WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Protobothrops mucrosquamatus BCNE00000000.2 (BCNE02) 138 83 21 1 20 5 5 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Protobothrops mucrosquamatus V19 ighv BCNE02080406.1 10931 VSSQAQLVESGGDVRRPGGSLRLLCQASGFTFSSSAMSWVRQAPGKGLEWVSYISYNSGTIRYSDKVKGRFTISKDDAKSQLYLQMNSLKPEDTAIYYCTA
Protobothrops mucrosquamatus V18 ighv BCNE02080406.1 8123 VCSEVQLVESAGDVRRPGGSLRLSCQGSGFTFSNAYMHWMRQAPGKGLEWVAYINKGSSNLLYSDKVKGRFTSSRDDAKSQMYLQMNSLKPEDTAVYYCARE
Protobothrops mucrosquamatus V17 ighv BCNE02080404.1 16465 VLSDVQLVESGGDVRSPGGSLRLSCQASGFTFSSYHMDWVRQAPGKGLEWVAFISTDSGTIRYSDKVKGRFTISRDNAKSQMYLQMDSLKAEDMAVYYCAR
Protobothrops mucrosquamatus V15 ighv BCNE02080404.1 8023 IKSEVQLVESGGDVRRPGQSLRLSCQGSGYTFSSYSMDWVRQAPGKGLEWVAYIRSDSSSIHYLDTVKGRFTISRDNAKSQLYLQMNSLTAEDTAVYYCT
Protobothrops mucrosquamatus V14 ighv BCNE02080402.1 14156 VQSQNQSGGDVRSPGGSLHLTCQGSGFTFSSYDMNWVRQAPGKRLEWVARIYTDSSEKLYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCA
Protobothrops mucrosquamatus V13 ighv BCNE02074449.1 1684 QLVESGGNMRRPGQSLCLSCQGSGFSFSSKWMVWVRQASEKGLEWISYIQPSSASIYYSDKVKGRVTVSRDNAKSQLYLQMNNLKSEDTAVYYCSGTVKGS
Protobothrops mucrosquamatus V12 ighv BCNE02074442.1 581 VQSEVQLVESGGDVRRPGESLRLSCQASGFTFSNAYMHWMRQVPGKGLEWVAYINPSSSTVYYSDKVKGCFTISRDNAKSQLYLQMNSLKSEDTGIYYCAG
Protobothrops mucrosquamatus V11 ighv BCNE02074441.1 572 VQMEVQLVESGGDVKTPGESLRLSCQASGFTFSSYEMCWVRQAPGKGLEWVAWIDNNGDGSSHTYANSVKGRFIISRRDASSMLYLQMNSLKPEDTAVYYCARG
Protobothrops mucrosquamatus V10 ighv BCNE02074439.1 21773 VQSEVQLAESGGEVRRPGESLRLSCQASGFTFNNAYMHWMRQAPGKVLEWVAYINPSSSTVYYSDKAKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCA
Protobothrops mucrosquamatus V9 ighv BCNE02074439.1 17757 VQMEVQLVESGGDVRRPGETLRLSCQASGFTFSSYEMAWVRQAPGKGLEWVAWIDNNGDGSSQYYANSVKGRFTISRHDASSMLYLQMNSLKPEDTAVYYCARD
Protobothrops mucrosquamatus V8 ighv BCNE02074439.1 13176 VRSQVLLVESGGDVRRPGGSLRLTCQASGFTFSSYAMNWVRQSPGKGLEWMAYISSSSGTIYYSDTVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V7 ighv BCNE02074438.1 137 QLLESGGDVRRPGGSLRLSCQASGFTISGYWMNWVRQAPEKGLEWVANIRTGSSPSTYYPDKVKGRFTISRDDAKSQLYLQMNNLELEDTAVYYCTR
Protobothrops mucrosquamatus V6 ighv BCNE02074437.1 9771 VQSQGQLVESGGDVRRPGGSLRLSCQASGFTISGYWMHWVRQAPEKGLEWVAGISTGSSPSTYYPDKVKGRFTISRDDAKSQLYLQMNNLELEDTAVYYCTT
Protobothrops mucrosquamatus V5 ighv BCNE02074437.1 6252 QLVESGGGVRRPGGSLRLSCQASGFTFSTSWMHWVRQAPGQELEFVAKILTGSSPSIYYPDKFTGRFIISRDDSHSQLYLQMNNLKPEDTAVYYCAR
