFVLLVMEASTKHVTYADPRIPGMDGKMSMKDKQVDLEISSAEVSDSALYYCALQ
Sinocyclocheilus grahami V35 trbv LCYQ01073190.1 3610 VTHAETITPEHTEVRVNETENITLSCSYSSAYSLLWYRQHHTSAPQFLMLILQSSGKVIQTSDEHLSGKLNVDKNRVDLEIPFSTVKSSAVYFCALQ
Sinocyclocheilus grahami V34 igkv LCYQ01057686.1 751 SRGQISVTQSPSTTAAQPEQTVKISCKTSTDVYRWSDGDEGLFWFLQKPGEAPKLLIRYVKKLESGTASRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V33 igkv LCYQ01051151.1 14407 SRGQISVTQSPSTTAAQPEETVKINCRTSTDVAEYSAPRYYLSWYLQKPGEAPKLLIYLTIDRYSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V32 igkv LCYQ01051150.1 5873 TQTPAVKPVQPGDTVTMSCKTSTEVYQGWSVQPLSWYLQKPGEAPKLLIYAADTLESGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQSVHVINSQHV
Sinocyclocheilus grahami V31 igkv LCYQ01051150.1 2144 SRGQISVTQSPSTTAAQPEETVKINCRTSRDVHRWSDGDEGLAWYLQKPGEAPKLLIRYANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V30 igkv LCYQ01051148.1 1390 SRGQISVTQSPSTTAAQPEETVKINCRTSTDVAEYSAPRYYLSWYLQKPGEAPKLLIYYANTLQSGTPSRFSGSASSATDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V29 igkv LCYQ01051146.1 1777 TQTPSVLLAQTGQSVTVNCIFNSDPTCCCNGKQCLSWYLQKPGEAPKLLIYGTSTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V102 trav LCYQ01004628.1 57141 NILTNMITSHDSQKQVLEGKNVTLTCNYSGVPDNLHWYRQYPRSTPKFLLYIYESGLMSDNIPQRLTPRMNKNTKRVDLEISSAAVSDSAVYYCALR
Sinocyclocheilus grahami V101 trav LCYQ01004628.1 62932 GRFESPITSDQTEVFDEEGANITLSCSYLTAISLHWYRQYPRSAPEYLLLILQISGRVQSTENLDSRFSARLNEKKNRVDLIISSVKVTDSALYYCALE
Sinocyclocheilus grahami V100 trgv LCYQ01004486.1 763 DGNVKMQQKISLTKSVDKTVVIDCNFPSDCSGYIHWYQLKEGQTLRRILYSSISGGATNNDAGFESFKIDRKPSNLALKIPQLKNEHSAVYYCACWVSG
Sinocyclocheilus grahami V99 trgv LCYQ01004486.1 7241 DGAVALQQKISLTKAEEKLAIIDCHLHISCWDYIHWYQQKDRETLKRILYADINDGSAKNDVGFESIKSEKKASNHFVLKITKLKKEHSAMYYCACWVSG
Sinocyclocheilus grahami V97 trbv LCYQ01004486.1 25791 AVLGVSLDQGPKVLFKGVGKTIYLPCKVTGLGTSDYIHWYQVKEGEAPSRLLYITQGGSVARDTNNPQATDFTVDKTKLYDLKLSNTQKSHSAVYFCAYW
Sinocyclocheilus grahami V96 trgv LCYQ01004485.1 94694 DGNVKMQQKISLTKSVDKTVVIDCNFPSDCSGYIHWYQLKEGQTLRRILYSSISGGATNNDAGFESFKIDRKPSNLALKIPQLKNEHSAVYYCACWVSG
Sinocyclocheilus grahami V95 igkv LCYQ01004133.1 1548 TVTQNPSKKTVESGQSVTITCQTSLDVGNWCNSKYCLSWYLKKPGDAPKLLIYHGHIRYSSIPSRFSGNGSDKNFQLVINGAQNEDSGEYYCFCDLGGHR
Sinocyclocheilus grahami V94 igkv LCYQ01004133.1 3725 TVTQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHAPKLLIYLIRERHSNIPSRFSGNGAHTDFNLTISGVQKEDEAQYYCMT
Sinocyclocheilus grahami V93 igkv LCYQ01004019.1 1148 QITVTQTPSVKTATPRENVEMSCKLSSPATACSPPCVFWYLQKPGEAPKLLIYRTNRLQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V92 igkv LCYQ01004017.1 2314 SRGEVTVTQTPAVKPVQPGDTVTMSCKTSTEVYQGWGYQPLSWYLQKPGEAPKLLIYKANVLQSGTPSRFSGSGSNSDFSLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V91 igkv LCYQ01004015.1 1429 TQTPAVKPVQPGDTVTMSCKTSPEVYQSWGYQPLSWYLQKPGEAPKLLIYKANVLQSGTPSRFSGSGSKTDFTLAISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V90 igkv LCYQ01004015.1 3136 QITVTQTPSVKTVTPRENVEMSCKFSSAPACSPPCVSWYLQKPGEAPKLLIYRTSSRQSGTPSRFSGSGSGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V89 ighv LCYQ01160016.1 205 VHCIELNQPALMVIKPGESFSIGCKITGYSASGGGCTNWIRHSAGKAMEWIGWFCSSGNTGTSDTMKNKISFTAETSSNTVFLRGQSFQTEDTAVYYCARNTQ
Sinocyclocheilus grahami V88 ighv LCYQ01158295.1 232 CWCQTLTESESVVIKPVGSHRLTCTASGFSSDPELAWIRQTAGGGLEWLAYISGGSSYIYYSQYVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Sinocyclocheilus grahami V87 ighv LCYQ01157892.1 349 CWCQTLTESESVVIKPGGSHRLTCTASGFSGDPSLAWIRQTAGGGLEWLAYISGGSSYIYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARQ
Sinocyclocheilus grahami V86 ighv LCYQ01157410.1 303 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSGTYMHWIRQAPGKGLEWIIYYYDDNNKNSAQSVQGRFTASSDSSNLYLNMNQLKTEDTAVYYCAR
Sinocyclocheilus grahami V85 igkv LCYQ01157393.1 608 IWGQMTVTQNPEIKSIKQGETVTISCKTSQTLTSCSTCVSWYQQKPGEAPKLLIYSINTLQSGTPSRFSGSGSRTDFSLTISGVQTEDTGDYYCM
Sinocyclocheilus grahami V84 trav LCYQ01155654.1 309 DTVDQPDKHVTEAEGGSVTLQCKYTATTTAPELFWYIQRANDIPKYMLRKSKYGGHQATEFQERFHSEVSSDSVPLMIKNLRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V83 igkv LCYQ01154618.1 1000 IWGQMTVTQNPEIKSIKQGETVTISCKTSQTLTSCSTCVSWYQQKPGEAPKLLIYTINTLQSGTPSRFSGSASGTDFSLTISGVQTEDTGDYYCM
Sinocyclocheilus grahami V82 ighv LCYQ01154357.1 450 CWCQTLTESESVVIKPGGSHRLTCTFSGFSSDPYLAWIRQTAGGGLEWLAYISDGSVSKYYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCAR
Sinocyclocheilus grahami V81 ighv LCYQ01154179.1 887 CWCQTLTESESVVIKPVGSHRLTCTASGFSSDPELAWIRQTAGGGLEWLAYISGGSSYIHYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCAR
Sinocyclocheilus grahami V80 ighv LCYQ01153881.1 110 ISGDEIRLDQSPAVIKRPGETVKISCKISGFTMTDYLMHWIRQKPGKALEWIGRVNSGSSSSSDYLIYADSMKNHFTMSEDLSQSTQYLEAKSLREEDTAVYYCAR
Sinocyclocheilus grahami V79 ighv LCYQ01148337.1 2486 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTGWIRQPAGKALEWIGVIWNSGGVAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Sinocyclocheilus grahami V78 ighv LCYQ01146804.1 413 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTGWIRQLSGKALEWIGFIWSDGNLAYKDSLKSKFSISRDTSSNTITLQGKNMQAEDTAVYYCARE
Sinocyclocheilus grahami V77 ighv LCYQ01146803.1 63 VKKPGETLTLSCRGSGSSFGCCSMHWIRQQAGKPLVWMGCVNSDSSGNDYSESFKSRTEIIRDNSKSMVYLKLSGLTAEDSAVYYCARNSL
Sinocyclocheilus grahami V76 igkv LCYQ01142375.1 1683 SRGLTVTQPKVKTVQQGQTVTIECSMDVGIYSNYLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSYSGTDFSLTISGVQTEDTGDYYCLS
Sinocyclocheilus grahami V75 trav LCYQ01138077.1 2139 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILHRTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYYCALE
Sinocyclocheilus grahami V74 trav LCYQ01138075.1 154 CFGEDTVNQPNENIAGAEGQQVTINCEFKTLQPTPYLYWYIQHSNGPAYVLMRNKFGSSNSSEFEERFDARLDSNSVPLTIKYLRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V73 trav LCYQ01136427.1 1842 CHGEDSVDQPDKNIIEFEGRSVTLQCKYKTALSQPELFWYIQRANNFPKYILRRNNYGGADNDAQFQERFHSEVSSDSVPLTMWNLCVSDSAVYYCALKPTVTE
