WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sinocyclocheilus rhinocerous LAVF00000000.1 (LAVF01) 277 42 0 30 132 48 12 13
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sinocyclocheilus rhinocerous V19 trav LAVF01024031.1 11146 IESQDSVEQKTRVQTVYEGGTVIINCTYQTQLTPTLFWYQQKVNRVPKYMLQRVGKTGVEDEEFKDRFNAHIDTSSKSVPLTIQDVCVSDSAVYYCALK
Sinocyclocheilus rhinocerous V18 trav LAVF01024031.1 3292 CNSQDKVDQHTRIQSAFEGDTVTIDCTYQTAYPSPTLFWYQQKDNGNPKHMLNKFSKSGNSEEEFKGRFHANLNKTAVPLTIQDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus rhinocerous V17 trav LAVF01024030.1 53096 DTVDQPDKHVIEVEGQSVTLQCKYKTDSAQENLFWYIQRANNFPKYILRRNRYGGEDNDAQFQGRFHSEVSSNSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus rhinocerous V16 trav LAVF01024030.1 30049 KVDQPEEYVTAVEGKSVTLDCTYTTNSTQPYLFWYIQRANDLPRYILRRDKYGGADNDAQFQERFHSKLSSDSVPLTIQNLCVSDSAVYYCALR
Sinocyclocheilus rhinocerous V15 trav LAVF01024030.1 20711 CRSKDKVDQPDKHMTEVEGRSVELKCKYKTDSAQDYLFWYIQRANDFPKYILRRSKYGGEDNDAQFQERFHSEVSSDSVPLTIKDARVSDSAVYFCALR
Sinocyclocheilus rhinocerous V14 ighv LAVF01022260.1 5651 CRSQTLVESDAVVIKPGESHKLTCTASGFNFGGSWMAWIRQAAGKGPEWVATLSNGNSYIYYSDKVKGRFTISRDDNKNQLYLQMSSLKTEDTAVYYCAR
Sinocyclocheilus rhinocerous V13 ighv LAVF01022260.1 4281 AHGQSLTSSGSEVKKPGESVTLSCVVSGLSLSWLHWIRQKPGRGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNMVYLEIKSLKTEDTAVYYCARE
Sinocyclocheilus rhinocerous V12 ighv LAVF01022260.1 2246 VSGISLTSSPTQTKAPGQSVRLSCQISGYALTDYGTAWIRQPPGKALEWIGIIWGSGSIDSGDSFKSRFTISRDTGRNELYLDISSLQTEDTAVYYCAKT
Sinocyclocheilus rhinocerous V11 ighv LAVF01022256.1 168 ISGDEIRLDQSPAEIKRPGETVKISCKISGFTMTDYLMHWIRQKPGKALEWIGRVNSGSSSSSSYLIYADSMKNHFTLSEDVSQSTQYLEAKSLREEDTAVYYCAR
Sinocyclocheilus rhinocerous V10 trav LAVF01020813.1 15549 SSGQDRVEQSSEEITASERDQVIVRCNYFTTGINIYLFWYKQLPNKSPTFILNQYTTEPDFKKRFSATLNSTSRTFPLMIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V9 trav LAVF01020813.1 11235 CHGEDSVDQPDKHIAEFEGRSVTLQCKYKTALSQPELFWYIQRANDFPKYMLRRNKYGAKDNDAQFQERFHSEVSSDSVPLTIKNLRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V8 trav LAVF01020813.1 9317 SSGQDSVEQSSREMPANEGAQVILICNYTTSTTLYLFWYKQLPNRSPTFILNQYTTEPDFKKRFSATLDSTSRTFPLTIKNLRVSDSAVYYCALQSTVTK
Sinocyclocheilus rhinocerous V7 trav LAVF01020813.1 6695 SLGQDRVEQSSGEITESEGAQVILMCNYTTTSTTPYHFWYKQLPNRSPTFILNQYTTEPDFTKQFSATLNSTSRTFPLMIKDVRVSDSAVYYCALRPTVTK
Sinocyclocheilus rhinocerous V6 trav LAVF01020813.1 1656 AVSGNVITPDETELFAEEGSNVTLSCSYSSADDLYWYRQYPGSAPIFLELIFDGATNTKKSDVDPRLSVKLTKREQKHVDLIISSAAVSDSALFYCALR
Sinocyclocheilus rhinocerous V5 trav LAVF01020811.1 3208 TSFADTIQPLSSEKYVVEGKNVTLSCNYSTTGTVNSLQWYRQYLGAKPEFLLQVNEYSSKSEPDLRLYSKATKEIKRVDLEIFSAAVSDSALYYCALRPT
Sinocyclocheilus rhinocerous V4 trav LAVF01020810.1 150 SVDQPDKNIIEFEGRSITLQCKYKTALSQPELFWYIQRANNIPKYILWRNKYGGADNDAQFQERFHSEVSSDSVPLTIKNLRVSDSAVYYCALRSTVTK
Sinocyclocheilus rhinocerous V3 igkv LAVF01019031.1 301 TQTPSVLLAQTGQSVTVTCKSSSDPTCCCSGKQCLSWYLQKPGEAPKLLIYGTSTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V2 igkv LAVF01011833.1 1393 CKAQITVTQTPSVKTATPRENVEMSCKFSSSDTACSPPCVSWYLQKPGEAPKLLIYRTSTIQSGAPSRFSGSGSDKDFTLTISGVQTEDAGHYYCLESFRGPV
Sinocyclocheilus rhinocerous V1 ighv LAVF01011713.1 934 IDSYELTQPESLTVRPDATLTINCKVSYSVTSEHTAWIRQPAGKALEWIGLIWSDGSVAYKDSLKSKFSISRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus rhinocerous V0 ighv LAVF01008869.1 12213 VKKPGETLTLSCRGSGFSFDCCNMHWIRQQAGKPLVWMGCVYSDGSGYDYSESFKGRTEITRDNSKSMVYLKLSGLTAEDSAMYYCARESQ
Sinocyclocheilus rhinocerous V55 igkv LAVF01093641.1 1795 QYTVSQSPSITAAQQGQEVRINCKTSSPVHGGSYLHWYLQKPGEAPKLLIYYATSRYTGTPSRFSGIGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V54 ighv LAVF01086830.1 2366 VYSQVVLTQSEQSVTVSPGGSVKLTCACSGFIVSSTNMHWIRQAPGKGLEWIIYYYSDSYKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus rhinocerous V53 igkv LAVF01073560.1 997 QISVTQTPSVAAVQPGETVTLNCQTSRGIGDRSRGCGDCFSWYLQKPGEAPKLLIYDISSRQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V52 igkv LAVF01066151.1 1842 ASRGITVTQPEALTVSEGRDVTIECKTDAGIFGWALAWYQQKPAETPKLIIYLVNNLYDESFSRFSGNGEQDGTDFTLTISGVQTEDAAHYYCQS
Sinocyclocheilus rhinocerous V51 trav LAVF01055744.1 169 VKRPGETLTLSCRGSGFSFDCCIMHWIRHQAGKPLVWMGLGYSSGSGHKAESFKGRLEITRDDSKSMMYLKLSGLTEEDSAVYFCARESQ
Sinocyclocheilus rhinocerous V49 trbv LAVF01024054.1 10290 EKGDMTVHQKPHNLIINYGESPEIKCFHKIPDYDRLLWYKQSQSKELTFMGNLLGDSGYPEKAFQNKIKIRGDANKFHGSLTLINSTSENSAVYFCAA
Sinocyclocheilus rhinocerous V48 trbv LAVF01024054.1 4200 SILGKSVLQTPSDLLKKEDEFVEIKCSHSIQNYYVIQWYKQSQSITVLQLMGHINVEQETTEPEFKGKIKLDGDGRNNGTLTINTLTLNDSAVYFCAAY
Sinocyclocheilus rhinocerous V47 trav LAVF01024054.1 3350 SVCSVQQSPSNLIKSEKDTAELVCEHSIATYTIILWYKQTQTNHGFTLLGYIWNKNYFPEDNFSKKIKLDGDGTKNGSLKILQLEASDSAMYYCAAS
Sinocyclocheilus rhinocerous V46 trbv LAVF01024051.1 16066 ANHAKTVLQSPDDLLKNQNELAVIVCSHNIQNYDRMLWYKQSQDMPGLKLMGYLYADQNIEPEFTSKIKLEGDAKRNGTLTINNLTPQDSAVYFCAAC
Sinocyclocheilus rhinocerous V45 trbv LAVF01024051.1 8513 ACLGKTVLQTPDNLIKNQDESAVIICTHNIPSYYRILWYKQSPDMLGFKLMGYLNYDKENKEPEFEKKIKLDGDGQKNGTLIINNLMLNDSAVYFCAAYYTVLR
Sinocyclocheilus rhinocerous V44 trav LAVF01024051.1 5891 SVVNGSVNQSPSNLIKSERDTAELVCEHNIPSYTMIFWYKQTLSRDLTLLGYTWNKNSIPEDNFNKKIKLDGDGTKNGSLKILQLEASDSAMYYCAAS
Sinocyclocheilus rhinocerous V43 trbv LAVF01024051.1 4026 PVFSTKVHQSPPDLFKMKGDDAQLECQHSISSNNVILWYKQTPGQGLILLGHLMMQIGQREDDFIGKVELKGDATKSGSLTIKYLSDNDSAVYFCAAS
Sinocyclocheilus rhinocerous V42 trbv LAVF01024051.1 2733 DSDVSQVPSVLMAVKGSSAQLNCTHKKDFTFNQMYWYRQRPGQTMTLIVFTSTASNPDFGDSDPNKFPVNKTVPESGSLTVNNVESDDSAVYFCSVS
Sinocyclocheilus rhinocerous V41 trbv LAVF01024051.1 1966 ACLGKSVLQTPNDLLKNQDESAVITCTHKIQSYDRILWYKQSQDSLGLKLMGNLYFNNPNEEPGYKNKIKLEGDGSDKGNLTISNLTLTDSAVYFCAAY