Protobothrops mucrosquamatus V4 ighv BCNE02074437.1 2696 VQSQVQLVESGGDVRRPGASLRLSCQASGFTFRSYYMGWIRQAPGKGLEWVASMGTTDTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V3 ighv BCNE02074432.1 6646 VQSDVQLVESGGDVRRPGESLRLSCQASGLSFSDYYMGWVRQAPGKGLEWVAYISTGSGTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAKDMAVYYCVT
Protobothrops mucrosquamatus V2 iglv BCNE02059373.1 800 SFAQYVLTQPSSVSVSLGQNERITCSGNNIGGKSVQWYQQKPGNPPVLIIYGDSRRPTGISDRFSGTNSGNTATLSISRAQAQDEADYYCQVWDSSQ
Protobothrops mucrosquamatus V1 trgv BCNE02031766.1 10993 EDLYTILQRPTWVVIDEFGIDHSLECSAKTSSIPNFYWFRQISNRSIDLLAFSISTRSTTNVGPSHMKGSRPNNENFLLNIRSMTTKDSGTYYCALS
Protobothrops mucrosquamatus V0 iglv BCNE02007167.1 825 IDGQSTWTQPPSSSVSLGGSIKISCRTTQSSYSIGWYQQKEGKGPRFVHCDGCSNRGEGIPNRFTATRSGSTGSLAITSVEAEDEASYYCGSWNSAVTQ
Protobothrops mucrosquamatus V55 trdv BCNE02032459.1 5302 QTVTQTEGRLTIIEGQPVFLNCTYDRSVDYQPSPFWYIQYLGQPPKLFKSTFSTPNIDASLPQNFKVVYNKVEKTFNMKKSVSQLNDSAIYFCALK
Protobothrops mucrosquamatus V54 trav BCNE02032459.1 13431 TSQSDSVSQTQNNMEILEGEDATLPCDFKTFSSNPYLYWYRQYKDQRPERILTAYKARPSNNHFREGKFSTTLFFGNQNSVPLKIGSVSLLDGAVYFCVLE
Protobothrops mucrosquamatus V53 trbv BCNE02031776.1 9278 LCHGVTVTQKERFKIIQAGTQMDIITCEHDDNSYLVIHWYRQELNSGQTELKLIGYSVQGNSPQMEIGNFNIDRPDVTHSSLRIPPDEAAKPAVYFCAVSQ
Protobothrops mucrosquamatus V52 trbv BCNE02031769.1 22692 CSDANIIQPHSMILEEGQDARLECRQDYGHLNMLWFRQRKQHQDLQLLYNFFNGNILQKNPYLHRLNADQPILDLCILSISVVKPEDSAVYFCASSE
Protobothrops mucrosquamatus V51 trbv BCNE02031767.1 22865 EQVLLTQKPAWISGQLGDQIQMNCQQTNTDHNWMYWYRQTVAKQQLELIGYIGKGASQATYEDGFEKQRFEIQQKHSKHCSLQINKMSSEDAAVYFCASS
Protobothrops mucrosquamatus V50 ighv BCNE02151111.1 710 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMHWVRQAPGKGLEWVAQIGTSSSPIRYSEQVKGRFTISRDDSRSQLYLQMNSLKSEDTAVYYCAR
Protobothrops mucrosquamatus V49 iglv BCNE02151098.1 825 IDGQSTWTQPPSISVSLGGSVTISCRTTQSSYSIGWYQQKEGKGPRFVHCDGCSNRGEGIPNRFTATRSGSTGSLAITNVEAEDEASYYCGSWNSAGNA
Protobothrops mucrosquamatus V48 ighv BCNE02142302.1 1255 VQSDVSLVESGGDVRRPGGSLRLICQASGLNFSSYNMAWVRQATGKGLEWVARIGTSSSSIGYSDKIKEHFTISRDDVLSQLYLQMNSLKSEDTAVYYCWGTG
Protobothrops mucrosquamatus V47 ighv BCNE02134515.1 710 AQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMDWVRQAPGKGLEWVAQIGTSSSPIRYSDNVKGRFTISRDDSRSQLYLQMNSLKSEDTAVYYCAR
Protobothrops mucrosquamatus V45 iglv BCNE02130654.1 3807 SFAQYVLTQPSSVSVSLGQNERITCSGSDIGEKNVHWYQQKPGNPPILIIYDDSSRPTGISDRFSGTNSGNTATLSISRAQAQDEADYYCQVWDSDYDQ