Sinocyclocheilus grahami V72 ighv LCYQ01126799.1 1791 VYSIELIQPDSKELKPGQPLSLSCKVSGYSLSSCSYCTNWIRQASGGLEWIRRVCCNGDTYNSEKLKNKFSISRDTSSSTVTITGQNMQTEDTAMYYCARESQ
Sinocyclocheilus grahami V71 trav LCYQ01125341.1 2858 ADTIKPSSLNENRHVGDSVTLSCSYKDYTGNIQNLQWYRQYPRSKPEFLLYIFPQGLMSEDRPPRFTAAVNQDNKQVDLEISSAVETDSAIYYCALV
Sinocyclocheilus grahami V70 trav LCYQ01125341.1 1708 SLGDLITSHDSEKQAQDGNSVTLYCNYTGAVYNLLWYRQYHRSKPELLLSMTESGDPVKADPSAHWLSAKADKHRKLMELEISPAKVSDSAQYYCALV
Sinocyclocheilus grahami V69 ighv LCYQ01120877.1 4444 IDSYDLTQPESLTVRPDATLTINCKVSYSVTSYATGWIRQPAGKALERIGFISSGGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Sinocyclocheilus grahami V68 ighv LCYQ01120877.1 2175 VHCVELTQTDSMVLSPGQVLTLSCKISGYSVTDSSYWTHWIQQPAGKALEWVGEICGDGNTYYSDKLKSRFQITRESSSNTVTLQGQNMQTEDTAVYYCARER
Sinocyclocheilus grahami V67 ighv LCYQ01120877.1 645 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEDTAWIRQPAGKPLEWIGVIWSGGGVAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus grahami V66 igkv LCYQ01116271.1 9379 VTLTQPKVKSVQQSQTATIECNIDVGIYGSHLAWYLQKPGEAPKLLIYYINTLQSGTPSRFSGSGTANTGKDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V140 iglv LCYQ01004634.1 332 VSFGDEITPDSTEKSAAVDSTVTLSCSYSSAESLQWYRQYPGSAPQFLVLIIESVKETKTSDVDPRFSTKLRKEKQSTKEINRVDLIISSAAQEDSAMYYCDLT
Sinocyclocheilus grahami V139 trav LCYQ01004634.1 1769 SSGQDRVEQSSEEITASERDQVIVRCNYFTTGINIYLFWYKQLPNKSPTFILNQYTTEPDFKKRFSATLNSTSRTFSLMIKNLLVSDSAVYYCALRPTVTK
Sinocyclocheilus grahami V138 trav LCYQ01004634.1 4169 CWGQDRVEQPSGEMTENEGAQVILMCNYTTTNPDLFWYKQLPNRSPTFIQNQYTTEPDFKKRFSATLDSTSRTFPLTIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V136 trav LCYQ01004632.1 9088 CDSLESVDQNTKVQTAVEGRSVMINCRYETSDLSPYLFWYQQKINGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSAPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus grahami V135 trav LCYQ01004632.1 16153 DTVDQPLHVSEFEGESVTLDCKYTTASPSQELFWYIQRTDESPKLVLQRNSYGGGINGTEFQERFYSEVKPSKSVPLIIQRLRVPDSALYYCALR
Sinocyclocheilus grahami V134 trav LCYQ01004632.1 29832 DTVDQPDKHVTEAEGGSVTLQCKYTATTTAPELFWYIQRANDIPKYMLRKSKYGGHQATEFQERFHSEVSSDSVPLMIKNLRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V133 trav LCYQ01004632.1 38484 CDSLHSVEQNTTVLTAIEGAVVTISCQYETTDILPIFFWYQQKLNGVPEFMLDKFDNHAIHFKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCVLQ
Sinocyclocheilus grahami V132 trav LCYQ01004632.1 40577 EQPSGGMTTNEADQVTLICNYTTKTTNADVYLFWYKQLPNKSSIFILNKYPFSEGITEPDFKKRFSATLDSTSRTVPLTIKNLCVSDSAVYYCALRPTVT
Sinocyclocheilus grahami V131 trav LCYQ01004632.1 41321 KVKQLSREMTANEAAQITLLCNYSTSSYNNAYLYWYKQLPNRSPTFILSEFSIGKGTTEDEFKDRFSASLDSTSRTVPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus grahami V130 trav LCYQ01004632.1 42925 KVKQLSREMTANEAAQITLLCNYSTSSYNNAYLYWYKQLPNRSPTFILSEFSIGKGTTEDEFKDRFSASLDSTSRTVPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus grahami V129 trav LCYQ01004632.1 45231 RVKQPSIEMTAKQGDPVTLRCNYSTTTTNAYLFWYKQLSNRSPTFILNKYSFSEGITEADINKRFSATLDSTSRRVPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus grahami V128 trav LCYQ01004629.1 2704 GSFANVITPVQTEVYKKEGENVTLSCSYSSASTLQWYLQYPGSAPEFLMLILHSTGKVSQMSEIVDRDPRFSGKVNEEKTHVDLEISSAKLTDSALYYCALTPTVTG
Sinocyclocheilus grahami V127 trdv LCYQ01004628.1 7846 NAAADVIKPVFTEKQVLAGKDVTLICNYTGNIQSLQWYRQYPGSKPEHLIMFFETSPKPEPALRLTAAADKAAKSMNLTIFSTEGKDSAMYYCALVPTVTG
Sinocyclocheilus grahami V126 trdv LCYQ01004628.1 10580 NAAADVIKPVFTEKQVLAGKDVTLICNYTGNVQSLQWYRQYPGSKPEHLIMFFETSPKSEPALRLTAAADKAAKSMNLTIFSTEVKDSAMYYCALEPTVTG
Sinocyclocheilus grahami V125 trav LCYQ01004628.1 14558 NADAEVITSFFTKQHVLSGRDVTLSCNYSGNVRNLQWYRQYPGSKPENIIFYTESKSQSEPKLRLYAVADKGIKRMNLSIYSTELDDSALYYCALE
Sinocyclocheilus grahami V124 trav LCYQ01004628.1 17269 NADAEVITSVFIEQHVLAGKDITLSCNYSGYVQNLQWYRQYPGSKPENIIFYTETKSQSEPKLRLYAVADKGIKLMNLSISSTQMDDSALYYCALQ
Sinocyclocheilus grahami V123 trav LCYQ01004628.1 19363 SLGDLITSHNSKKQAQDGNSVTLSCNYTGAVYNLLWYRQYQGSKPELLLSMTESGDPVKEDPSAHWLSAKVDKHTKLMELEISPAKVSDSARYYCALQ
Sinocyclocheilus grahami V122 trdv LCYQ01004628.1 20605 NADANTINPLVPEKHMTAGDNVTLSCEYSGGVNTLQWYRQYPGSRIEFLIFATELSGRSEPALRLSTTADKGNKWMHLNIFLTEMDDSALYYCALV
Sinocyclocheilus grahami V121 trav LCYQ01004628.1 22180 HTEADAIKPLSLNEYRRAGDSATLSCSYKDYTATVQNLQWYRQYPRSKPEFLLYIFQHGAMSEDRPPRFTAAVNQDNKQVDLKISSAVETDSAMYYCALV
Sinocyclocheilus grahami V120 trav LCYQ01004628.1 24533 IKPLSLNENRFVDDSVTLSCSYKDYSGTVNNLQWYRQYPRSKPEFLLYIFPQGVMSEDRPPRFTATVNQDNKQVDLKISSAVETDSAMYYCALR
Sinocyclocheilus grahami V119 trav LCYQ01004628.1 27559 ADAIKPLSLNEYRRVGDSATLSCSYKDYTATVQNLQWYRQYPRSKPEFLLYIFQHGAMSEDRPPRFTAAVNQDNKQVDLKISSAVETDSAMYYCALV
Sinocyclocheilus grahami V118 trav LCYQ01004628.1 29208 SLGDLITSHGSEKQAQDGNSVTLSCNYTGAVYNLLWYRQYQRSKPELLLSMTESGDPVKEDPSAHWLSAKVDKHTKLMELEISPAKVSDSAHYYCALR
Sinocyclocheilus grahami V117 trav LCYQ01004628.1 31074 ADAIKPLSLNEYRRVGDSATLSCSYKDYTATVQNLQWYRQYPRSKPEFLLYIFQHGAMSEDRPPRFTAAVNQDNKQVDLKISSAVETDSAMYYCALV
Sinocyclocheilus grahami V116 trav LCYQ01004628.1 33206 IKPLSLNENRFVGDSVTLSCSYKEYSGTVNNLQWYRQYPRSKPEFLLYIFPQGVMSEDRPPRFTATVNQDNKQVDLKISSAVETDSAMYYCALR
Sinocyclocheilus grahami V115 trav LCYQ01004628.1 34366 SLGDLITSHGSEKQAQDGNSVTLSCNYTGAVYNLLWYRQYQRSKPELLLSMTESGDPVKEDPSAHWLSAKVDKHTKLMELEISPAKVSDSAHYYCALR
Sinocyclocheilus grahami V114 trav LCYQ01004628.1 35560 ADTIKPLSLHENRFVGDSVTLSCSYKDYSGTVNNLQWYRQYPRSKQEFLLYIFQHGAMSEDRPPRVSAAVNQDNKQVDLKISSAVETDSAMYYCALV
Sinocyclocheilus grahami V113 trdv LCYQ01004628.1 36687 EANKSPISSDKAYVSLNEGSNATLSCTFDESAYRLHWYRQKTGSKLEFLLLIDKSTKVVVAASPPLPHMFTSIHNNNRVDLEISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V112 trdv LCYQ01004628.1 38602 NSFADTIQPLSSEKHIFRGDNVTLSCNYSGFVYSLQWYRQYVGSRTEFLILVNENSEASEPSLRLSAKDSKEKKQVNLTISSAEVTDSALYYCALR
Sinocyclocheilus grahami V111 trav LCYQ01004628.1 39392 SAGAYTIESLLPEKHVLVGQSAVISCKYSGNGPSFQWYRQYPRSRPEYLIFNAETAVSSEPTLRLKAMAKKEITEVELEISSTEVKDSAVYYCALV