Sinocyclocheilus rhinocerous V40 trbv LAVF01024049.1 9081 ISDVSQVPSVLMAVKGSSVQLNCTHKKDSTFVQMYWYRQRPGQTMTLIVFTSTLSSIHDYGDSDPNKFPIIKTVPESGSLTVNNVESDDSAVYFCSVR
Sinocyclocheilus rhinocerous V39 trav LAVF01024049.1 7303 TEGGDEVIQEPEILWEPKSGSASLSCKHNKGSSYYQMYWYRQRPGETMRLVVFMAGGKPDFGDVDEKKFEAQKSDAESGSLKVKDLEPDDSAIYFCAVS
Sinocyclocheilus rhinocerous V38 trav LAVF01024038.1 2815 KVEQASRQMTANEAAQVTLLCNYSTSFSNAYLFWYKQLPNRSPTFILSEFTVGKGTTEDEFKERFSATLDSTSRTVLMMIEDVRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V37 trav LAVF01024037.1 6248 RVEQPSGEMTANKGDPVTLQCNYSTSATNVYIYWYKQLPNRSPAFMLSVFSFGKGTTEDEFKDRFSAALNSKSTTVPLMIEDVRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V36 trav LAVF01024037.1 3465 SSGQDRVEQSSEEMTASEGAQVIVWCKYITTDTNPYLFWYQKLPNRSPTFILNKLTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKNLCVSDSAVYYCALR
Sinocyclocheilus rhinocerous V35 trav LAVF01024037.1 1346 CHGDELVDQPDKNIAEFEGRSVMLQCKYKTTSSQPELFWYIHRANDFPKYILWRNKFGAKDNDAQFQERFDSEVSSDSVPLTIKNLRVSDSAVYYCALR
Sinocyclocheilus rhinocerous V34 trav LAVF01024035.1 16270 SSGQDRVEQSLRELTASERDQVIVMCNYFTTVTNINLFWYKQLPNRSPTLILGQYTTEPDFKKRFSATLNSTSRTFPLMIKNQHVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V33 trav LAVF01024035.1 14278 SSGQDNVEQSSREMPANEGAQVILMCTYTTSGTPYLFWYKQLPNRSPTFILSQYTTEPDFKKRFSATMNSTSRTFPLMIKNLHVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V32 trav LAVF01024035.1 10659 SSAQDRIEQSSGEMTESEGAQVILMCNYTTTSTTNYLFWYKQLPNRSPTFILNQYTTEFFTTRFSATLDSTSRTFPLMIEDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V31 trav LAVF01024035.1 5873 CKSEDAVHQNKRVQTADEGAAVIINCSYTTTDPSPTLFWYQKQVNGFPKYMLNRVATYGNNEEEFKKRFNASLNTQAKSVPLTIQDVCVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V30 trav LAVF01024033.1 1613 KVEQASRQMTANETAQVTLLCNYSTSFSNAYLYWYKQLPNRSPTFILSEFTVGKGTTEDEFKERFSAALDSTSRTVPLTIQDVCVSDSAVYYCALKPTVTE
Sinocyclocheilus rhinocerous V29 trav LAVF01024032.1 29428 SSGQDRVEQSSGEMTVSEGAQVIVWCKYITTDTDPYLFWYQQLPNRSTTFILNKLTFGEGTTEPDFKKRFSATLNSTSKTVPLMIKDVRVSDSALYYCALRPTVTG
Sinocyclocheilus rhinocerous V28 trav LAVF01024032.1 26733 CHGEERVDQPNQHIAEFEGRSVTLQCKYKTTSPQPELFWYIQKENDFPKYMLRRNKYGGEDNDAQFQERFDSEVSSDSVPLTIQNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V27 trav LAVF01024032.1 22724 AVFGNGIKLNKTDVVYEEGSNVILSCSHSPAATDYIHWYRQYERSKPEFLVLSFASAKKAEMSDVDPRFSVKVEKREQIHVDLKISSAAVSDSALYYCALA
Sinocyclocheilus rhinocerous V26 trav LAVF01024032.1 21201 DSVDQPDKHITEFEGKPVTLQCKYKTSSSQPNHFWYIQRANDFPKYMLRRNKYGGEDNDAQFQERFDSEVSSDSVPLTIQNLRVSDSAVYYCALR
Sinocyclocheilus rhinocerous V25 trav LAVF01024032.1 14039 CDSLDSVEQKTRVQTAVEGETVTINCTYSTTDSFPYLFWHQQEINGYPRYMLKKFPGSGEVDKQFEGRFDANLNTSRTSVPLTIKDVRVSDSAVYYCALKPTVTE
Sinocyclocheilus rhinocerous V24 trav LAVF01024032.1 11308 CNSQDKVDQHTRIQFAFEGDTVTIDCTYQTAYPGPTLFWYQQKDNGNPKYMLNKVSKSGNSEEEFKERFHANLSTTSVPLTIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V23 trav LAVF01024032.1 3793 EQPSREMTANEADQVTLMCNYTTKATNTDAYLFWYKQLSNKSPAFILNKYPFSEGTTEPDFKKRFSATLDTTSSTVPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus rhinocerous V22 trav LAVF01024031.1 18308 SSAQDRIEQTSREMTESEGAQVILMCNYTTASTSPFLFWYKQLPNRSPTFILNQYTTEPDFTKKYSATLNSTPRTFPLMIKNLHVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V21 trav LAVF01024031.1 16561 KVDQHTRIQSAFEGDTVTIDCTYEATYTGPTLFWYQQKDNGNPKHMLNKLSKSGNSEEEFKERFHANLSKTSVPLTIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V20 trav LAVF01024031.1 15473 NSFGDTIQPWFPEKHDSDGENVTLSCNYSLTSGTSVTIQWYRQYPGAKPEFLLFVTEYSSKSVPELRLFSEAKKEIKRVDLVIFSAAVSDSALYYCALQ
Sinocyclocheilus rhinocerous V92 trav LAVF01152479.1 1629 ESLSDQVHQNPPHLITKVEKTVQISCSHTIKDYNMILWYQQLKGNSALNLIGYVYYKDPTTENQYKNQFSIGGNGEESSTLNVTLEREHVGSTAVYYCAASK
Sinocyclocheilus rhinocerous V91 trbv LAVF01144298.1 2534 CVVCSPVIQQSPKHLLRTVEEKEAKVFCRHGDSSYQYMYWYQQKRNGSSLELIGMLNYGTDSEEEKFKPRFNITGDATKDAFLLISNINTEDSAVYFCAAS
Sinocyclocheilus rhinocerous V90 trbv LAVF01144298.1 1141 CVVCSPVIQQSPRHLLRTVEEKEAKLSCHHRDSSYPYLYWYQQKSNMGSLELIGMLTHDSFSPEEKFKSRFNITGHATQDAFLIISSISAEYSAVYFCAAS
Sinocyclocheilus rhinocerous V89 trgv LAVF01140367.1 3770 VESLSLKQPQKVLVKQKGKSVSFKCEVTGLGSSNFVHWYHKKDGETFKRLLYITQSGTITTEAKDFVSEKIGDSYGIKIATTKEEHAGMYYCASWEG
Sinocyclocheilus rhinocerous V88 trbv LAVF01140363.1 30327 AVLGVSLDQGPKVLVKGVGKTIYLPCKATGLGTSDYIHWYQVKEGEAPSRLLYITQGGSVARDTNNPESTDFTVDKTKLYDLKLSNTQKSHAAVYFCAYW
Sinocyclocheilus rhinocerous V87 ighv LAVF01138018.1 2142 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTNMHWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus rhinocerous V86 trgv LAVF01137590.1 10988 LTAYNLSQEKSKSVKLGDKVSILCTAEDDEYYISWYQQKAGAPPQFLFFNDIRASDLPDRFTFTDSGNQDYLTIDGVRAEDEAVYYCACIGCAG
Sinocyclocheilus rhinocerous V85 ighv LAVF01136199.1 101 VYSIELTQPDSKELKPGQPLSLSCKVSGYSLSSCGYCTNWIRQASGGLEWIGRVCCSGDTHYSEKLKNKFSISRDTSSSTVTITGQNMQTEDTAVYYCARESQ
Sinocyclocheilus rhinocerous V84 ighv LAVF01121566.1 2093 GVFCVELDQPPSLVVKPQESFSISCRISVSSYCIHWIHQPTGKALEWLGYLCSDGGTDIKDSVKNKISFTQDTSKNTVFLQGNNFQTEDSAVYYCARQSQ
Sinocyclocheilus rhinocerous V83 igkv LAVF01118910.1 138 FSGVTVTQPKVKTVQLGQTATIECSLDVGLTSNDLVWYQQKPGEAPKLLIYVINSLQSGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCLS
Sinocyclocheilus rhinocerous V82 ighv LAVF01113061.1 362 VKKPGETLTLSCRGSGFSFGCCSMHWIRQQAGKPLVWLGRVHSGGSGNDYSESFKGRTEITRDNSKSMVYLKLSGLTAEDSAVYYCARDSQ
Sinocyclocheilus rhinocerous V81 ighv LAVF01113057.1 2545 QNLESISSVAEVKPGETLSLSCRGSGFTFGSYHMQWVRQQPGKALVWMGRVWNNGQGQDYAKSFEGRIEITRDNSKNIVYLKLSGLTEEDSAVYYCARQ
Sinocyclocheilus rhinocerous V80 ighv LAVF01108770.1 839 TDSYELTQPESLTVRPDATLTINCNVSYSVTSERTAWIRQPAGKALEWIGLIWSDGDLDYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAKR
Sinocyclocheilus rhinocerous V79 igkv LAVF01108766.1 47627 TFAQSIRPLQNDIHITEKQPVMLSCKYEGSANSLHWYRQYPGSKPEFVLLVMEASTKHVTYADPRIPGMDGKMSMKDKQVDLEISSAEVSDSALYYCTLQ