Protobothrops mucrosquamatus V44 iglv BCNE02129398.1 5216 IDGQSTWTQPPSISVSLGGSSTISCTTQSTYNIYWYQQKEGKGPRFVHCAGCSRGEGIPNRFTATRSGSTGSLAITNVEAEDEASYYCGSWNSAGNA
Protobothrops mucrosquamatus V43 iglv BCNE02129052.1 3954 IDGQSTWTQPPSISVSLGGSVTISCRTQSTNSIDWYQQKEGKGPRFVHCAGCSRGEGIPNRFTATRSGSTGSLAITNVEAEDEASYYCGSWNSAGNA
Protobothrops mucrosquamatus V42 trav BCNE02124102.1 564 TSQSDSVSQTQNNMEIREGEDAILSCDFKPLSSNPSLFWYRQYGNQRPEHILTAYKYGNNHFQEGRFSTTLVLGSPNSVPLNIRSVSLLDGAVYFCVLN
Protobothrops mucrosquamatus V41 ighv BCNE02124098.1 2130 IKCSVQLEQSGSYVKRPGQSLFLFCKGSGFNFGSYGMHWVRQAPGKGLEWIAVIWYDASKQEYAESVKGRFTISRNNAKSLLYLQMNSLKPEDTAVYYCTR
Protobothrops mucrosquamatus V40 ighv BCNE02124097.1 184 IKCSGQLEQSGSYVKRPGDSLSISCKGSGFNFGSYGMHWVRQAPGKGKEWIAVIWYDASKQEHAESVKGRFTISRDNAKSLVYLQMNSLKLEDMAVYYCTG
Protobothrops mucrosquamatus V39 ighv BCNE02121026.1 1627 ISSQITLTESGDGLKKPGDTLRLTCTVSGFAITSYGVHWIRQPPGKALEWNGAIWVDGSSNYNSALQNRITITRDTSKNQVFLQLTGLKPEDTAIYYCA
Protobothrops mucrosquamatus V38 ighv BCNE02113678.1 2058 QLVESGGGVRKPGGSLRLSCQASGFTFSTSWMHWVRQAPGQELEFVATILTGSSPSIYYPDKFTGRFIISRDDSRSQLYLQMNNLKPEDTAVYYCVG
Protobothrops mucrosquamatus V37 ighv BCNE02113677.1 695 VQSQVQLVESGGDVKRPGGSLRLSCQASGFTFRSYYMGWIRQAPGKGLEWVASMGTTDTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V36 ighv BCNE02103402.1 8647 CRSEIQMIQSGGGIKAPRGSLTIICKTSGFGFTNYYMSWVRKQPEKGLEWLCQIPSLGTKPWYNPAIVGRFIQTRDNAKASTTLQMNDLKLEDSAVYYCTR
Protobothrops mucrosquamatus V35 iglv BCNE02103206.1 1460 INGQSTWTQPPSSSVSLGESVTISCKTTQSSYCIGWYQQKPGEAPRYVQCSGYSRGEGIPDRFTATKSGSTGSLAITNVQAEDEAIYYCGSWNSAVTQ
Protobothrops mucrosquamatus V34 iglv BCNE02103203.1 1083 IDGQSTWTQPPSISVSLGGSVTISCRTQSTNSIDWYQQKEGKGPRFVHCDGCSNRGEGIPNRFTATRSGSTGSLAITNVEAEDEAYYYCGSWNSAGNA
Protobothrops mucrosquamatus V33 ighv BCNE02094627.1 11905 VQSQVQLVESGGDLRRPGGSLRLSCQASGFPFSSYNMGWMRQFPGNGLEWITYMGTSSTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCTR
Protobothrops mucrosquamatus V32 ighv BCNE02094627.1 9985 VQSQGQLVESGGDVRRPEESLHLSCQGSGYNFGGYSMDWVRQAPGKGLEWIAGIYPDSSGKFYSDKVKGRFTVSRDNAKSQLYLQMNSLKAEDMAVYYCT
Protobothrops mucrosquamatus V31 ighv BCNE02094627.1 8285 VQSQGQLVESGGDVRRPGESLRLSCQGSGYNFGGYSMSWVRQAPGKGLEWVARIYYDSSGKFYSDKVKGCFTVSRDNAKSQLYLQMNTLKAEDTAVYYCAR
Protobothrops mucrosquamatus V30 ighv BCNE02094627.1 825 QLMESGGDVRRPGESLRISCQGSGFTFSSFNMNWVRHAPGKPMEWVGGIYTDSSGIYSYKMKGRFTISRDNAKSQLYLQMNNLKAEDTAVYYC
Protobothrops mucrosquamatus V29 ighv BCNE02094625.1 4272 VQSQAQLVESGGDVKRPGETLQISCQASGFTFSSYGMHWVRQAPGKGLEWVVSISPDSSGKFYSDKVKGRFTISRDNAKSQLYLQKNSLKPEDSGIYYCAG