Sinocyclocheilus grahami V110 trav LCYQ01004628.1 40665 ISFANIIQPLSSEKHVFRGEQVILSCNYSGNVDNLQWYRQYPGSRPEHLILVTEYSEPDLSRRLSAKATKDLKQVHLTISSAEETDSAMYYCALQ
Sinocyclocheilus grahami V109 trgv LCYQ01004628.1 43748 TVLANAITSRSTKQHVLEGGKVTISCNYSGSNINSLQWYRQSSKTAPEFILQAFERSGLQQKDRYVAKVQINEKQLILEISKTEMADAVIYYCALV
Sinocyclocheilus grahami V108 trav LCYQ01004628.1 44805 ISFANIIQPLSSEKHVFRGEQVILSCNYSGNVDNLQWYRQYPGSRPEHLILITEYSEPDLSRRLSAKATKDLKQVHFTISSAEETDSALYYCALQ
Sinocyclocheilus grahami V107 trdv LCYQ01004628.1 45556 SVFANAITAMSSENNAFEGGKATLSCNYSGSNIKSWQWYRQYPNTAPEFLLQALEGLGPEQKDRHVAEAQKDKKHLKLEISKTEVADAALYYCALV
Sinocyclocheilus grahami V106 trdv LCYQ01004628.1 47817 GIAPLSSSELVTNGDSITLVCNYNGTYNSDSLLWYRQYSSSKPEFLFLVSEAKFEQPADPPIPGVFAKLNEEKNRVVLEISSASVSDSALYYCALQ
Sinocyclocheilus grahami V105 trav LCYQ01004628.1 49651 SVFANAITPLFTEKHASEGEKATLSCNYSGSNIQGWQWYRQYPNTAPEFLLQAFESLGPEQKDRHVAEAQKDKKHLNLEISKTEVADSAIYYCALV
Sinocyclocheilus grahami V104 trdv LCYQ01004628.1 54035 GCFAQTITPLQDRTQVTEGEPVNLSCKYDVSVQNLRWYRQYPGSGLEFLLLVVESSRKTVVYADPPIPRLDGEMSIKDKRVDLTISSAEVTDSALYYCALQ
Sinocyclocheilus grahami V177 trbv LCYQ01014722.1 13545 EKGDMTVHQKPHNLIINDGESPEIKCFHKIPDYDRLLWYKQSQSEELTFMGYLMGDSGYPEKAFQNKIKLRGDANKFHGSLTLINSTSENSAVYFCAA
Sinocyclocheilus grahami V176 trbv LCYQ01014722.1 19844 SILGKSVLQTPSDLLKKEDEFVEIKCSHSIPNYYVIQWYKQSQSIKVLQLMGHINVEQETTEPEFKAKIKLDGDGRNNGTLTINTLMLNDSAVYFCAAYDTVLR
Sinocyclocheilus grahami V175 trbv LCYQ01014722.1 24121 AHHAKTVLQSPDDLLKNQNELAVIVCSHNIQNYDRMLWYKQSQDMPGLKFMGYLYADQNIEPEFTNKIKLEGDAKRNGTLTINNLTPQDNAVYFCAAY
Sinocyclocheilus grahami V174 trav LCYQ01014722.1 30157 TVGADDVIQEPKILWGQKESSVHMNCTHNKGSTYRQMYWYRQRQGQTMRLIAFTTSYTKPEYEDSELNKFVANKTVAESGSLTVNNLQLNDSATYFCSVSE
Sinocyclocheilus grahami V173 trbv LCYQ01014722.1 44595 ACLGKTVLQTPDNLIKNQDESAVIMCSHKIPSYYQILWYEQSPDMLGLKLMGYLNNDAENKEPEFDKKIKLDGDGRNDGTLIISNLTLKDSAVYFCAAY
Sinocyclocheilus grahami V172 trbv LCYQ01014720.1 709 FSLSNKVNQSPPDMIERQGETAKIQCSHSVSSYNQINWYRQNQDHGFTLMGYLLGTDPYKENDFKDKIEMSGDGNSNGYLNIKSLSSNDNAVYFCAAY
Sinocyclocheilus grahami V171 trgv LCYQ01014720.1 13237 LIRSKKVDQTPQDLIINLTESAVLTCSHSDQGFELILWYKRSDDKGFIFLGYLNNNFPNPEEDFKHKIDLAGDGRSSATLTIKDLTEDNSGVYYCAAR
Sinocyclocheilus grahami V170 igkv LCYQ01009052.1 40737 TVTQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHAPKLLIYLIRERHSNIPSRFSGNGAHTDFNLTISGVQKEDEAQYYCMT
Sinocyclocheilus grahami V169 trav LCYQ01004639.1 5585 VVFGNVIKPNKTDIVYEEGSDITLSCSQSPGASDYIYWYRQYERSKPEFLVLTYGSAKEAAVSEVDPRFSVKVEKREQIHVDLKISSAAVSDSALYYCALR
Sinocyclocheilus grahami V168 trav LCYQ01004639.1 11214 IESQDSIEQKTRVQTAYEGGTVIINCTYQTSYGPTLFWYQQKVNRVPKYMLNRVGKTGDEDKEFKDRFNAHIDTSSKSVPLTIKDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V167 trav LCYQ01004639.1 19782 AVFGNVIKPNKTDVFAEEASSVTLSCNFSDSGGTDYLHWYRQYGRSKPEFLVLTYDTAKEAQRSVVDPRFSVNITKREQNHVDLKISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V166 trav LCYQ01004639.1 24073 AVFGNVIKPNKTDVFAEEASSVTLSCNFSDSGGTDYLHWYRQYGRSKPEFLVLTYDTAKEAQRSVVDPRFSVNITKREQNHVDLKISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V165 trav LCYQ01004639.1 27026 VVFGNNISPDTTDVGAHEGQKATLSCSYSSSGVTENLFWYRQYGRSKPEFLVATYSTAKESEISGVDSRFSVKVTKKEQIHVDLKISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V164 trav LCYQ01004639.1 28486 EETVRQPERHQTELEGKLVTLNCKYSSASAAPDLFWYIQRANDIPKYILRRDNFGTGETGTEFQERFHSKLSSDSVPLTIQDVHVSDSAVYYCALR
Sinocyclocheilus grahami V163 trav LCYQ01004639.1 29395 QDNVIQSKPVMTAYEDGTATLDCTYKATSTQYPNLLWYQQKTNRSPKYMLIRLSGSSSNNEEFKERFNADLNTSSKSVPLTIKDVRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V162 trav LCYQ01004638.1 1890 SSGQERVEQSSREMPESEGAQVILMCNYTTTSTSPNLFWYKQLPNRSPTFILNQYTTEPDFINKYSATLNSTSRTFPLMIKNLLVSDSAVYYCALRPTVTK
Sinocyclocheilus grahami V161 trav LCYQ01004638.1 4079 ISFADTIQPLYSEKYVVEGKNVTLSCNYSTTGTVDSLQWYRQYLGAKPEFLLQVNEYSSKSEPDLRLYSKATKEIKRVDLVISSAVVSDSALYYCALR
Sinocyclocheilus grahami V160 trav LCYQ01004638.1 7764 AVFGNVIKPDQPEVFAEEASDITLSCNFSDSGTTDNLHWYRQYGRSKPEFLVLTYSSAKEAQRSDVDPRFTVKVEKREHVDLMISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V159 trav LCYQ01004638.1 9410 AVFGNVIKPDQPEVFAEEASDITLSCNFSDSGTTDNLHWYRQYGRSKPEFLVLTYSSAKEAQRSDVDPRFTVKVEKREHVDLKIFSAAVSDSALYYCALQPTVTG
Sinocyclocheilus grahami V158 trav LCYQ01004638.1 19440 IESQDSVEQKTGVQTAYEGGTVIINCTYQTSYSPTLFWYQQKVNRVPKYMLNRVGKTGDEDKEFKDRFNAHIDTSSKSVPLTIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V157 trav LCYQ01004638.1 27831 CRSEDTVDQTEQHVTEAEGRSVELKCKYKTVSVQEELFWYIQRANDFPKYILRRNKYGGENDVQFQERFHSEVSSNSVPLTIKNLRVSDSAVYYCVLK
Sinocyclocheilus grahami V156 trav LCYQ01004638.1 29434 CNSQDKVDQHTRIQSAFEGATVTIDCTYQTAFTNPTLFWYQQKVSGIPKYMLNKFSKSGNSEEEFKKRFHANLSKTSVPLTIQDVRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V155 trav LCYQ01004638.1 36458 AVFGNAIKQNKTTVVYEEGSNILLICSYYPGNSDDLHWYRQYERSKPEFLVLTYGSAKEAAVSDVDPRFSVKVEKREQNHVDLKISSAAVSDSALYYCALR
Sinocyclocheilus grahami V154 trgv LCYQ01004638.1 38279 NSSGDTIQQWFPEKHGSEGENVTLSCNYSLTGSTSVTLQWYRQYPRAKPEFLLLVTEYSSKSEPELRLYSEVKNQIKRLDLVIFPAAVSDSALYYCALRTT
Sinocyclocheilus grahami V153 trgv LCYQ01004638.1 40274 NSSGDTIQQWFPEKHGSEGENVTLSCNYSLTGSTSVTLQWYRQYPRAKPEFLLLVTEYSSKSEPELRLYSEVKNQIKRLDLVIFPAAVSDSALYYCALRTT
Sinocyclocheilus grahami V152 trdv LCYQ01004637.1 2256 PSKGDTMTPDKTEEFAAKGSNVTLSCSYSSAWSLLWYRQYPRSAPEFLVLISDSAKQAQTSGVDHRLTTKIRKKEKQNHVDLDISSAAVSDSALYYCALE
Sinocyclocheilus grahami V151 trav LCYQ01004637.1 5962 AVSGNVITPDETELFAEEGSNVTLSCSYSSADYLYWYRQYPGSAPEFLELILDGTTKTKKSDVDPRLSVKLTKQEQKHVDLKISSAAVSDSALYYCALR
Sinocyclocheilus grahami V150 trav LCYQ01004637.1 8645 YTLAQSITPQENKALATVGQKVTLSCKYEGAITNLHWYRQYPRSKPEFLAWIYPQGATSNPLPPRIIPKVDKNLVSLEISDAEVTDSVLYYCTLT
Sinocyclocheilus grahami V149 trav LCYQ01004637.1 9762 CDSQDSVEQKTRVQTAFEGEPVTINCTYSTTDSFPYLFWYQQEIKGYPRYMLKKFPGSGEVDKQFEGRFDANLNTSTTSVPLMIKNLRVSDSAVYYCALRPTVT