Sinocyclocheilus rhinocerous V78 trav LAVF01108766.1 36025 QHTVRQSPSSSSAYTGETATLNCEYNTTDTMPALLWYRQTKNLSPEYILVRHNFGNGSNSKDFPNKRFQSQLDSAARRISLTIQNLHLSDSSLYFCALR
Sinocyclocheilus rhinocerous V77 trbv LAVF01108766.1 31557 VTPAETITPEHTEVRVNETENITLSCSYSSAYSLLWYRQHHTSAPQFLMLILQSSGKVIQTSDERLSGKQNVDKNRVDLEIPFSTVKDSAVYFCALQ
Sinocyclocheilus rhinocerous V76 trav LAVF01108766.1 8859 KDVITPYSDAAFATETETVKLSCNYTGSVESLHWYRQYAGSPPQFLILDSYGSITQANPPVSGISISPRKEDNSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus rhinocerous V75 trav LAVF01108766.1 3963 KDVITTYSDAVFATETETVKLSCNYTGSVESLHWYRQYAGLTPQFLILDHSGYVIQANPPVSGISISHRKEDNSVDLIISSAAVSDSALYYCALK
Sinocyclocheilus rhinocerous V74 trbv LAVF01108764.1 1057 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILHRTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYFCALE
Sinocyclocheilus rhinocerous V72 trav LAVF01108762.1 10800 CFGEDTVNQPNENITGAEGQQVTINCEFKTLQLTPYLYWYIQRSNGPEYVLMRYKFGSSNSSEFEERFDARLDSNSVPLTIKNLRVSDSAVYYCALQPTVTK
Sinocyclocheilus rhinocerous V71 trav LAVF01108762.1 9014 EDSVTQPTKVQTATAGETVTIDCTYKTNAFPTLYWYQYKANQAPKYMLKRYAGSSNEDEDFKERFNANLQTSSTSVPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V70 trav LAVF01108762.1 7830 CDSLESVDQNTRVQTTVEGRSVTINCRYETSDPSPYLFWYQQKMNGIPKYMMMIFAKTVQNEKDFEERFNANHDKTSKSAPLMIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V69 trav LAVF01108762.1 1062 EDTVDQPNKHVTEAEGGSVTFQCKYTATTTTTPELFWYIQRANYIPKYILRKNKYNGDQGTEFQERFHSEVSSDSVPLTIQNLRVSDSAVYYCALK
Sinocyclocheilus rhinocerous V68 trav LAVF01108761.1 613 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDPSPYLFWYQQKTNGIPKYLMIIIATNVQNDKDFEERFNANHDKTSKSVPLMIQDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V67 igkv LAVF01104525.1 555 TQTPSVLLAQTGQSVTVNCTFNSDADCCNNGNHFLNWYLKKPGEATKFLIYATNTLQPGVPSRFSGSRSSGRDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V66 igkv LAVF01104505.1 2162 IWGQMTVTQNPEIKSIKRGETVTISCKTSQTLTSCGTCVSWYLQKPGEAPKLLIYYINTLQSGTPSRFSGSGTNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V65 trdv LAVF01099065.1 38019 YTLAQSITPQENKSLATVGQKVTLSCKYEGAITNLHWYRQYPRSKPEFLAWIYPQGATSNPLPPRIIPKVDKNRVSLEISDAEVTDSALYYCALT
Sinocyclocheilus rhinocerous V64 trav LAVF01099065.1 36877 CDSLDSVEQKTRVQTAFEGETVTINCTYSTTDSFPYLFWYQKEIKGYPRYMLKKFPGSGEVDKQFENLNTSTTSVPLMIKNLRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V63 trav LAVF01099065.1 14370 AVFGNVIKPNKTNVFAEEGSSITLSCNFSDSVGTDYLHWYRQYGRSKPVFLVLTYDTAKEAQRSVVDPRFTVNTTKREQNHVDLKISSAAVSDSALYYCALV
Sinocyclocheilus rhinocerous V62 trav LAVF01099065.1 12169 TSFADTIQPLSSEKYVVEGKNVTLSCNYSTTGNVDSLQWYRQYLGAKPEFLLLVNEYSSKSEPDLRLYSKATKEINRVDLEIFSAVVSDSALYYCALQPT
Sinocyclocheilus rhinocerous V61 trav LAVF01099065.1 3650 CKSQDKVDQHTRIQSGFEGATVTIDCTYQTAFTNPTLFWYQQKVSGIPKYMLNKYSKSGNSEEEFKERFHANLSKTSVPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V60 trav LAVF01099061.1 5914 EETVSQPERHQTELEGKSVTLNCKYSSASAAPDLFWYIQRANDIPKYILRRDNFGTGETGTEFQERFHSKLSSDSVPLTVQDVHVSDSAVYYCALR
Sinocyclocheilus rhinocerous V59 trav LAVF01099061.1 4427 EETVSQPERHQTELEGKSVTLNCKYSSASAAPDLFWYIQRANDIPKYILRRDNFGTGETGTEFQERFHSKLSSDSVPLTVQDVHVSDSAVYYCALR
Sinocyclocheilus rhinocerous V58 trav LAVF01099061.1 3532 QDNVIQSKPVMTAYEDGTATLDCTYKATSTQYPNLLWYQQKTNRSPKYMLIRLSGSSSNNEEFKERFNADLNTSSKSVPLTIKDVRVSDSAVYYCALQPTATE
Sinocyclocheilus rhinocerous V57 igkv LAVF01093647.1 12559 SRGVTLTQPEVKTVQQGQKATIECSMDVALTYDDLAWYQQKPGEAPKLLIHDINSLYSGTPSRFSGSGTAYTGKDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V129 trbv LAVF01018762.1 5093 DVVQEPKILWEPKNGSTTLNCKHNKGSLYYQMYWYRQRPGETMRLIVFTMTGSKPDFGDVDEKKFEAQKSDAESGSLKLKDLEPDDSGIYFCAVS
Sinocyclocheilus rhinocerous V128 trbv LAVF01018761.1 1235 VCLGKTVLQTPDDILKKQNESAVITCTHSIQSYNQILWYKQSQDVLGFKLMANLNYKAVTKEPEFQNKIELEGDAQKIGILNIHNLTLTDSAVYFCAAY
Sinocyclocheilus rhinocerous V127 trbv LAVF01018759.1 8455 VCLGKTVLQMPDNLIKNQYESAVIICTHNIPSYYRILWYKQSPEVLGFKLMGFLNYDAENKEPEFENKIKLDGDGQKNGTLIISNLSLTDSAVYFCAAY
Sinocyclocheilus rhinocerous V126 trav LAVF01018759.1 10629 SVVNGSVNQSPSNLIKSERNTADLVCEHNIPSYNMILWYKQTLGHDFTLLGYTWNTNSYPEDNFDKKIKLDGDGTKNGSLKILHLEASDSAMYYCAAS
Sinocyclocheilus rhinocerous V125 trbv LAVF01018759.1 11776 ACFGKTVFQSPGDLVKNQDESAVIICTHNIAGYDRILWYKKDGMGFKFMGFLNLIYDNPELEFKNKIKLDGDGQKNGTLIISNLSLTDSAVYFCAAY
Sinocyclocheilus rhinocerous V124 trbv LAVF01018759.1 12509 SVFSTKVHQSPPVLYKTKGDDAQLECQHSISSNNVILWYKQTPGQGLILLEHLMMRIGQREDDFIGKIELKGDATKSGSLTIQYLSDKDSAVYFCAAS
Sinocyclocheilus rhinocerous V123 trgv LAVF01002594.1 13981 SKSNRIHILQQPTSSGGNVTLLCTIQNEQESCGGDHKVYWFRHGLEKSHSGIIYTQGSCKNSSMAVSPTKSCVYSLSLRNIKPSDAGTYYCAV
Sinocyclocheilus rhinocerous V122 igkv LAVF01002046.1 8271 SRGQISVTQSPSTTAAQPEETVKINCRTSRYVFRFSRTYYFSWYLQKPGEAPKLLIYATNRRQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V121 trav LAVF01297880.1 267 SSGQDRVEQSFREITTSERDQVIVRCNYTTTDTNPYLFWYQQLPNRSPTFILNKFTFGEGNTEPDFKKRFSATLDSTSRTVPLMIKDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V120 igkv LAVF01187046.1 33833 TQNPSKKTVESGQSVTITCQTSLDVGNWCDSKYCLSWYLKKPGDAPKLLIYHGHIRYSSIPSIFSGNGSDKNFQLVINGAQNEDSGEYYCFSDLGGHR
Sinocyclocheilus rhinocerous V119 igkv LAVF01187046.1 31397 TVTQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHAPKLLIYHIRERHSNIPSRFSGNGAHTDFNLTISGVQKEDEAQYYCMT
Sinocyclocheilus rhinocerous V118 igkv LAVF01173612.1 494 IWGQVTVTQNPEIKSIKQGETVTIRCKTSQPISGCSDCVSWYQQKPGEAPKLLIYYINTLQSGTPSRFSGTGSNSDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V117 ighv LAVF01160933.1 1982 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYGTGWIRQPAGKALEWIGVIWSSGSLYYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCARD
Sinocyclocheilus rhinocerous V116 ighv LAVF01160933.1 199 WTQSPLKVVKKPGETLTLSCRGSGFSFDCCSMHWIRHQAGKPLVWLGRVHSHGNSHDFSDSFSRRIEITRDNSKSMVYLKLSGLTAEDSAVYYCARD
Sinocyclocheilus rhinocerous V115 igkv LAVF01159212.1 189 VTLTQPEVETVQQGQTATIECHIDVGIYSNGLAWYQKKPGEAPKRLIYYINTLQSGTPSRFSGSGTVNTGRDFTLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V113 ighv LAVF01155239.1 222 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYTTAWIRQPAGKALEWIGLIDSAGNLAYKDSLRNKFSITRDTSSNTITLQGKNMRAEDTAVYYCARA
Sinocyclocheilus rhinocerous V112 trav LAVF01155236.1 9817 EVKPGETLSLSCRGSGFTFGSYHMHCVRQQPGKALVWMGRVWSNGQGQDHAKSFEGRIEITRDNSKNMVYLKLSGLTEEDSAVYFCARQAQ
Sinocyclocheilus rhinocerous V111 ighv LAVF01155235.1 6126 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTYMHWIRQAPGKGLEWIIYYYDDNNKNSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCATE
Sinocyclocheilus rhinocerous V110 ighv LAVF01155233.1 1761 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTNMHWIRQAPGKGLEWIIYYYDDSYKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCARE
Sinocyclocheilus rhinocerous V109 ighv LAVF01155230.1 4608 HCVELTQTDSLVLSPGQVLTLSCKISGYSVTDSSYWTHWIQQPAGKALEWVGEIGSGGGTYYSDKLKSRFQVTRESSSNTVTLQGQNMQTEDTAVYYCARER
Sinocyclocheilus rhinocerous V108 trav LAVF01152488.1 2132 QTSVHIVLQSTRFISALPGDKVTFDCSMAAGVSVSSYTMHWYRQDHYGQPIQFIIKEYDKTTQNYEAILNTKDNMFSLIVSNLTAEDSSTYYCAA
Sinocyclocheilus rhinocerous V107 trdv LAVF01152488.1 506 TANCVKFEQTPLLIANQSSEAQISCRHDDSSLLVMLWYRQQRTGMSLDLIGYSYSGSSPNNEPEFTDRFKQSRQDTVRGSLTISDLVLSDSAIYYCAAS
Sinocyclocheilus rhinocerous V106 trav LAVF01152487.1 290 KAKCVHVQQKVTSLFANQNDTTEMKCSHDDSSMLNMLWYQQKDTAMVLSGYTYGIGEPSYEDGFKGRFELKRKDTLHGALEIPDLSLSDSAVYYCADS
Sinocyclocheilus rhinocerous V105 trbv LAVF01152486.1 3121 FSDGVLITQWPNYISSLPGSSVKMHCYQNDTDYDYKYWYRQIKGEGPVLIGSYNFNSPTNEKGFETGFTMSGTETKKWTLTVDVKEGIDAVYLCAASF
Sinocyclocheilus rhinocerous V104 trbv LAVF01152485.1 9724 VFSDGVLITQWPKHISSLPGSSVEMHCYQNDTDYDYKYWYRQIKGELVLVGSYLVASSTNEKGFETNFTVSSTETKKWTLKVDVKEGIDAVYLCAAS
Sinocyclocheilus rhinocerous V103 trbv LAVF01152485.1 7146 FSDGVLITQWPKYISSLTGSSVEMHCYQNDTNYDYKYWYRQIKGELVLVGSYIVNSGSIEKDFESGFTVSSTEKKKWTLKVNITDGIDAVYLCAAS
Sinocyclocheilus rhinocerous V102 trbv LAVF01152484.1 18720 FSDGVLITQWPKYISSLPGSSVEMHCYQNDTDYDYKYWYRQIHGEGPVLIASIIGTAESIEKGFDTGFKVSSTETKKWTLKVNITDGINAVYLCAAS
Sinocyclocheilus rhinocerous V101 trav LAVF01152484.1 17248 CVHFDQPLSIFIKQDIEAEISCRHDDNDLDVMLWYQQLHNSKSLALIGYSYGKADPAYEPEFQKRFKMTRDDTVTGALKISNLSLSDSAVYYCAAK
Sinocyclocheilus rhinocerous V100 trbv LAVF01152484.1 14427 CVVCSPVIQQSPKHLLQTVEEKEAKLFCRHGDNDYQYMYWYQQKSNGGSLELIGMLSYATASQEDKFKPRFNITGHAKEDAFLFISSISVEDSAIYFCAAS
Sinocyclocheilus rhinocerous V99 trbv LAVF01152484.1 13126 CVVCSPVIQQSPKHLLRTEEEKEANMSCHHGDSSYTYLYWYQQKNEGGSLELIGMLRFGEPSLEDKFKPRFVLSGHATKDAFLLISSISAEDSAVYFCAAS
Sinocyclocheilus rhinocerous V98 trav LAVF01152484.1 12176 CVVCSPVIQQSPKHLQTVEEKEAKLFCRHGDNNYQYMYWYQQKSNGGSLELIGMLNYGTASQEDKFKPRFNITGHAKEDAFLLISSISVEDSAIYFCAAS
Sinocyclocheilus rhinocerous V97 trbv LAVF01152484.1 9563 CVVCSPVIQQSPKHLLQTVEEKEANISCHHGDSSYLYLFWYQQKNEGGSLELIGMLTGDSGTPEEKFKPRFALSGHATKDAFLLISSISAEDSAVYFCATS
Sinocyclocheilus rhinocerous V96 trbv LAVF01152484.1 8933 LCLMLNVTQTPRNLFLVTGATMNITCSHHDKTYDKIYWYQQSNGQNLEHLGFLSFKQDLVDKKGFTITGDAEKEAYLLVSSVKAEHSAVYFCAVSA
Sinocyclocheilus rhinocerous V95 trav LAVF01152484.1 3559 HLICEKVHQSPSDVLCKPKESVSLTCRHTITSYDTILWYQRSHGDSSLKLIGYARYSSIKEFEPSYKDHFNLTGNGEEEVTLKILQARPDQDSAEYFCAASYAQ
Sinocyclocheilus rhinocerous V94 trbv LAVF01152484.1 2166 HLFSSVVQTPAEVIVRSAQTFTLSCSHSISTYNTILWYYQHEHGQGMHIIGFSFHGAHNVEKDDKKYNLVGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus rhinocerous V166 trav LAVF01138760.1 3047 KVRCVNVQQNLTPILVNKNKIAEIKCSHDDSNMPYMQWYQQKDMAMVLIVFSYGATGDPIFEDGFKDRFKLERKDTLNGVLRISDLSLSDSAVYYCAVS
Sinocyclocheilus rhinocerous V165 trav LAVF01138760.1 5261 MVRCVNVQQNMTPLLFNKNKTAELMCRYDDSGKPNMLWYQQKNTAMALIVLSYSAEGVPTYEDGFKKRFKLERKDTLNGVLRISDLSLSDSAVYYCAVS
Sinocyclocheilus rhinocerous V164 trdv LAVF01138759.1 580 TANCVKFEQTPLLIANRSGEAQINCKHDDSSLVVMLWYQQLRTGMSLDLIGYGYTGSPPNYESRFTDRFTQTRQDTVTGSLTISNLILSDSAIYYCAAS
Sinocyclocheilus rhinocerous V163 ighv LAVF01136345.1 818 CWCQTLTESESVVIKPGGSHRLTCTASGFSGDPYLAWIRQTAGGGLEWLAYISSGGTIYYSQSVQGHFTISRENSKKQMYLQMNNMKNEDTAVYYCARQ
Sinocyclocheilus rhinocerous V162 trgv LAVF01126305.1 5435 CLNGQITHPDPVIIKASGRAARIQCKVDSSTLQSSVLHWYRAPPKGALQRLMYFEAGSSKAKKDPDTPRRFSGSVNGDLVALTISKLELSDAGSYYCALWSGD
Sinocyclocheilus rhinocerous V161 trbv LAVF01126304.1 2165 VFGVTLEQGQQILVKAVGKTSYLPCKVTGLQSWHYIHWYQKREGEAPSRLLYISAVGSFIHDTSNPQANYFTVDRTQLYNLKLSNTKPIHAAVYFCA
Sinocyclocheilus rhinocerous V160 trgv LAVF01126302.1 17869 VESLSLKQPQKVLVKQKGKSVSFKCEVTDLGSSNYVHWYHKKDGETFKRLLYISHSGIATNEAKDIVSEKMGNSYGIKLKETKEEHAGMYYCACWDG
Sinocyclocheilus rhinocerous V159 trbv LAVF01126302.1 21111 AVLGVSLDQGQKALIKTEGKTVYLPCKVTGQSYIHWYQMKDGEAPSRLLYISQRGDVTRDTNNPQANDFTVDKTKLYDLKLSDTQKSHAAVYFCAYWDSS
Sinocyclocheilus rhinocerous V158 trbv LAVF01126302.1 21598 AVLGVSLDQGQKALIKTEGKTVYLPCKVTGQSYIHWYQMKDGEAPSRLLYISQRGDVTRDTNNPQANDFAVDKTKLYDLKLSDTQKSHAAVYFCAYWDSS
Sinocyclocheilus rhinocerous V157 ighv LAVF01119418.1 1590 SRGVTLTQPKVKTVQQGQTATIECHIDVGIYSNALAWYQQKPGEAPKLLIYYINTLQSGTPSRFSGSGTILETISGVQTEDTGEYYCQS
Sinocyclocheilus rhinocerous V155 trav LAVF01104570.1 238 KDSATGFTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCMERSENGSSTQSWVYSLSQTELRPSDAGIYYCAV
Sinocyclocheilus rhinocerous V154 ighv LAVF01085236.1 1280 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYGTGWIRQPAGKALEWIGLIDSAGNLAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus rhinocerous V153 ighv LAVF01085235.1 5718 GVFCAELTQPPSMVVKPQESFSISCRISVSSYCIYWIRQPTGKALEWLGYLCSGGGTDIKDSVKNKISFTQDTSKNTVFLQGNNFQTEDTAVYYCARQ