Sinocyclocheilus grahami V148 trav LCYQ01004636.1 3902 AVFGNVIKTNKTDVVYEEGSDITLSCSQSPVASDNIHWYRQYERSKPEFLVLTYGSAKEAAVSEVDPRFSVKAEKREQIHVDLEIFSAAVSDSALYYCALRPT
Sinocyclocheilus grahami V147 trav LCYQ01004636.1 5560 VSFGDEITPDSTEKSAAVDSTVTLSCSYSSAHSLQWYRQYPGSAPQFLVLIIESVKETKTSDVDPRFSTKLRKEKQSTKEITRVDLIISSAAVSDSALYYCALR
Sinocyclocheilus grahami V146 trav LCYQ01004635.1 1247 CHGEDSADQLDKHIAEFEGRSVTLQCKYKTASSQPELFWYIQRANDFPKYMLRRNKFGAKDNDAQFQERFHSEVSSDSVPLMIKNLRVSDSAVYYCALPPTVTE
Sinocyclocheilus grahami V145 trav LCYQ01004635.1 3015 SSGQDSVEQSSREMPANEGAQVILICNYTTSTTPYLFWYKQLPNRSPTFILNQYTTEPDFKKRFSATLDSTSKTFPLTIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V143 trdv LCYQ01004635.1 5783 ASNGDTITSDKTVEFVAEGSNATLSCSYSSAWSLLWYRQYPRSAPEFLVLISDSAKQAQTSDVDQRFSSKIRKEKQNHVDLKISSAALKDSALYYCALR
Sinocyclocheilus grahami V142 trav LCYQ01004635.1 7454 AVSGNVITPDETELFAEEGSNVTLSCSYSSADYLYWYRQYPGSAPEFLELILDGITNTKKSDVDPRLSVKLTKQEQKHVDLKISSAAVSDSALYYCALR
Sinocyclocheilus grahami V214 trav LCYQ01021814.1 44938 VSFGDEITADSTEESAAVGSTVTLSCSYSSAQSLQWYRQYPGSAPQFLVLIIESVKETKTSDVDPRFFTKLRKEKQDTKEIKHVDLIIFSAAVSDSALYYCALRST
Sinocyclocheilus grahami V213 trav LCYQ01021814.1 46186 SSAQDRIEQTSREMTESEGAQVILMCNYTTASTSPYLFWYKQLPNRSPTFILNQYTTEPDFTKKYSATLNSTLRTFPLMIKSLHVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V212 trdv LCYQ01021813.1 1299 ATYGNEIKPTKTEEFADEGSSVKLSCSYTSAYYLHWYRQYPGSAPEFIVLISDSAKEDQKSNVDSRFTAKVTKDNNEYLVDLEISSASISDSALYYCALTPTVTG
Sinocyclocheilus grahami V211 trav LCYQ01021813.1 2516 KVEQASRQMTANEAAHVTLLCNYSTSFLNAYLFWYKQLPNTSPTFILSEFTVGKGTTENAFKERFSATLDSTSRSVPLTIQDVCVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V210 trav LCYQ01021813.1 7963 VSLGDEITADSTEESAAVGSTVTLSCSYSSAQSLQWYRQYPGSAPQFLVLIIEGVKETKTSDVDPRFSTKLRKEKQSTKEIKHVDLEISSAAVSDSALYYCALR
Sinocyclocheilus grahami V209 trgv LCYQ01021812.1 422 SWGQDRVEQPLGEMTATKGDPVTLQCNYSTIATNAYLFWYKQLPNRSPTFILSEFTIGKGTTEDEFKERFSATLDSKSSTVRLTIKNLRVSDSAVYYCALK
Sinocyclocheilus grahami V208 trav LCYQ01021809.1 430 RVEQPLGEMTAIKGDPVTLQCNYSTSATNAYLFWYKQLPNRSPTFILSEFTIGKGTTEDEFKERFSATLDSKSSTVRLTIKNLRVSDSAVYYCALK
Sinocyclocheilus grahami V207 trav LCYQ01021807.1 1078 CKSEDAVHQNIRVQTADEGAAVIINCSYTTTDPSPTLFWYQKQVNGFPKYMLNRVATYGNNEEEFKKRFNASLNTQTKSVPLTIQDVRVSDSAVYYCALR
Sinocyclocheilus grahami V206 trav LCYQ01021807.1 2385 CWGQDRIEQPSGEMTANKGDPVTLQCNYSTSATNVYIYWYKQLPNRSPTFMLSVFSFGKGTTEDEFKDRFSATLNSKSTTVPLMIEDVRVSDSAVYYCALQ
Sinocyclocheilus grahami V205 trav LCYQ01021807.1 5060 SSGQDRVEQSSEEMTASEGAQVIVWCKYITTDTTPYLFWYQQLPNRSPTFILNKLTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKDVRVSDSAVYYCALRPTVTG
Sinocyclocheilus grahami V204 trdv LCYQ01021807.1 6246 YGNEIKPTKTLEFADEGSSVKLSCSYLSALTLYWYRQYPGSPPEFIVLISDRSKQPEESNVDSRFTAKVTKDKENHVDLEISSASISDSALYYCALEPTVTG
Sinocyclocheilus grahami V203 trav LCYQ01021807.1 7190 CHGEELVDQPDKNIAEFEGRSVTLQCKYKTTSSQPELFWYIHRANYFPKYILWRNKFGAKDNDAQFQERFDSEVSLDLVPLTIKNLRVSDSAVYYCALR
Sinocyclocheilus grahami V202 trav LCYQ01021807.1 15391 SSGQDRVEQSLKELTASERDEVIVMCNYFTTVTNINLFWYKQLPNRSPTLILGQYTTEPDFKKRFSATLNSTSRTFPLMIKNQHVSDSAVYYCALKPTVTE
Sinocyclocheilus grahami V201 trav LCYQ01021807.1 17052 SSGQDNVEQSSREMPANEGAQVILMCTYTTSGTPYLFWYKQLPNRSPTFILSQYSTEPDFKRFSATMNSTSRTFPLMIKNLHVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V200 trav LCYQ01021807.1 18357 VSFGDEITPESTEESAAVGSTVTLPCSYSSAQSLQWYRQYPGSAPQFLVLIMESVKETKTSDVDPRFSTKLKKEKQATKEIKHVDLIIFSAAVSDSALYYCALT
Sinocyclocheilus grahami V199 trdv LCYQ01021807.1 19471 SSAQDRIEQSSREMTESEGAQVILMCNYTTASTTNYLFWYKQLPNRSPTFILSQYSTEPDFKRFSATMNSTSRTFPLMIKNLHVSDSAVYFCALRPTVTE
Sinocyclocheilus grahami V198 trdv LCYQ01021807.1 20501 ASNGDTITPDKTEEFVAEGSSVKLSCSYSSAWSLLWYRQYPGSAPEFLVLISDGAKQTQTSDVDQRFSTNNRKEKQNHVDLIISSAAVSDTALYYCALR
Sinocyclocheilus grahami V197 trav LCYQ01021807.1 21289 TSSADTIQPFTLEKHVFEGENVTLSCNYSTTGVTVNSLQWYRQYLKEKPTFLLLLTEYSNKSEPDLRLYSKATKEIKRVDLIIFSAAVTDSAVYYCALQPTVTG
Sinocyclocheilus grahami V196 trav LCYQ01021807.1 23357 CDSLDSVEQNTTVQTIVEGAAVTISCQFETTDISPNLFWYEQKANGVPEFMQSKFGSRIQFKERFNGDLSTISKSFPLTIQNVRVSDSAVYYCALR
Sinocyclocheilus grahami V195 trav LCYQ01021806.1 2323 CKSEDAVHQNMRVQTADEGAAVIINCSYTTTDPLPTLFWYQQKVNGFPKYMLSTYGNNEEEFKKRFNASLNTITKSAPLTIQDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus grahami V194 trgv LCYQ01021805.1 4136 CWGQDSVEQHLREKTSAEGNQVTLLCNYTLMSSANAYLFWYKQLPNRSPTFVLSDFSIGKGTTEPEFQERFHTKLDSTLGTVPLMIEDVRVSDSAVYYCALK
Sinocyclocheilus grahami V193 trav LCYQ01021805.1 5442 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDPSPYLFWYQQKTNGIPKYMMTIIATNVQNDKDFEERFNANHDKTSKSVPLMIKDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V192 trav LCYQ01021805.1 11941 CDSLDSVEQNTTVQTAVEGAAVTISCQYETTDISPDLFWYQQKVNGFPEYMLNRFGTNDKPFKERFNGDLNTISKSFPLTIQDVRVSDSAVYYCALRPTVTK
Sinocyclocheilus grahami V191 trav LCYQ01021803.1 571 CQSDDTVDQPFKHVTKFEGESVTLDCKYTTASTSQELFWYIQRTEESPKLVLQRNSYGGGSNGTEFQERFYSEVKPSKSVPLIIQRLCVSDSAVYYCALR
Sinocyclocheilus grahami V190 trav LCYQ01014724.1 15034 ANHAKTVLQSPDDLIKNQNERAVIVCSHNIQNYNQMLWYKQGQDMPGLKLMGYLYGDENIEPEFTNKIKLEGDAKRNGTLTINNLTPQDSAVYFCAAY
Sinocyclocheilus grahami V189 trbv LCYQ01014724.1 19331 ACLGKTVLQTPDNLIKNQDESAVIMCSHKIPSYYQILWYKQSPDMLGLKLMGYLNYDAENKEPEFDKKIKLDGDGRNDGTLIISNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V188 trbv LCYQ01014724.1 33937 ACLGKTVLQTPDNLIKNQDESAVIICTHNIPSYYRILWYKQSPDMLGFKLMGYLNYDKENKEPEFEKKIKLDGDGQKNGTLIINNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V187 trav LCYQ01014724.1 36607 SVVNGSVNQNPSNLITSERDTAELVCEHNIPSYTMIFWYKQTLSRDLTLLGYTWNKNSIPEDNFNKKIKLDGDGTKNGSLKIHQLEASDSAMYYCAAS
Sinocyclocheilus grahami V186 trbv LCYQ01014724.1 38481 PVFSTKVHQSPPDLFKMKGDDAQLECQHSISSNNVILWYKQTPGQGLILLGHLMMQIGQREDDFIGKVELKGDATKSGSLTIKYLSDNDSAVYFCAAS
Sinocyclocheilus grahami V185 trav LCYQ01014724.1 39778 DSDVSQVPSVLMAVNGSSVQLNCTHKKDFIFTQMYWYRQRSGQTMTLIVFTSTASSKHDYADSDPNKFPAIKTVPESGSLTVNSVESDDSAVYFCIVR
Sinocyclocheilus grahami V184 trbv LCYQ01014724.1 40546 ACLGKSVLQTPNDLLKNQDESAVITCTHKIQSYDRILWYRQSQDSLGFKLMGNLYLNNPNEEPEYKNKIKLEGDGRDKGNLTISNLTLNDSAVYFCAAY
Sinocyclocheilus grahami V183 trbv LCYQ01014724.1 42163 AGDSDVSQVPSVLMAVNGSSVQLNCTHKKDSSFVQMYWYRQRPGQTMTLIVFTSTLSSKHDYADSDPNKFPAIKTVPESGSLTVNSVESDDSAIYFCSVS
Sinocyclocheilus grahami V182 trav LCYQ01014724.1 50212 DSDVSQVPSVLMAVNGSSVQLNCTHKKDSSFVQMYWYRQRPGQTMTLIVFTSTLSSKHDYADSDPNKFPAIKTVPESGSLTVNNVESDDSAVYFCSVR
Sinocyclocheilus grahami V181 trbv LCYQ01014724.1 51287 AGDSDVSQVPSVLMAVNGSSVQLNCTHKKDSSFVQMYWYRQRPGQTMTLIVFTSTLSSKHDYADSDPNKFPAIKTVPESGSLTVNNVESDDSAVYFCSV
Sinocyclocheilus grahami V180 trav LCYQ01014724.1 54472 TEGEDEVIQEPEILWEPKSGSASLSCKHNKGSSYYQMYWYRQRPGETMRLVVFMAGGKPDFGDVDEKKFEAQKSDAESGSLKVKDLEPDDSAIYFCAVS
Sinocyclocheilus grahami V179 trbv LCYQ01014723.1 931 ANHAKTVLQSPDDLLKNQNELAVIVCSHNIQNYDQMLWYKQSQDMPGLKLMGYLYADQNIEPEFTNKIKLEGDAKRNGTLTINNLTPQDSAVYFCAAY
Sinocyclocheilus grahami V251 trbv LCYQ01069105.1 11327 FSDGVLITQWPKYISSLPSSSAEMHCYQNDTDYNYKYWYRQIKGEGPVLIGSNDFNSPSNEKGFENGFTISGTETKKWTLTVDVKKGIDAVYLCAAS
Sinocyclocheilus grahami V250 trav LCYQ01069105.1 13037 MVRCVNVQQNMTPLLFNKNKTAELMCRYDDSGKPNMLWYQQKNTAMALIVLSYSAEGVPIYEDGFKKQFKLERKDTLNGVLRISDLSLSDSAVYYCAVS
Sinocyclocheilus grahami V249 trbv LCYQ01069105.1 20941 ISLGSSIDQPADMMKHQGDTVNISCTHTYSSYYYLYWYQQTTQEESFKLLGYLYMKKFNPEKDYDRFYIYGNSQTHGTLQISTVTSEDSAMYFCAVS
Sinocyclocheilus grahami V248 trbv LCYQ01069105.1 22079 CVVCSPVIQQSPKHLLRIVEEKEAKLSCHHGVSSYQYMYWYQQKSNDGSLELIGMLNYGTAYQEEKFQSRFNITGHAKEDAFLLISNINAEDSAVYFCAAS
Sinocyclocheilus grahami V247 igkv LCYQ01067682.1 2765 QITVTQTPSVKTVTPRENVEMSCKLSTATPCSPNPCVFWYLQKPGEAPKLLIYWTNTLQSGTPSRFSGSGSGTDFSLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V246 igkv LCYQ01067682.1 8786 QISVTQTPSVAAVQPGETVTLNCRTSRGIGDRSAGCGSCLAWYLQKPGEAPKLLIYYISSRQSGTPSRFSGNGANYGTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V245 trgv LCYQ01040987.1 35990 SKSNRIHILQQPTSSGGNVTLLCTIQNEQDSCGGDHKVYWFKHGLGKSHSGIIYTQGSCKNSSMAVSPTKSCLYSLSLRNIKPSDAGTYYCAV
Sinocyclocheilus grahami V244 trav LCYQ01040976.1 2903 SDGIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSYPGLIYTRDNRSDQCMERSENGSSTQSCIFSLSQTELRPSDAGIYYCAVATCGK
Sinocyclocheilus grahami V243 trav LCYQ01021821.1 1064 KVDQHTKIQSAFEGDTVTIDCTYQTAYTGPTLFWYQQKDNGNPKYMLNKYSKSGNSEEEFKERFNVNLNKTAVPLTIQDVRVSDSAVYYCALR
Sinocyclocheilus grahami V242 trav LCYQ01021821.1 5047 NSFGDTIQPWFPEKHDFDGENVTLSCNYSLTSGTSVTIQWYRQYPGAKPEFLLLVTEYSSKSEPELRLYSEAKKEIKRVDLVIFSAAVSDSALYYCALQ
Sinocyclocheilus grahami V241 trav LCYQ01021821.1 5692 SVNQPTRVQTASEHEMAKLHCTYSTSDSYPYLYWYQHKTNGFPVYMLRKLSTGSSSIEKEFEERFHADLNKSSSSVSLSIQDVRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V240 trav LCYQ01021821.1 8180 AVFGNTIKPNKTDVVNEEGSNVILSCSHSPAATDYIHWYRQYERSKPEFLVLTYGSAKEVKVSDIDPRFSVKVEKRKEIHVDLEISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V239 trav LCYQ01021821.1 11029 VALGNVIKPDQTYVVHEEDSSVTLSCSFSASGRTDYLHWYRQYGRSKPEFLVLTYDTAKGAQRSDVDPRFSVNIPKREHVDLEISSAAVSDSALYYCALV
Sinocyclocheilus grahami V238 trav LCYQ01021821.1 12617 CRSEDTVDQPDKHVTEAEGRSVTLQCKYKTDSTQENLFWYIQRAKDFPKYILRRSKYGGENGTEYQERFHSKLSSNSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus grahami V237 trav LCYQ01021821.1 13354 AVFGNFIKPNKTDVFAEEGSGVTFSCSFSASGGSDNLHWYRQYGRSKPVFLVLIYSNAKEAQQSDVDPRFSVKVEKREKNLVDLEISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V236 trav LCYQ01021821.1 17476 CRSEDTVDQPDKHVTEAEGRSVTLQCKYKTDSAQEDLFWYIQRAKDFPKYILRRSKYGGENGTEYQERFNSKLSSNSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus grahami V235 trav LCYQ01021821.1 18196 AVFGNFIKPNKTDVFAEEGSGVTLSCSFSASGGSDNLHWYRQYGRSKPVFLVLIYSNAKEAQQSDVDPRFSVKVEKREKNHVDLEISSAAVSDSALYYCALQ
Sinocyclocheilus grahami V234 trav LCYQ01021819.1 789 DTVDQPDKHVIEVEGQSVTLQCKYKTDSAQENLFWYIQRANNFPKYILRRNRYGGEDNDTQFQGRFHSEVSSNSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus grahami V233 trav LCYQ01021815.1 1095 KVDQHTRIQSAFEGDTVTIDCTYEATYTGPTLFWYQQKENGNPKHMLNKFSKSGNSEEEFKERFHANLSTTSVPLTIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V232 trav LCYQ01021815.1 2177 NSFGDTIQPWFPEKHDSDGENMTLSCNYSLTSGTSVTIQWYRQYPAAKPEFLLFVTEYSSKSVPELRLYSEAKKEIKRVDLVIFSAAVSDSALYYCALQ
Sinocyclocheilus grahami V231 trav LCYQ01021815.1 2792 CNTQDSVNQPTRVQTASEHEMVKLHCTYSTSDSHPYLYWYQHKTNGFPVYMLRKLSTGSSSSEKEFEERFHADLNKSSNSVSLSIQDVRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V230 trav LCYQ01021815.1 7044 IESQDSVEQKTRVQTVYEGGTVIINCTYQTQLTPTLYWYQQKVNRVPKYMLQRVGKTGAEDEEFKDRFNAHIDTSSKLVPLTIQDVCVSDSAVYYCALK
Sinocyclocheilus grahami V229 trav LCYQ01021814.1 236 SSGQDRVEQSSGEMTASERDHVIVGCNYFTTDTNPYLFWYQQLPNRSPTLILGQYTTEPDFKKRFSATLNSTSKTVPLMIKDVRVSDSAVYYCALRPTVTG
Sinocyclocheilus grahami V228 trav LCYQ01021814.1 1345 AVFGNVIKPNNTDVVYEEGSNVTLSCSHSPAATDYIHWYRQYGRSRPEFLVLTYGSAKKAEVSDVDPRFSVKVEKREKIHVDLKISSAAVSDSALYYCALA
Sinocyclocheilus grahami V227 trav LCYQ01021814.1 9143 SSGQDRVEQSSEEMTASERDQVIVWCKYITTDTDPYLFWYQQLPNRSPTFILNKLTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKDVRVSDSAVYYCALRPTVTG
Sinocyclocheilus grahami V226 trdv LCYQ01021814.1 10219 TTYGNEIKPTKTEVFSDEDSSVILSCNYSSAYYLHWYRQYPGSAPEFIVLISDGSKQAQESNVDSRFTAKVTKDKEKLVYLEISSASISDSALYYCALEPTVTG
Sinocyclocheilus grahami V225 trav LCYQ01021814.1 11392 CHGEERVDQPDQHIAEFEGRSVTLQCKYKTTSPQPELFWYIQKENDFPKYMLRRNKYGGEDNDAQFQERFDSEFSSDSVPLTIKNLCVSDSAVYYCALKPTVTE
Sinocyclocheilus grahami V224 trav LCYQ01021814.1 12611 TSFADTIQPLSSEKYVIEGKNVTLSCNYSSSTGNVNSLQWYRQYFGAKPEFLLLVNEYSSKSEPDLRLYSKATKEIKRVDLEISSAAVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V223 trav LCYQ01021814.1 16028 SVFGNGIKPNKTDVVYEEGSNVTLSCSHSPAATDYIHWYRQYERSKPEFLVLSFAGAKKAEVSDVDPRFSVTVEKREQIHVDLKISSAAVSDSALYYCALA