Sinocyclocheilus rhinocerous V152 ighv LAVF01085234.1 3356 IDCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSYNMHWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCAR
Sinocyclocheilus rhinocerous V151 ighv LAVF01085234.1 7086 VNCIELNQPALMVKKPGESFSIGCKITGYSASGGSCTNWIRHSAGKAMEWIGWFCSSGNTGTSDTMKNKISFTAETSSNTVFLRGQSFQTEDTAVYYCARNTQ
Sinocyclocheilus rhinocerous V150 ighv LAVF01077188.1 30 VSGQSLTSSDSVVKKPGESVTLSCTVSGFSVSGYWMGWVRQKPGKGLEWIGQRHGSTVYYAQSLQGQFSITTDTSKNMLYLELKSLKTEDTAVYYCARESQ
Sinocyclocheilus rhinocerous V149 trav LAVF01074532.1 143 AEVITPYSALQFAVEGDSVTLSCSYTGSVRGLHWYRQYSGSPPKFLIMDYYGAVTKADPPVVGVSIYHRKDNSSVDLKISSAAVTDSALYYCALE
Sinocyclocheilus rhinocerous V148 trgv LAVF01071203.1 6544 DGNVKMQQKISLTKSVEKTVVIDCNFPSDCIGYIHWYQLKEGQTLRRILYSSISGGATNNDAGFESFKIDRKPSNLALKIPELKKEHSAVYYCACWVSG
Sinocyclocheilus rhinocerous V147 trgv LAVF01071203.1 9335 DGAVELQQEISLTKAEEKLAIIDCHLHISCWDYIHWYQQKDRETLKRILYADINDGSAKNNVGFESIKSEKKASNHFVLKITKLKKEHSAMYYCACWVWSSV
Sinocyclocheilus rhinocerous V146 trav LAVF01064280.1 1886 SVGSVQQSPSNLIKSERNTADLVCEHNIPSYNMILWYKQTLGHDFTLLGYTWNTNSYPEDNFDKKIKLDGDGTKNGSLKILHLEASDSAMYYCAAS
Sinocyclocheilus rhinocerous V145 trbv LAVF01064279.1 5623 ACLGKTVLQTPDDLLKKQDESAVITCTHKIQSYNQILWYKQSQDSLGLKLIGNLYVESKNKEPGFENKINLEGDGRNKGILTISNLTLTDSAVYFCAAY
Sinocyclocheilus rhinocerous V144 igkv LAVF01060975.1 11562 SHEEVQSPESLSVKAGDSVSISCTGTSGVGNDMSWYLQKPGEAPKLLIYTASRLESGVPDRFSGSGSEPDFTLNIRGVQLEDAGVYYCMGVYEGPV
Sinocyclocheilus rhinocerous V143 igkv LAVF01058189.1 3620 SRGQISVTQSPSTTAAQPEETVKINCRTSRDVHRRSDGDEELAWYLQKPGEAPKLLIYLAKKLYTGTPSRFSGSGSKTDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V142 trav LAVF01055749.1 613 CDSLDSVEQNTTVQTAVEGAAVTISCQYETTDISPDLFWYQQKVNGFPEYMLNRFGTNDKHFKERFNGDLNTISKSFPLTIQDVRVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V141 trav LAVF01055748.1 228 CQSDDTVDQPHKHVIKFEGESVTLDCKYTTASTSQELFWYIQRTEESPKLVLQRNSYGGGSNGTEFQERFYSEVKPSKSVPLIIQRLCVSDSAVYYCALR
Sinocyclocheilus rhinocerous V140 ighv LAVF01041883.1 165 IKCQSMESTESTVQKKPGETLTLSCIGSGFSFGCCSMHWIRHQAGKPLVRLGRVHSHGNSHDFSDSFSRRIEITRDNSKSMVYLKLSGLTAEDSAVYYCARD
Sinocyclocheilus rhinocerous V139 trav LAVF01041755.1 710 SDGIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCMERSENGFSTQSCVYSLSQTELRPSDAGIYYCAVATCGK
Sinocyclocheilus rhinocerous V138 igkv LAVF01041649.1 10762 CSAEIILTQSPSVDSVSVGSSVTLNCRSSSDSFTQSLAWYHQRPGQTPKLLFSSVGSKVSGVSERFTDGRSGTNFMLNIRNVRSEDAGDYYCQQHYEL
Sinocyclocheilus rhinocerous V137 ighv LAVF01039121.1 2934 IDSYELTQPESLTVRPDATLTINCKVSYSVTSYGTGWIRQPAGKALEWIGLIDSAGNLAYKDSLKSKFSISRDTSSNTITLQGKNMQAEDTAVYYCARY
Sinocyclocheilus rhinocerous V136 ighv LAVF01039121.1 5203 VHCVELTQTDSLVLSPGQVLTLSCKISGYSVTDSSYWTHWIQQPAGKALEWVGEIGSGGGTYYSDKLKSRFQIARDISSNTVTLRGQNMQTEDTAVYYCARER
Sinocyclocheilus rhinocerous V135 igkv LAVF01037841.1 66 QITVTQSPSITAAQPGQEVRINCKTSSSVYNGDYLAWYLQKLGEAPKLLIYRATSRNTGTPSRFSGSGSNTDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V134 trdv LAVF01036185.1 582 SEVITPKSNREFALEGDNVTLSCNYSGSARDIHWYRQYAGSPPQFLILEDSGVTTPANPPVPGITIKHRKKESHVDLIISSAKVSDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V133 ighv LAVF01033484.1 170 ISGDEIRLDQSPAEIKRPGETVKISCKISGFTMTDYLMHWIRQKPGKALEWIGRVNSGSSSSSSYLIYADSMKNHFTLSEDVSQSTQYLEAKSLREEDTAVYYCARQ
Sinocyclocheilus rhinocerous V132 igkv LAVF01023178.1 4613 SRGVTLTQPKVKTVQQGQTATIECNIDVGIYGSYLAWYQQKPGEAPKLLIYYINSLQSGTPSRFSGSGTAGTGKDFSLTISGVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V131 igkv LAVF01020995.1 1166 QITVTQSPSITAAQGREVRINCKTSSRVYDGDELHWYLQKPGEAPKLLIYLINRLQSGTPSRFSGSGSDSDFTLTISEVQTEDTGDYYCQS
Sinocyclocheilus rhinocerous V203 trav LAVF01153025.1 10513 ESNGNVIRPNQPSVVLTEGSSTTLSCTYDGSAYSLHWYRQKPGSKPEFLLLIVRSTKTVVPASPPHPQMSIRLHDNKSVDLEISSAAVSDSAMYYCALQ
Sinocyclocheilus rhinocerous V202 trav LAVF01153025.1 11472 TAGEDVLKPVFTEKHVLAGKDVTLICNYTGNLQNLQWYRQYPGSKPEHLILYLETIPKSEPALRLTAVAEKAAQSMNLTISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V201 trav LAVF01153025.1 12937 NADAEVITPFLTEQYVLAGKDITLSCNYSGYVQNLQWYRQYPRYKPENIIFHTESNGHSEPKLRLSSVANKGIKLMNLSISTTKLEDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V200 trav LAVF01153025.1 16130 SLGDLITSHDSEKQAQDGNSVTLYCNYTGAVYNLLWYRQYHRSKPELLLSMTESGDPVKADPSAHWLSAKVDKHRKLMELEISPAKVSDSVQYYCALV
Sinocyclocheilus rhinocerous V199 trav LAVF01153025.1 17568 NADANTINPLVPEKHITAGDNVTLSCEYSGIVNTLQWYQQYPGSRIEFLIFATELSGQSEPALRLSSTADKGNKHMHLNIFLTEMEDSAIYYCALVPTVTG
Sinocyclocheilus rhinocerous V198 trav LAVF01153025.1 19443 ADTIKPLSLNENRHVGDSVTLSCSYKDYTGNIQNLQWYRQYPRSKPEFLLYIFQHGAMSDDRPPRFTAAVNQDNKQVDLKISSVVETDSAIYYCALR
Sinocyclocheilus rhinocerous V197 trav LAVF01153025.1 21322 SLGDLITSHGSEKQAQDGNSVTLYCNYTGAVYNLLWYRQYHRSKPELLLSMTESGDPVKADPSAHWLSAKVDKHRKLMELEISPAKVSDSAQYYCALV
Sinocyclocheilus rhinocerous V196 trav LAVF01153025.1 22425 YSFADTIQPLSSEKHILRGDNVTLSCNYSGLVYDLQWYRNTGGSRPEFLILVNENSEASEPSLRLSAKDSKKQVNLTISSAKVTDSAVYYCALR
Sinocyclocheilus rhinocerous V195 trav LAVF01153025.1 23236 ADTIKPLSLNENRHVGDSVTLSCSYKDYTGNIKNLQWYRQYPRSKPEFLLYIFPQGLMSEDRPPRFTAAVNQDNKQVDLKISSAVETDSAIYYCALV
Sinocyclocheilus rhinocerous V193 trav LAVF01153025.1 26156 NSFADTIQPLSSERHIFRGENVTLSCNYSGLVYNLQWYRQYVGSRPDFLILVNENSEASEPSLRLLAKDSKEKKQVNLTISSAEVTDSAVYYCALR
Sinocyclocheilus rhinocerous V192 trav LAVF01153025.1 26931 SADAYTIESLLPEQHVSVGQSAVISCKYSGIGPSFQWYRQYPGSRPEYLIFNAETAVSSEPTLRLKAQAKKEITEVELEISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V191 trgv LAVF01153025.1 28234 NSFANTIQPLYSEKHVVRGKNVILSCNYSGDVNNLQWYRQYPGSQPEYLILITEYSEPDLSLRLSAKASKDIKQVNLTISSAEETDSALYYCALE