Sinocyclocheilus grahami V222 trav LCYQ01021814.1 17948 CHGEDSVDQPYKHITEFEGKPVTLQCKYKTASSQPDHFWYIQRANDFPKYMLRRNKYGGEDNDAQFQERFDSEVSSDSVPLTIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V221 trav LCYQ01021814.1 23473 AVSGNVIPDETEHFAEEGSNVTLSCSYSSADYLYWYRQYLGSAPEFLVLIFDGASNTEKSDVDPRLLVKLTKREQKHVDLEISSAAVSDSALYYCALR
Sinocyclocheilus grahami V220 trav LCYQ01021814.1 26634 CDSLDSIEQETRVQTAVEGETVTINCTYSTTDSFPYLFWYQQEINGYPRYMLKKFPGSGEVDKQFEGRFDANLYTSRTSVPLTIQDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus grahami V219 trdv LCYQ01021814.1 27803 ETFAQSITPLENKALKSEGEKVTLSCKYDGAVNNLHWYRQHLGSKPEFIAYIYPHGATSNPLPDRIIPKVDKNNNLVSLEISDAQVTDSALYYCALS
Sinocyclocheilus grahami V218 trav LCYQ01021814.1 29128 CNSQDKVDQHTRIQFAFEGDTVTIDCTYQTAYPGPTLFWYQQKDNGNPKYMLNKVSKSGNSEEEFKERFHANLSTTSVPLTIHDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V217 trav LCYQ01021814.1 36714 EQPSREMTASEADRVTLMCNYTTKATNTDAYLFWYKQLSNKSPAFILNKFPFSEGTTEPDFKKRFSATLNTTSKTVPLMIEDVRVSDSAVYYCALR
Sinocyclocheilus grahami V216 trav LCYQ01021814.1 37781 CKSEDAVHQNMRVQTADECAAAAIINCTYTGIDPSPTLFWYQQQVNGFPKYMLSTYGANDDDFKKRFNARLNTVTKSAPLTIQDVRVSDSAVYYCALR
Sinocyclocheilus grahami V288 trav LCYQ01107921.1 25744 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEYLLIILHRTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYYCALT
Sinocyclocheilus grahami V287 trav LCYQ01107921.1 29607 CFGEDTVNQPNENIAGAEGQQVTINCEFKTLQPTPYLYWYIQHSNGPAYVLMRNKFGSSNSSEFEERFDARLDSNSVPLTIKYLRVSDSAVYYCALQPTVTE
Sinocyclocheilus grahami V286 trav LCYQ01107921.1 31423 EDSVTQPTKVQTATAGETVTIDCTYKTNAFPTLYWYQYKANQAPKYMLKRYAGSSDEDEDFKERFNATLQTSSTSVPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus grahami V285 trav LCYQ01107921.1 32595 CDSLESVDQNTRVQTAVEGRSVTINCINCTYETSDPSPYLFWYQQKTNGIPKYMMMIFAKTVQNEKDFEERFNANHDKTSKSVPLMIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus grahami V284 igkv LCYQ01078400.1 216 SHEEVQSPEYLSVKAGDSVSISCTASSGIGYDMSWYLLRPGKNPKLLIYTTSNLASGVSDRFSGTYSGYEFTLNIRGVQPEDAGVYYCMGAYSGRC
Sinocyclocheilus grahami V283 igkv LCYQ01073507.1 4484 SHEEVQSPESLSAKAGDSVSISCTGTSGVGSDMSWYLLKHGEAPKLLIYGARALEPGVPDRFSGSVSEPDFTLNIHGVQTEDAGVYYCGFYEGPV
Sinocyclocheilus grahami V282 igkv LCYQ01073504.1 951 SVGQILTQSEDQTVKPDQTVTIHCNHTPAVNCRKKDTSLYCMSWYHQIPGEAPKLLTYYTSERASGVSSRFSGSESGNHMDFTLTISGVQPEDSGDYYCQS
Sinocyclocheilus grahami V281 trbv LCYQ01069114.1 3584 ACLGKTVLQTPDDLLKKQDESAVITCTHSIQSYDRILWYKQSQDVLGFELMGQLFYKDETKEPGFEKKIKLEGDGRNKGILTIGNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V280 trbv LCYQ01069113.1 9313 ACLGKTVLQKPDDLLKKQDESAGITCTHSIQRYDQILWYKQSQDSLGLKLMGNLYIESKTKEPGFENKIKLEGDGRNKGILTIGNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V279 trbv LCYQ01069113.1 13536 ACLGKTVLQKPDDLLKKQDESAGITCTHSIQRYDQILWYKQSQDSLGLKLMGNLYIESKTKEPGFENKIKLEGDGRNKGILTIGNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V278 trbv LCYQ01069113.1 15579 ACLGKTVLQMPDKLIKNQYESAVIICTHNIPSYYTILWYKQSPEVLGFKLMGFLNYDAENKEPEFENQIKLDGDGQKNGTLMISNLTLTDSAVYFCAAYDTVLR
Sinocyclocheilus grahami V277 trbv LCYQ01069113.1 18662 ACFGKTVFQSPGDLIKNQDKSAVIICTHNIAGYDRILWYKKDGMGFKFMGFLNLIYDNPELEFKNKIKLDGDGQKNGTLIISNLSLTDSAVYFCAAY
Sinocyclocheilus grahami V276 trbv LCYQ01069113.1 19417 SVFSTKVHQSPPVLYKTKGDDAQLECQHRISSNNVILWYKQTPGQGLILLGHLVMRIGQRENDFIGKVELKGDATKSGSLTIQYLSDKDSAVYFCAAS
Sinocyclocheilus grahami V275 trbv LCYQ01069113.1 21774 ACLGKTVLQTPDDILKKQDESAVITCTHKIQSYNQILWYKQTQDSLGLKLMGYLHYNNKNKEPEFENKIKLEGEAQTNGNLTISNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V274 trbv LCYQ01069113.1 23445 DVVQEPKIIWEPKNGSTTLNCKHNKGISYYQMYWYRQRPGETMRLIVFTTTGSKPDFGDDDEKKFEAQKSDAESGSLKVKDLEPDDSGIYFCAVS
Sinocyclocheilus grahami V273 trbv LCYQ01069113.1 24420 STFGNIVYQTPSKSIKDRDESAVFICTHNIASYFQMMWYKQTQGTLGFKLMGHLNGETDQIETEFKNKIFLNGNGRRNGTLTIKNLRVDDSAVYFCAAYDTVL
Sinocyclocheilus grahami V272 trbv LCYQ01069113.1 28395 ACLGKTVLQTPDDILKKQDESAVITCTHSIQSYNRILWYKQSQDVLGFKLMGNLNYKAVSKEPEFQNKIELEGDAQKIGILNIHNLTLTDSAVYFCAAYYTVLR
Sinocyclocheilus grahami V271 trav LCYQ01069113.1 32310 IMGGDDVVQEPKIIWEPKNGSTTLNCKHNKGISYYQMYWYRQRPGETMRLIVFTTTGSKPDFGDVDEKKFEAQKSDAESGSLKVKDLEPDDSGTYFCAVS
Sinocyclocheilus grahami V270 trbv LCYQ01069113.1 33627 DVVQEPKIIWEPKNGSTTLNCKHNKGISYYQMYWYRQRPGETMRLIVFTTTGSKPDFGDDDEKKFEAQKSDAESGSLKVKDLEPDDSGIYFCAVS
Sinocyclocheilus grahami V269 trbv LCYQ01069112.1 2286 ACLGKTVLQTPDDILKKQDESAVITCTHKIQSYNQILWYKQSQDSLGLKLMGNLYVESKTKEPGFENKIKLEGDGRNKGILTISNLTLTDSAVYFCAAY
Sinocyclocheilus grahami V268 trbv LCYQ01069109.1 560 CVVCSPVIQQSPKNLLRTEEEKEAKLSCRHGDSSYQYMYWYQQKRNGGSLELIGMLQYGTDSEEETFKRRFNITGDATKDAFLLISNINAEDSAVYFCAAS
Sinocyclocheilus grahami V267 trbv LCYQ01069109.1 560 CVVCSPVIQQSPKNLLRTEEEKEAKLSCRHGDSSYQYMYWYQQKRNGGSLELIGMLQYGTDSEEETFKRRFNITGDATKDAFLLISNINAEDSAVYFCAAS
Sinocyclocheilus grahami V266 trbv LCYQ01069109.1 1795 CVVCSPVIQQSPKHLLWRVEEKETKLSCHHGDSSYPYLYWYQQKSNSGSLELIGMLRYGEPSPEDKFKTRFNITGHATQDAFLIISSISAEYSAVYFCAAS
Sinocyclocheilus grahami V265 trbv LCYQ01069109.1 2449 LCMMLNVTQTPTKLFLVIGATMNLTCSHHDKSYDKIFWYQQSNGQNLEHLGFLSFKQQLVDRKGFTITGDAEKEAYLLVSSVKAEHNAVYFCAVSR
Sinocyclocheilus grahami V264 trdv LCYQ01069109.1 4448 FSVNSAIKQTPSDLLSKNKVESVTLHCSHTNPNFNVILWYKQPLSGEMQLMGYLYRTNNNSEPVFKEKIELLGNGASNSNLILKKLSSDDNAIYYCAAS
Sinocyclocheilus grahami V263 trdv LCYQ01069109.1 4949 FSVNSAIKQTPSDLLSKNKVESVTLHCSHTNPNFNVILWYKQPLSREMQLMGYLYRTNNNSEPVFKEKIELLGNGASNSNLILKKLSSDDNAIYYCAAS
Sinocyclocheilus grahami V262 trav LCYQ01069109.1 10893 GLICEKVHQSPSDVLCKPKESVNLTCRHKITNYDTILWYQRSNGDSSLKLIGYSRYSSKKKFEASYVDNFSLNGNGEEEVTLKILQARPDQDSAEYFCAAYYAQ
Sinocyclocheilus grahami V261 trbv LCYQ01069109.1 12315 HLLSSVDQTPSEVIVRSGQAYTLSCSHSISSYNTILWYYQHEHGQGMNIIGYSFHSTHNVENADDKKYKLEGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus grahami V260 trbv LCYQ01069109.1 13456 FSYTYTVDQSPPDVIKKPKESAKIQCSHSVPNYNQISWYRQIQDQGFTFMGYLFLKEQNPEKEFTKKIEMSGDGNSNGYLTIEDLSSNDSAVYFCAAC
Sinocyclocheilus grahami V259 ighv LCYQ01069109.1 22395 LVRSQKVDQSPPDLIRKLTESAVLTCSHSDQGFAHILWYKRSDDKGFIFLGYLNNNFPNPEDEFKLKIDLAGDGRSKATLTIKDLTEDNSGVYYCAAR
Sinocyclocheilus grahami V258 trbv LCYQ01069109.1 23541 SSHSNKVDQSPPDVITKQEESAKIQCSHNVPNYNQINWYRQNQGQELTFMGYLLLTSPNPENEFTAKIEMSGNGNSNGAVTIKNLSSSDSAVYFCAAY
Sinocyclocheilus grahami V257 trav LCYQ01069109.1 28714 STLSDKVFQEPRDMIVDINDSPVLQCSHSISSYDRILWYKQAQDGQLVFLGYLLGLIDQLEPEVKNKFKLDGNGNNNGKLAIKSLEFNDTATYFCAASTQ
Sinocyclocheilus grahami V256 trbv LCYQ01069109.1 30055 ISNSQDIHQTPKDLIKDPGQSEDLLCSHSSSYNVMLWYKQKRGESLELLGYLVGSGDTVEDKFKNKISLDGDANKNSVLKLERLSSDDSAVYFCAAS
Sinocyclocheilus grahami V255 trbv LCYQ01069109.1 34375 SILGKSVVQTPSDFLKKEDEFAEIKCSHSIQNYYVTQWYKQSQSIMELQLMGNINVKQKTIEPEFNGKIKLDGDGRNNVTLTIDTLKLNDSAMYFCAAY
Sinocyclocheilus grahami V254 trbv LCYQ01069108.1 3555 CMVCSPVIQQSPKHLLRTVEEKEARLSCHHGDSSYPYLYWYQQKSNIGSLELIGTLTHDSFSPEEKFKSRFNITGHATQDAFLIISSISAEYSAVYFCAAS
Sinocyclocheilus grahami V253 trgv LCYQ01069105.1 3074 KSNGEIRQEPEIFANGSSNVTLTCQHDNSNHNRLFWYKQTKGSVDLSLLVFSIGQNQVEIEAPFKTHKSKYAATRPEIKISTLQINKLETEDSALYYCAT
Sinocyclocheilus grahami V325 ighv LCYQ01116971.1 3811 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYNTGWIRQPAGKALEWIGVIWSDGDLYYKDSLKSKFSISRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus grahami V324 ighv LCYQ01116970.1 123 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYATGWIRQPAGKALEWIGMIGYSGGLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKE
Sinocyclocheilus grahami V323 igkv LCYQ01115643.1 748 QITVTQSPSITAARPEEVARINCKTSSNVYTDSNGLYLSWYLQKPGEVPKLLIYKVNSLQSGTPSRFSGSGSNSDFSLTISGVQTEDAGDYYCKS
Sinocyclocheilus grahami V322 igkv LCYQ01114010.1 5543 SSGQITVTQTPAVQTTELGKTVVMRCTASTPLTGCSTPCLSWYLQKPGEAPKLLIYVTSNRYTGTPSRFSGSGSGSDFSLTISGVQTEDTGDYYCQSYHSGPV
Sinocyclocheilus grahami V321 igkv LCYQ01114010.1 5543 SSGQITVTQTPAVQTTELGKTVVMRCTASTPLTGCSTPCLSWYLQKPGEAPKLLIYVTSNRYTGTPSRFSGSGSGSDFSLTISGVQTEDTGDYYCQSYHSGPV
Sinocyclocheilus grahami V320 igkv LCYQ01113687.1 962 CSAEIILTQSPSVDSVSVGSSVTLNCRSSSDSFTSSLAWYHQKPGQTPKLLFSSVGSKVSGVSERFTDGRSGTNFMLNIRNVRSEDAGDYYCQQHYERP
Sinocyclocheilus grahami V319 igkv LCYQ01112979.1 9050 SSGQITVTQTAVQTTELGKTVVMRCTASTPLTGCSTPCLSWYLQKPGEAPKLLIYVTSNRHTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V318 ighv LCYQ01112615.1 612 IECQTFTQSEAVVKKTGESHKLTCTITGFTFRNIYLSWIRQSPGKGLEWIAYISTASSPIYYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVVYYCARE
Sinocyclocheilus grahami V317 ighv LCYQ01112614.1 844 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYVTAWIRQPAGKALEWIGVIWHNGDLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus grahami V316 ighv LCYQ01112611.1 8746 IECQTFTQSEAVVKKPGESHKLTCTITGFTFRNIYLSWIRQSPGKGLEWIAYISTASSPIYYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVYYCARE
Sinocyclocheilus grahami V315 ighv LCYQ01112611.1 10083 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYNTGWIRQPAGKALEWIGVIWSDGDLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus grahami V314 ighv LCYQ01112610.1 1250 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYVTAWIRQPAGKALEWIGVIWSNGGLYYKDSLKSKFSITRDTSSNTITLQGKNVQAEDTAVYYCAKE
Sinocyclocheilus grahami V313 ighv LCYQ01112608.1 4233 IHCQTFTQSQDVVKRPGESFRLVCTASGYSFSSYWAGVVRQAPGKGLEWVSTISTSNTPYYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVYYCARE
Sinocyclocheilus grahami V312 ighv LCYQ01112606.1 811 IHCQTFTQSQDVVKKPGESFRLVCTASGFTFSSIWAAVVRQAPGKGLEWVATIGTSSSPIYYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVYYCARE
Sinocyclocheilus grahami V311 ighv LCYQ01112606.1 3194 GVFCVELTQPPSLVVKPQESFSISCRISESSYCINWIRQPTGKALELLGYLCNGGGTNIKDSVKNKISFTQDTSKNTVFLQGNHFQTEDTAVYYCARQ
Sinocyclocheilus grahami V310 ighv LCYQ01112605.1 256 VHCIELNQPALMVIKPGESFSIGCKITGYSASGGGCTNWIRHSAGKAMEWIGWFCSSGDTGTSDTMKNKISFTAETSSNTVFLRGQSFQTEDTAVYYCARNTQ
Sinocyclocheilus grahami V309 igkv LCYQ01111818.1 727 SRGITVTQPKVKTVQLGQTATIECSLDVGLTSNDLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSYSGSDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V308 ighv LCYQ01110915.1 713 FCVELTQPPSMVVKPQESFSISCRISVSSYCIHWIRQPTGKALEWLGYLCSSGGTDIKDSVKNKISFTQDTSKNTVFLQGKNFQTEDSAVYYCARESQ
Sinocyclocheilus grahami V307 ighv LCYQ01110914.1 1438 LFCIELDQPPVMVVKPGETFTIACKITGYSASGGGYTNWIRHSSGKPMEWIGWYHTSSSNGVKDSLKNKISFSSESSSNAVILTGKNFNTEDTAVYYCARD
Sinocyclocheilus grahami V306 ighv LCYQ01110914.1 8521 IHCQTFTQSQDVVKKPGESFRLVCTASGYSFSSYWAAVVRQAPSKGLEWVSTIGTSSSPISYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVYYCARE
Sinocyclocheilus grahami V305 ighv LCYQ01110913.1 495 CWCQTLTESESVVIKPGGSHRLTCTFSGFSSDPDLAWIRQTAGGGLEWLAYISGGSSYIHYSQSVQGRFTISRDNSKKQMYLQMNNMKNEDTAVYYCARE
Sinocyclocheilus grahami V304 ighv LCYQ01110913.1 3037 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSGTYMHWIRQAPGKGLEWIIYYYDDNNKNSAQSVQGRFTASSDSSNLYLNMNQLKTEDTAVYYCATG
Sinocyclocheilus grahami V303 igkv LCYQ01109006.1 20774 QITVTQSPSITAAQPEEVARINCKTSSRVHGGDELHWYLQKPGEAPKLLIYETLNRYTGTPSRFGGRGSDTDFTLTISGVQTEDTGDYYCQSYHSGGV
Sinocyclocheilus grahami V302 ighv LCYQ01107934.1 4472 IDSNELTQPESLTARPDATLTINCKVSYSVTSYATGWIRQPAGKALEWIGVIWSDGDLYYKDSLKSKFSISRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus grahami V301 trav LCYQ01107924.1 4177 CQSDDTVDQPHKHVIKFEGESVTLDCKYTTASTSQELFWYIQRTEESPKLVLQRNSYGGGSNGTEFQERFYSEVKPSKSVPLIIQRLCVSDSAVYYCALR
Sinocyclocheilus grahami V300 trav LCYQ01107922.1 4541 DTVDQPNKHVTEAEGGSVTLQCKYTATTTTTPELFWYIQRANYIPKYMLRKNKYNGDQGTEFQERFHSEVSSDSVPLTIQNLRVSDSAVYYCALM
Sinocyclocheilus grahami V299 trav LCYQ01107921.1 2077 KDVITPYSDAAFATETETVKLSCNYTGSVESLHWYRQYAGSPQFLILDYSGYVTHANPPVSGISISHRKEDNSVDLIISSAAVSDSALYYCALK
Sinocyclocheilus grahami V298 trgv LCYQ01107921.1 3450 DIFGNVITPVHNEVYKTEKDIISLSCNYSSAASLYWYRQYPESAPEFLLVILHANGKVLQKSKVVELDPRFSGKLNKEKTHTYLEISSAKVTDAATYYCALE