Sinocyclocheilus rhinocerous V190 trav LAVF01153024.1 1430 NVDAELITSFFTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIYYTESSSQSEPKLRLYAVADKEIKLMNLSISSTQMDDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V189 trav LAVF01153024.1 2694 ESNGNVIRPNQPSVVLTEGSSTTLSCSYDGSAYSLHWYRQKPGSKPEFLLLIVESTKYVNKADQPHPHMSIRLCNDKPVDLEISSAAVSDSAVYYCALE
Sinocyclocheilus rhinocerous V188 trav LAVF01153024.1 4973 NAGEDVIKPVFTEKQVLEGKDVTLICNYTGTVNYLQWYRQYPGFMPEHIIMFFETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V187 trav LAVF01153021.1 9956 NAGEDVIKPVFTEKQVLEGKDVTLICNYTEAVRNLQWYRQYPGSKPEHLILFFETNPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALE
Sinocyclocheilus rhinocerous V186 trav LAVF01153021.1 10887 TAGEDVIKPVFTEKHVVAGKDVTLICNYTGNIQNLQWYRQYPGSKPEHLILYIETIPKSEPALRLTAAADKAAKSMTLMISSTEVKDSAMYYCALE
Sinocyclocheilus rhinocerous V185 trav LAVF01153021.1 13121 TAGEDVIKPVFTEKQVLEGKYVTLICNYTGSVQNLQWYRQYPGTKPEHLILYIETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V184 trav LAVF01153021.1 14229 TAGEDVIKPVFTEKHVLAGKDVTLICNYTGSVQNLQWYRQYPGTKPEHLILYIETIPKSEPALRLTAAADKAAKSMNLTISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V183 trav LAVF01152491.1 3225 SSDVTQTSSLWVEQGESAVMDCSHTKGADYWYMYWFRQRQGETMRLIAFIMKNDKPDFGEFSGDKYSAEKTVAESGSFTVKKLQPDDSGVYFCAVSKHS
Sinocyclocheilus rhinocerous V182 trbv LAVF01138771.1 1373 SILGKSVVQTPSDLLKKEDEFAEIKCSHSIQNYYVTQWYKQSQSIMELQLMGNINVKQKTIEPEFNGKIKLDGDGRNNVTLTIDTLKLNDSAMYFCAAY
Sinocyclocheilus rhinocerous V181 trbv LAVF01138769.1 2131 FSFSYNVDQSPPDVIKRRGESAEIRCSHSVPSYNQINWYRQNQEGFTLMGYLFATSNTSEKEFMDKIVMSGNGNSDGLFTIKNLASSDSAVYFCAAC
Sinocyclocheilus rhinocerous V180 ighv LAVF01138769.1 3164 LVRSQKVDQSPPDLIRKLTESAVLTCSHSDQGFEHILWYKRSDDKGFIFLGYLNNNFPNPEDEFKQKIDLAGDGRSSATLTIKDLTEDNSGVYYCAAR
Sinocyclocheilus rhinocerous V179 trbv LAVF01138769.1 4304 SSHSNKVDQSPPDVIKKQGESAKIQCSHNVPSYNQINWYRQHQGQEFTFMGYLLLTSPNPENEFTAKIEMSGNGNSNGAVTIKNLSSSDSAVYFCAAY
Sinocyclocheilus rhinocerous V178 trav LAVF01138769.1 9924 STLSDNVFQEPRDMIVDIKDSPVLQCSHSISSYDRILWYKQTQDGQLVFLGYLLGLIDQLEPEVKNKFKLDGNGNNNGKLAIKSLEFNDTATYFCAASTQ
Sinocyclocheilus rhinocerous V177 trbv LAVF01138769.1 11073 ISNSQDIHQTPKDLIKDPGQSEVLRCSHSSSYNVMLWYKQKRGESLELLGYLVDSGDTVEDTFKNKISLDGDAYKNSVLKLESLSSDDSAVYFCAAS
Sinocyclocheilus rhinocerous V176 trbv LAVF01138768.1 3516 FSLSNKVDQTPSDVIETQGETAKIQCLHSVPNYNQINWYRQNQDHGFTLMGYLLGKEPYKENDFKDKIEMSGDGNNNRYLNIKSLSSNDNAVYFCAAY
Sinocyclocheilus rhinocerous V175 trav LAVF01138766.1 838 CLICEKVHQSPSDVLCKPKESVNLTCRHKITNYDTILWYQRSYGDSSLKLIGYARYSSEKKFEASYVDNFSLTGNGEEEVTLKILQARPDQDSAEYFCAAYYAQ
Sinocyclocheilus rhinocerous V174 trbv LAVF01138766.1 2262 HLLSSVDQTPSEVIVRSGQAYTLSCSHSISSYNTILWYQHEHGQGMNIIGYSFHSTHNVENADDKKYKLEGDAKSSVNLTISELTLKESAVYFCAAS
Sinocyclocheilus rhinocerous V173 trbv LAVF01138766.1 3364 FSYTYTVDQSPPDVIKKPKESAKIQCSHSVPNYNQISWYRQIQDQGFKFMGYLFLKEQNPEKEFTKKLEMSGDGNSNGYLTIKDLSSNDSAVYFCAAC
Sinocyclocheilus rhinocerous V172 trbv LAVF01138766.1 3866 FSYTYTVDQSPPDVIKKPKESAKIQCSHSVPNYNQISWYRQIQDQGFKFMGYLFLKEQNPEKEFTKKLEMSGDGNSNGYLTIKDLSSNDSAVYFCAAC
Sinocyclocheilus rhinocerous V171 trdv LAVF01138764.1 211 FSVNSAIKQTPSDLLSKNNVESVTLHCSHTNPNFNVILWYKQPLSGEMQLMGYLYRTNNNSEPVFKEKIELLGNGASNSNLILKKLSSDDNAIYYCAAS
Sinocyclocheilus rhinocerous V170 trbv LAVF01138761.1 5255 ISLGSSIDQPADMLKHQGDTVNISCTHTYSSYYYLYWYQQTTQEESFKLLGYLYMKKLNPEKDYDRFYIYGNSQTHGTLQIATVTSEDSAMYFCAVS
Sinocyclocheilus rhinocerous V169 trbv LAVF01138761.1 11170 CVVCSPVIQQSPKHLLRTEEEKEAKLSCHHGDSSYQFMYWYQQKINGGSLELIGMLQYGTDSEEEKFKPRFNITGDATKDAFLLISNINAEDSTVYFCAAS
Sinocyclocheilus rhinocerous V168 trbv LAVF01138761.1 12035 CVVCSPVIQQSPKHLLQTVEEKKAKLSCHHGDSSYPYLYWYQQKSNSGSLELIGMLRYGEPSPEDKFKTRFNITGHATQDAFLIISSISAEDSAVYFCAAS
Sinocyclocheilus rhinocerous V240 trav LAVF01168935.1 36985 NGNVIRPNQPSVVLTEGSSTTLSCTYDESAYSLHWYLQKPGSKPDFLLLIVESSKYVTRADQPHPHMSIRLHDNKSVDLEISSAAVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V239 trdv LAVF01168935.1 37810 DAADDVIKPVFTEKQVLAGKDVTLICNYTGTVQSLQWYRQYPGSKPEHLIMFFETSPKSEPALRLTAAADTAAKSMNLMISSTEVKDSAMYYCALV
Sinocyclocheilus rhinocerous V238 trav LAVF01168935.1 39887 NADAEVITSFFTEQHVLAGKDITLSCNYSGYVQNLQWYRQYPGSKPENIIFYTETNSQSEPKLRLYAVADKGIKLMNLSISSTQMDDSALYYCALQ
Sinocyclocheilus rhinocerous V237 trav LAVF01168935.1 42544 CGNVIRPNQPSVVLTEGSSTTLSCTYDESAYSLHWYLQKPGSKPEFLLLIVESTKTVVPASPLHPHMSIRLRNNNGVDLEISSAAVSDSALYYCALE
Sinocyclocheilus rhinocerous V236 trav LAVF01168935.1 46020 NADANTINPLVPEKHMTAGDNVTLSCEYSGGVNTLQWYRQYPGSRIEFLIFATELSGRSEPALRLSSTADKGNKWMHLNIFLTEMDDSALYYCALVPTVTG
Sinocyclocheilus rhinocerous V235 trav LAVF01168935.1 47305 IKPLSLNENRFVGDSVTLSCSYKDYSGTVNNLQWYRQYPRSKPEFLLYIFPQGVMSEDRPPRFTATVNQDNKQVDLKISSAVETDSAMYYCALR
Sinocyclocheilus rhinocerous V234 trav LAVF01168935.1 48460 SLGDLITSHGSEKQAQDGNSVTLSCNYTGVVNNLLWYRQYQRSKPELLLSMTESGDPVKADPSAHWLSAKVDKLTKLMELEISPAKVSDSAQYYCALR
Sinocyclocheilus rhinocerous V233 trav LAVF01168935.1 50306 ADTIKPLSLNENRFVGDSVTLSCSYKDYTGTVNNLQWYRQYPRSKPEFLLYIFQHGAMSEDRPPRFSAAVNQDNKQVDLEISSAVETDSAMYYCALV
Sinocyclocheilus rhinocerous V232 trdv LAVF01168935.1 51440 EANKSPISSDKPYVSLNEGSNATLSCTFDESAYRLHWYRQKTGSKLEFLLLIDKSTKVVVAASPPLPHMSTSIHNNNRVDLEISSAAVSDSALYYCALQ
Sinocyclocheilus rhinocerous V231 trav LAVF01168935.1 52158 SLGDLITSHGSEKQAQDGNSVTLSCNYTGVVYNLLWYRQYQRSKPELLLSMTESGDPVKEDPSAHWLSAKVDKHRKLMELEISPAKVSDSAQYYCALQ
Sinocyclocheilus rhinocerous V230 trdv LAVF01168935.1 53297 ISFADTIQPLSSEKHIFRGDNVTLSCNYSGFVYSLQWYRQYVGSRPEFLILVNENSEASEPSLRLSAKDSKEKKQVNLTISSAEVTDSALYYCALR
Sinocyclocheilus rhinocerous V228 trgv LAVF01168935.1 60471 TVLANAITPRSTKQHVLEGGEVTISCNYSGSNINSLQWYRQSSKTAPEFILQAFERSGPQQKDRYVAKVQMNEKQLILEISKTEMADAVIYYCALV
Sinocyclocheilus rhinocerous V227 trav LAVF01168935.1 62148 ISFANTMQPLSSEKHVFRGEQVILSCNYSGNVDNLQWYRQYPGSRPEHLILVTEYSEPDLSRRLSAKATKDLKQVHLTISSAEETDSALYYCALQ
Sinocyclocheilus rhinocerous V226 trav LAVF01168935.1 62904 SVFANAITPLFTEKHAFEGEKATLSCNYSGSNIKSWQWYRQYPNTAPEFLLQALESLGPEQKDRHVAEAQKDKKHLNLEISKTEVADSAIYYCALV
Sinocyclocheilus rhinocerous V225 trav LAVF01168935.1 67058 KSFAQSIAPLQTTERATERETVILSCKYDSQARTLQWYRQYPGSRPEFLLLVYESNSVLHAEPPFPRLNASVNKVEKQVHLKISSAAVTDSALYYCALE
Sinocyclocheilus rhinocerous V224 trdv LAVF01168935.1 69936 GCFAQTITPLQDRTQVTEGKPVNLSCKYDVSVQNLLWYRQYPGSGLEFLLLVVESSRKTVVYADPPIPRLDGEMSMKDKRVDLEISSAEVTDSALYYCALQ
Sinocyclocheilus rhinocerous V223 trav LAVF01168935.1 71255 NILTNMITSHDSQKQVLEGKNVTLTCNYSGVPDNLHWYRQYPRSTPKFLLYIYESGLMSDNIPQRLTPRMNKNTKRVDLEISSAAVSDSAVYYCALR
Sinocyclocheilus rhinocerous V222 trav LAVF01168935.1 75478 GRFESPITSDQTEVFDEEGANITLSCSYSTAISLHWYRQYPRSAPEYLLFILQISGRVQSAENLDSRFSARLNEKKNRVDLIISFVKVTDSALYYCALE
Sinocyclocheilus rhinocerous V221 trdv LAVF01168935.1 79142 GSFANVITPVKTEVYKKEGENVTLSCSYSSASTLQWYRQYPGSAPEFLMLILHSTGKVSQMSEIVDQDPRFSGKVNEEKTHVILEISSAKLTDAALYYCALTPTVTG
Sinocyclocheilus rhinocerous V220 trav LAVF01168935.1 80314 GTFAIDITPVQNEMFYSEGANITLSCNYSSAYTLQWYRQYPGQAPQYLLVVLYSTGQVSQRSEIVDQDPRFSGKLNDKKTHVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus rhinocerous V219 ighv LAVF01166120.1 153 QTLAESESVVIKPVNNHKLTCTFSGIDVGAADISWIRQAEGKALEWISHISAPSGSSKYYSKTVEGRFTISRDNSKMQVYLHMTNLQTEDTAVYYCARKTQ
Sinocyclocheilus rhinocerous V218 trav LAVF01162444.1 1825 KVEQPLRKMTANEAAQITRLCNYSTSFPNAYLFWYKQLPNRSPTFILSEFSIGKGTTEDEFKERFSATLDSTSRTVPLMIKNLRVSDSAVYYCALCSE
Sinocyclocheilus rhinocerous V217 ighv LAVF01162375.1 947 IDCQVVLTQSEQSVVVAPGGSYKLTCACSGFSVSGTNMYWIRQAPGKGLEWIIYYYSDSDKSSAQSVQGRFTASKDISNFYLHMNQLKTGDTAVYYCATE
Sinocyclocheilus rhinocerous V216 ighv LAVF01162375.1 5499 VYSQVVLTQSEQSVTVSPGGSYKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYHTDSDKGSAQSVQGRFMASKDSSNFYLHMSQLRTEDTAVYYCARD
Sinocyclocheilus rhinocerous V215 ighv LAVF01162375.1 6430 LFCIELDQPPILVVKPGETFTIACKITGNSASGGGYTNWIRHSSGKPMEWIGGFHTSSSNGVKDSLNNKLSFSSESSSNAVILTGKNFNIEDTAVYYCARN
Sinocyclocheilus rhinocerous V214 ighv LAVF01162375.1 12128 IHCQTFTQSQDVVKRPGESFQLVCTASGFTFSGSWAAVVRQAPGKGLEWVAAITSTNDAYYSQSVQGRFTVSRADSSSQLYLQMNSLKTEDPAVYYCARE
Sinocyclocheilus rhinocerous V213 igkv LAVF01161103.1 5628 SIGQVSVTQTPSVLLAQTGHSVTVTCTFNSDANCCHNGNHFLSWYLQKPGEAPKLLIYGAISRQSGTPSRFSGSRSSGRDFTLTISGVQTEDVGHYYCMS
Sinocyclocheilus rhinocerous V212 igkv LAVF01161100.1 904 TTGQISVTQTPSVAAVQPGETVTLNCQTSRGIGDRSRGCGDCLSWYLQKPGEAPKLLIYGISSRQSGTPSRFSGNGANYGTDFTLTISGVQTEDAGHYYCLS
Sinocyclocheilus rhinocerous V211 igkv LAVF01161100.1 6836 ITVTQPEVLTVSKGQDATIECKTDAGIDSWGLAWYQQKPGETPKLIIYSADSLYDDSFSRFSGNGAYEGTDFTLTISGVQTEDAAHYYCMS
Sinocyclocheilus rhinocerous V210 igkv LAVF01155807.1 439 SRGEVTVTQTPAVKPVQPGDTVTMSCKTSPEVYQSWGYQPLSWYLQKPGEAPKLLIYHANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V209 trgv LAVF01153026.1 1077 NVLANAITSRSTKQHVLEGGKVTISCNYSGSNINSLQWYRQSSNTAPEFILQAFIGLGPQQKDRYVAEVQKNEQQLDLEISKTEMADAAVYYCALV
Sinocyclocheilus rhinocerous V208 trav LAVF01153025.1 3107 NVDAELITSFFTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIFYTESSSQSESKLHLYAVADKGNKLMNLSISSTQMDDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V207 trav LAVF01153025.1 4367 ESNGNVIRPNQPSVVLTEGSSTTLSCSYDGSAYSLHWYRQKPGSKPEFLLLIVESTKYVNKADQPHPHMSIRLHDNKSVDLEISSAAVSDSAVYYCALE
Sinocyclocheilus rhinocerous V206 trav LAVF01153025.1 5294 TAGEDVIKPVFTEKQVLEGKYVTLICNYTEAVNNLQWYRQYPGSKPEHIIMFFETIPKSEPALRLTAAADKAAKSMNLMISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V205 trav LAVF01153025.1 7757 NVDAELITSFFTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIYYTESSSQSEPKLRLYAVADKGIKLMNLSISSTQMDDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V276 trgv LAVF01283259.1 12 SVFANAITHISTENHAFEGGKVTISCNYSGNDIRSWQWYRQYPNSAPEFLLQALETLGPEQKDRYVAEAQKDKKLLNLEISKTEVSDAAIYYCALV
Sinocyclocheilus rhinocerous V275 trav LAVF01281863.1 102 ANHAKTVLQSPDDLIKNQNELAVIVCSHNIQNYNQMLWYKQSQDMPGLKLMGYLYVDQNIEPEFTNKIKLEGDAKRNGTMTINNLKPQDSAVYFCAAC
Sinocyclocheilus rhinocerous V274 ighv LAVF01191789.1 2378 VSGISLTSAPAQTKAPGQSVRMSCQISGYALTDVGTAWIRQPPGKALEWIGIIWGSGSIDSGNSFKSRFTISRDTGRKELYLDISSLQTEDTAVYYCAKT
Sinocyclocheilus rhinocerous V273 ighv LAVF01191788.1 937 VRGQSLTSSDSVVKKPGESVTLSCTGSGFSVGSSYMHWIRQKPGKGLEWIGRIDDGTGTVFAQSLQGQFSITKDSNKNMLYLEVKSLKPEDTAVYYCARQ
Sinocyclocheilus rhinocerous V272 ighv LAVF01191786.1 4705 VECNIVLTQPNSVVLQPGHSLTLTCEVSGYSVTDNSYATAWIRHPAGKALEWNVHIWGGGDIYKKDSLANKFIISKSDSSNTVTLKGQNVQTEDTAVYYCARRP
Sinocyclocheilus rhinocerous V271 trbv LAVF01186836.1 21740 SSDVTQTPILWVPQGESAQMNCSHTKGAGYNYMYWFQQRQGETMRLIAFMMADSKPDFGEYSDDKYSAEKTVAERGSFTVKKLQPDDSGVYFCAVSEHS
Sinocyclocheilus rhinocerous V270 trbv LAVF01186836.1 30440 SSDVTQTPILWVPQGESAQMNCSHTKGADYFYMYWFRQRKGETMRLIAFTTTTNIKPDFGEYSDDKYSAEKTVAERGSFTVKKLQPDDSGVYFCAVIKHS
Sinocyclocheilus rhinocerous V269 igkv LAVF01186427.1 8465 SNGQVTATQTPQVLTSQRDETVKINCKTNSPVADCSLWRNCVFWYQHKPGHAPKLLIYCIRERHSNVPSRFSGNGAHTDFSLTISGVQKEDEAQYYCMT
Sinocyclocheilus rhinocerous V267 ighv LAVF01184329.1 6329 INCQVVLTQSEQSVVVAPGASYKLTCACSGFTVSSTYMHWIRQAPGKGLEWIIYYYDDSHKISAQSVQGRFTASKDSSNLYLHMSQLKTEDTAVYYCATE
Sinocyclocheilus rhinocerous V266 ighv LAVF01184329.1 8019 VYSSVEHNQPSSLLVKPGESFTITCKISGYALSDTSKAPSWIRHTHGKILGFIGMIHAGGGIDYKDSLKNKFTISRDTSISTVYLKGQNLQTEDTAVYYCVRYT
Sinocyclocheilus rhinocerous V265 trav LAVF01181571.1 6583 CSSDADVVQEDNVKIGQVGENVNLTCTFSKLLQTTTAWFKHTADRKSVQIVSLYLNQQPSWNEDFDKTNRFNVIKGDDHFNLTILKTKPSDSATYYCVVSSY
Sinocyclocheilus rhinocerous V264 igkv LAVF01176049.1 1292 FSGQVTVTQTPSVKTVQIGESVTINCKTNTEVSNACTGSYTCMAWYQQKPGEAPKRLIHSANQRDSNTPSRFSGSGSRTDFILTISGVQTEDTGHYYCQR
Sinocyclocheilus rhinocerous V263 trav LAVF01168940.1 6823 CQSDDTVDQPLHVTEFEGESVTLDCKYTTTSQSQELFWYIQRTDESPKLVLQSNSYGGGINGTEFQERFYSEVKPSKSVPLIIQRLRVSDSALYYCALR