Sinocyclocheilus grahami V297 trdv LCYQ01107921.1 5522 SEVITPKSDREFALEGDNVTLSCNYSSSARGVHWYRQYAGSPPQFLILEDSGVTTPANPPVPGINIKHRKKESHVDLIISSAKVSDSALYYCALQPTVTG
Sinocyclocheilus grahami V296 trav LCYQ01107921.1 9354 QQRSSHHTVLCSLLLRVNSVTLSCSYTGSVRGLHWYRQYSGSPPKFLVMDYYGTVTEADPPVAGVSINHRKDNSNVDLKISSAAVTDSALYYCALE
Sinocyclocheilus grahami V295 trav LCYQ01107921.1 10590 QQRSSHHTVLCSLLLRVNSVTLSCSYKGSVRGLHWYRQYSGSPPKFLVMDYYGTVTEADPPVAGVSINHRKDNSNVDLKISSAAVTDSALYYCALE
Sinocyclocheilus grahami V294 trav LCYQ01107921.1 12302 VSFGDVITPVETHVSGTEGDFISLSCSYSSARSLFWYRQYPGSAPEFLFLILHATGEVLQKSKTVDQDPRFSAKLNEKKTHVDLEISSAKVTDSVMYYCALE
Sinocyclocheilus grahami V293 trav LCYQ01107921.1 13486 SEVITPKSDREFALEGDNVTLSCNYSAAARGVHWYRQYAGSPPQFLILEDSGVTTPAIPPVPGITINHRKTESHVDLIISSAKVSDSALYYCALQ
Sinocyclocheilus grahami V292 trav LCYQ01107921.1 17741 SEVITPKSDREFALEGDNVTLSCNYSGSARGVHWYRQYAGSPPQFLILEDSGVTTPAIPPVPGITINHRKTESHVDLIISSAKVSDSALYYCALR
Sinocyclocheilus grahami V291 trav LCYQ01107921.1 20120 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEYLLIILQGTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYYCALE
Sinocyclocheilus grahami V290 trav LCYQ01107921.1 23494 AEVITPYSALQFAVEGNSVTLSCSYTGSVRSLHWYRQYSGSPPKFLILESYGTVTKADPPVAGVSIYHNKDNSNMDLKISSAAVTDSALYYCALE
Sinocyclocheilus grahami V342 igkv LCYQ01153855.1 777 SRGITVTQPKVKTVQLGQTATIECSLDVGLTSNDLAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGSYSGSDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus grahami V341 trav LCYQ01153145.1 537 KVDQHTKIQSAFEGDTVTIDCTYQTAYTGPTLFWYQQKDNGNPKYMLNKYSKSGNSEEEFKERFHVNLNKTAVPLTIQDVRVSDSAVYYCALR
Sinocyclocheilus grahami V340 trbv LCYQ01149125.1 448 VTHAETITPEHTEVRVNETENITLSCSYSSAYSLLWYRQHHTSAPQFLMLILQSSGKVIQTSDEHLSGKLNVDKNRVDLEIPFSTVKSSAVYFCALQ
Sinocyclocheilus grahami V339 trav LCYQ01147380.1 569 VSFGNVITPVQTEVFWTEGGNITLSCNYSSAISLQWYRQYHGSAPEFLLIILHRTGKVSQKSKIAELDPRFSVKLNEKKTHVDLEISSAKLTDSALYYCAME
Sinocyclocheilus grahami V338 ighv LCYQ01145308.1 704 ISGDEIRLDQSPAVIKRPGETVKISCKISGFTMTSSYMHWIRQKPGKALEWIGRVNSGSSSSSDYLTYADSMKNHFTLSEDVSQSTQYLEAKSLREEDTAVYYCARQ
Sinocyclocheilus grahami V337 ighv LCYQ01145307.1 572 CKGQTLTESESVVIKPGNNHKLTCTFSGIDVGAAHISWIRQAEGKALEWISHISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTNLQTEDTAVYYCARK
Sinocyclocheilus grahami V336 igkv LCYQ01144012.1 164 SIGQVTVTQTTSVLLAQTGRSVTVTCTFNRDPDCCYNGNHFLSWYLQKPGEAAKLLIYYVNRRQSGTPSRFSGSGTEKHFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V335 igkv LCYQ01144011.1 382 SIGQVTVTQTTSVLLAQTGRSVTVTCTFNRDPDCCNNGNHFLSWYLQKPGEAAKLLIYYVNRRQSGTPSRFSGSGTEKHFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V334 trbv LCYQ01138756.1 426 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTNYDYKYWYRQIKGELVFVGSYIVNSGSVEKDFESGFTVSSTEKKKWTLKVNITDGIDAVYLCAAS
Sinocyclocheilus grahami V333 trav LCYQ01138756.1 2084 MGRCVNVQQNLTPLLFNKNDMAEITCIYDDSGKPNMLWYQQKDTAMALIVLSYGAGSDHIYEDGFKGRFELKRTETLNGALKISDLSQSDSAVYYCAVS
Sinocyclocheilus grahami V332 trdv LCYQ01133230.1 60 ASNGDTITSDKTVEFVAEGSNVTLSCSYSSAWSLLWYRQYPRSAPEFLVLISDSANQAQTSDVDQRFSSKIRKEKQNHVALKISSAALKDSALYYCALR
Sinocyclocheilus grahami V331 trgv LCYQ01132894.1 774 VESLSLKQPQKVLVKQKGKSVSFKCEVTDLGSGNFVHWYHKKDGETFKRLLYITHSGIITTEAKDFVSEKIGNSYGIKIATTKEEHAGVYYCASWES
Sinocyclocheilus grahami V330 trav LCYQ01131590.1 545 KDVITPNSDEAFAAETESVKLSCNYTGSVDSLHWYQQYAGSPPQFLILDYYGATTHANPPVSGISISHRKEENRVDLIISSAAVSDSALYYCALR
Sinocyclocheilus grahami V329 trav LCYQ01128427.1 449 HLICEKVHQSPSDVLCKPKESVSLTCRHTITSYDTILWYQRSHGDSSLKLIGYARYSSIKEFEPSYKDHFNLTGNGEEEVTLKILQARQDQDSAEYFCAASY
Sinocyclocheilus grahami V328 igkv LCYQ01122202.1 2926 SRGQISVTQSPSTTAAQPEETVKISCRTSTDVYLSGSDHCLAWYLQKPGEAPKLLIRYAKKLQTGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus grahami V327 igkv LCYQ01122202.1 11403 QISVTQSPSTTAAQPEETVKISCKTSRDVYSWNRKYYLAWYLQKHGEAPKLLIFDADVRQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYY
Sinocyclocheilus grahami V343 trav LCYQ01154414.1 230 QKKPGDTLTQSCRGSGFSFGCSVMHWIRQAGKPLVWMGLGYSSGSGHKAESFKGRLEITRDDSKSMMYLKRSGLSEEDSAVYFCARESL
Sinocyclocheilus grahami V326 ighv LCYQ01116971.1 2394 IECQTFTQSEAVVKKPGESHKLTCTITGFTFSGLYLNWIRQSPGKGLEWIAYISTASSPIYYSQSVQGRFTVSRDDSSSQLYLQMNSLKTEDTAVYYCARE
Sinocyclocheilus grahami V289 trav LCYQ01107921.1 24679 SEVITPNSDREFALEGDNVTLSCNYSSSARGVHWYRQYAGSPPQFLILEDSGVTIQANPPVPGINIKHRKTESHVDLIISSAKVSDSALYYCALE
Sinocyclocheilus grahami V252 trdv LCYQ01069105.1 8461 TVNCVKFEQTPLLIANLSGEAQINCKHDDSSLAVMLWYQQLRTGMSLDLIGYGYTGSPPNFESRFTDRFTQTRQDTVMGSLTISNLILSDSAIYYCAAS
Sinocyclocheilus grahami V215 trdv LCYQ01021814.1 41103 ATYGNEIKPTKTEEFADEGSSVKLSCSYSSAYTLYWYRQYPGSAPEFIVLILDSAKQAQESYVDSRFTAKVTKDKENHVDLEISSASISDSALYYCALEPTVTG
Sinocyclocheilus grahami V178 trav LCYQ01014723.1 2401 TVGADDVIQEPKILWGQKESSVHMNCTHNKGSTYRQMYWYRQRQGQTMRLIAFTTSYTKPEYGDSELDKFVANKTVAESGSLTVNNLQPNDSATYFCSVSE
Sinocyclocheilus grahami V144 trav LCYQ01004635.1 4706 SSGQDRVEQSPGEITESEGAQVILMCNYTTTSTTPFHFWYKQLPNRSPTFILNQYTTEPDFTKQFSATLNSTSRTFPLMIKDVRVSDSAVYYCDLRPTVTE
Sinocyclocheilus grahami V141 trav LCYQ01004635.1 15414 AVFGNVIKTNKTDVVYEEGSDITLSCSHSPVASDNLHWYRQYERSKPEFLVLTFASAKEAQRSDVDPRFSVVVEKREKIHVDLKIFSAAVSDSALYYCALRPTVTG
Sinocyclocheilus grahami V137 trav LCYQ01004632.1 6752 CDSLESVDQNTKVQTAVEGRSVMINCRYETSDLSPYLFWYQQKINGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSAPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus grahami V103 trdv LCYQ01004628.1 55929 GCFAQTITPLQDRTQVTEGEPVNLSCKYDVSVQNLRWYRQYPGSGLEFLLLVVESSRKTVVYADPPIPRLDGEMSIKDKRVDLTISSAEVTDSALYYCALQ
Sinocyclocheilus grahami V98 trgv LCYQ01004486.1 17496 GLNGQPKHTLSVIIKPSGRTARIQCQEETLQSNALHWYRLKDQAFQRLMYFEAKSNTGKSDPGVPARYAGSVKGNTVTLTISTLELSDAGSYYCALWSGDN
Sinocyclocheilus grahami V65 igkv LCYQ01115646.1 72 VTLTQPKVKTVQQGQTATIECNIDVGIYSSYLYWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGTASTGKDFTLTISGVQTEDTGDYYCQSYHSGGV