Sinocyclocheilus rhinocerous V262 trav LAVF01168940.1 13359 DTVDQPDKHVTEAEGGSVTLQCKYTATTTTAPELFWYIQRANDIPKYMLRKNKYGGDQATEFQERFHSEVSSDSVPLTIKNLRVSDSAVYYCALQPTVTE
Sinocyclocheilus rhinocerous V261 trav LAVF01168940.1 16795 DTVDQPDKHVTEAEGGSVTLQCKYTATTTAPELFWYIQRANDIPKYMLRKNKYGGDQATEFQERFHSEVSSDSVPLTIKNLRVSDSAVYYCALQPTVTE
Sinocyclocheilus rhinocerous V260 trav LAVF01168940.1 19493 CGSLDSVEQNTTVQTAVEGAAVTINCQYETTDKLPNLLWCQQKANGVPEYMLSKFGSRNRFNERFSGDLNTISKTFPLTIQDVRVSNSSVYYCALRTNT
Sinocyclocheilus rhinocerous V259 trav LAVF01168940.1 20403 CDSLESVDQNTRVQTAVEGRSVTINCRYETKTSDLSPYLFWYQQKMNGIPKYMMMIFAITVQNDKDFEERFNANHNKSSKLFPLTIHVCVSDSAMYYCALRPTVTET
Sinocyclocheilus rhinocerous V258 trdv LAVF01168940.1 24419 LEKDDTVDQPLKHVTEFEGESVTLDCKYTTASPSQELFWYIQRTDESPKLVLQRKSYGGGINGTEFQERFYSEVKPSKSVPLIIQRLRVPDSALYYCALR
Sinocyclocheilus rhinocerous V257 trav LAVF01168940.1 27943 DTVDQPDKHVTEAEGGSVTLQCKYTATTTTAPELFWYIQRANDIPKYMLRKSKYGGDQATEFQERFHSEVSSDSVPLTIKNLRVSDSAVYYCALQPTVTE
Sinocyclocheilus rhinocerous V256 trav LAVF01168940.1 34477 CDSLDSVEQNTTVLTALEGAVVTISCQYETTDILPIFFWYQQKVNGVPEFMLDKFDNYAIHFKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCALQPTVTE
Sinocyclocheilus rhinocerous V255 trav LAVF01168940.1 36608 EQPSGGMTANEADQVTLICNYTTKTTNADVYLFWYKQLPNKSPIFILNKYTFSEGITEQDFKKRFSATLDSTSRTVPLMIKNLRVSDSAVYYCALR
Sinocyclocheilus rhinocerous V254 trav LAVF01168940.1 37316 KVEQLSREMTANEAAQITLLCNYSTSSYNNAYLYWYNQLPNRSPTFVLSEFSSGKGTTEDEFKERFSASLDSTSRTVPLMIKNLRVSDSAVYYCALRPTVTK
Sinocyclocheilus rhinocerous V253 trav LAVF01168940.1 39878 RVKQPSIEMTAKQGDPVTLLCNYSTTTTNAYIFWYKQLSNRSPTFILNKYSFSEGITEADINKRFSATLDSTSRRVPLTIQDVHVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V252 trav LAVF01168940.1 42881 SSGQDRVEQSFREITTSERDQVIVRCNYTTTDTNPYLFWYQQLPNRSPTFILNKFTFGEGNTEPDFKKRFSATLDSTSRTVPLMIKDVRVSDSAVYYCALRPTVTE
Sinocyclocheilus rhinocerous V251 trav LAVF01168939.1 1370 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDLSPYLFWYQQKMNGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSVPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus rhinocerous V250 trav LAVF01168939.1 2141 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDLSPYLFWYQQKMNGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSVPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus rhinocerous V249 trav LAVF01168939.1 2687 CDSLESVDQNTRVQTAVEGRSVTINCRYETSDLSPYLFWYQQKMNGIPKYMMMIFATTVQNDKEFEERFNANHNKTSKSVPLTIQDVSVSDSAVYYCALR
Sinocyclocheilus rhinocerous V248 trdv LAVF01168938.1 1778 AEVITPYSAYQIADEGDSVTLSCSYTGSVQGLHWYRQYAGSPPKFLIMDSYGAVTKADPPVAGVSIHHRKDNSSVDLKISSAAVTDSTLYYCALE
Sinocyclocheilus rhinocerous V247 trav LAVF01168938.1 3428 SEVITPKRDREFARESDNVTLSCNYSGSARGVHWYRQYAGSPPQFLILEYSGVTTPANPPVPGITINHRKTESHVDLIISSAAVSDSAVYYCALQ
Sinocyclocheilus rhinocerous V246 trgv LAVF01168938.1 5341 VSFGNVITPVQIEVFWTEGGNITLSCNYSSAISLQWYRQYHGSAPEFLLIILHRTGKVSQKSKIVELDPRFSLKLNEKKTHVDLEISSAKLTDSALYYCAME
Sinocyclocheilus rhinocerous V245 trav LAVF01168936.1 2265 KDVITPYSDEAFATETESVKLSCNYTGSVDSLHWYRQYAGSPPQFLILDYYGATTHANPPVSGISISHRKEENSVDLIISSAAVSDSALYYCALR
Sinocyclocheilus rhinocerous V244 trav LAVF01168936.1 8412 KDVITPYSDEAFATETESVKLSCNYTGSVDSLHWYRQYAGSPPQFLILDYYGTTTHANPPVSGISISHRKEENSVDLIISSAAVSDSALYYCALQ
Sinocyclocheilus rhinocerous V243 trav LAVF01168935.1 27422 ETTGYSIKPDKNTTELMEDTNMTLSCIYEGSIDSLHWYQQKPGSRPEFLIMIDEASKYVTKANPPFPRLSIKLDKIQKRVHLEISSAAVTDSAMYYCALR
Sinocyclocheilus rhinocerous V242 trdv LAVF01168935.1 28521 NAADDVIKPVFTEKQVLAGKDVTLICNYTGTVRSLQWYRQYPGSKPEHLIMFFETSPKSELALRLTAAADKAAKSINLTIFSTEVIDSAMYYCALQPTVTG
Sinocyclocheilus rhinocerous V268 igkv LAVF01184501.1 274 SRGQISVTQSPSTTAAQPEETVKINCKTSRDVFSNSWGQRLAWYLQKPGEAPKLLIYAATNRYTGTPSRFSVGGSNSDFTLTISGVQTEDAGHYYCQS
Sinocyclocheilus rhinocerous V241 trav LAVF01168935.1 35390 NADAEVITSFFTKQHVLTGRDVTLSCNYSGNVRNLQWYRQYHGSKPKNIIFYTESNSQSEPKLRLYAVADKGIKRMNLSIYSTELDDSALYYCALE
Sinocyclocheilus rhinocerous V229 trav LAVF01168935.1 53995 SAGAYTIESLLPEKHVLVGQSAVISCKYSGIGPSFQWYRQYPRSRPEYLIFNAETAVSSEPTLRLKAMAKKEITEVELEISSTEVKDSAVYYCALV
Sinocyclocheilus rhinocerous V204 trav LAVF01153025.1 9177 NVDAELITSFFTKQHVLAGRDVTLSCNYSGNVRSLQWYRQHPGSKPENIIYYTESSSQSEPKLRLYAVADKGIKLMNLSISSTQMDDSALYYCALQPTVTG
Sinocyclocheilus rhinocerous V194 trav LAVF01153025.1 24352 EANKSPISSDKASVSLNEGSNATLSCTFDESAYRLHWYRQKAGSKLEFLLLIDKSTKFVVPASPPLPHMSTSFHNNNRVDLIISSAAVSDSALYYCALE
Sinocyclocheilus rhinocerous V167 trbv LAVF01138760.1 1334 FSDGVLITQWPKYISSLPSSSAEMHCYQNDTDYNYKYWYRQIKGEGPVLIGSNNFNSPSNEKGFENGFTISGTETKKWTLTVDVKKGIDAVYLCAAS
Sinocyclocheilus rhinocerous V156 trav LAVF01104571.1 5275 SDGIRSTTVLQQPVSDRLHPGDSVTLQCSVISQICAGEYSVYWFRHSSGHSHPGLIYTRDNRSDQCMERSENGFSTQSCIFSLSQTELRPSDAGIYYCAVATCGK
Sinocyclocheilus rhinocerous V130 trbv LAVF01018763.1 3222 VCLGKTVLQTPDDLLKKQDESAVITCTHNIQSYDRILWYKQSQDVLGFELMGNLFYEDETKETGFEKKIKLEGDGRNKGILTISNLTLTDRAVYFCAAY
Sinocyclocheilus rhinocerous V114 ighv LAVF01155240.1 2964 IDSYELTQPESLTVRPDATLTINCKVSYSVTDYSTAWIRQPAGKALEWIGLIDSAGNLAYKDSLKSKFSITRDTSSNTITLQGKNMQAEDTAVYYCAR
Sinocyclocheilus rhinocerous V93 trbv LAVF01152483.1 1458 FSLSNKVNQSPPDVIERQGETAKIQCSHSVSSYNQINWYRQNQDHGFTLMGYLLGKDPYKENDFKDKIEMSGDGNSNGYLNIKSLSSNDNAVYFCAAY
Sinocyclocheilus rhinocerous V73 trbv LAVF01108762.1 14482 VSFGNVITPVQPEVFGTEGDNITLSCNYSSAVSLQWYRQYPNSAPEFLLIILQGTGKVSQKSKIVEQDPRFSGKVNEKKTHVDLEISSAKVTDSALYFCALE
Sinocyclocheilus rhinocerous V56 igkv LAVF01093646.1 8321 TQNPEIKSIKQGETVTISCKTSQLTSNCNDCVSWYQQKPGEAPKLLIYYINRLQSGTPSRFSGSGSRYGSDFTLTISGVQTEDTGHYYCQR
Sinocyclocheilus rhinocerous V50 igkv LAVF01046444.1 680 SIGQVTVTQTPSQLLAQTGEEVKIKCTTSSNAGCCCGGTACISWYLQKHGEAPKLLIYGANQVQSGTPSRFSGSGSNSDFTLTISGVQTEDTGDYYCQS