Protobothrops mucrosquamatus V28 ighv BCNE02094624.1 5484 QLVESGGDVRRPGGSLHLSCQASGFTFSSNAMGWVRQAPGKGLEWVARIYSDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCARDF
Protobothrops mucrosquamatus V27 ighv BCNE02094620.1 11348 VRSEVLLVESGGDVRRPGGSLRLTCQASGFTFSSYVMSWVRQAPGRGLEWVAFIHTRSSPIYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCMG
Protobothrops mucrosquamatus V26 ighv BCNE02094620.1 9177 QMVESGGDVRRPGGSLRLSCQASGFTFSSHWMDWVRQAPGKGLEWVARISNGSPPSTYYSDKVKGRFTISRDDTKSQLYLQMNSLKQEDTAVYYCVR
Protobothrops mucrosquamatus V25 ighv BCNE02094618.1 356 AQSQVQLVESGGDVRRPGGSLRLTCQASGFTFSSYAMNWVRQAPGKGLEWVAFIHTRSTPIYYSDTVKGRFTISRDDAKSQIYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V24 ighv BCNE02094617.1 675 AQSQVQLVESGGDVRRPGGSLRLTCQASGFTFSSYAMRWVRQAPGRGLEWVASIGTSSTPIYYSDTVKGRFTISRDDAKSQIYLQMNSLKAEDTAVYYCAG
Protobothrops mucrosquamatus V23 ighv BCNE02094616.1 1516 VWSEVLLVESGGDVRRPGGSLRLTCQASGFTFSSSAMSWVRQAPGKGLEWVAFIGTSSTPIYYSDTVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCA
Protobothrops mucrosquamatus V22 ighv BCNE02080408.1 21 VRSEIQLVESGGDVRKPGGSLRLTCQASGFTFSSYGMHWVRQSPGKGLEWVAYISTDSSPIHYSDTVKGRFTISRDDAKSQIYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V21 ighv BCNE02080407.1 1646 VQSQVLLVKSGGEVRRPGESLRLSCQASGFTISGYWMYWVRQAPGKGLEWVANIYSSYIYYSDKVKGRFTISRDDAKNQLYLQMNSLKAEDTAIYYCAR
Protobothrops mucrosquamatus V20 ighv BCNE02080406.1 16509 VRSEVLLVESGGDVRSPGGSLRLTCQASGFTFSSYAMSWVRQAPGKGLEWVARTGGYYSDTVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V92 ighv BCNE02079068.1 16639 CHSQVQLVETGGGIVALGGSLRLSCKASGFTFTSYHMHWFRQAAEKEPEFVAGLAASGSSKWYNPKVNGRFTISRDNSQSSVYLQMNNLKAEDSALYYCARE
Protobothrops mucrosquamatus V91 trav BCNE02073523.1 7561 VLHLVSSQVFQSEQLILMEKDEIVLKCTHNITVINNMYWYKQTGRVLTFLGANYNGKLDLPGGFTMDVDQKSRSSKLTRDVARLKDAGVYFCAVR
Protobothrops mucrosquamatus V90 iglv BCNE02058991.1 793 DSAISFLQPVSVSASLGSATQISCTLSNGTMATYTISWFQHQQPSPPKYLLYYKDGPNQRRKTGVSERFAASKDASLNACYLTISEVQAADEGMYYCLASTGSE
Protobothrops mucrosquamatus V89 iglv BCNE02058988.1 2538 PSLQQLQTLKDPEFVAVGQTVTLSCRYDGGNLGDSNHPWWAQQISENKPRTLIYATSTRPSGIPERFSGSRSGNVMSLTITRALVEDEATYYCSAWTGSQ
Protobothrops mucrosquamatus V88 iglv BCNE02058987.1 1952 IDAQSPWSQPPSISVSLGGTLSLSCTTTQSSHSISWYQQKAGQGPRFVHCDGCSSRGEGIPDRFTATRSGTTGSLAITNIQAEDEGDYYCLSW
Protobothrops mucrosquamatus V87 iglv BCNE02058987.1 3201 IDGESPWTQPPSSSISLGGSITISCSTTQSSNCISWFQQKPGEAPRHVQCSGYSRGEGIPDRFTATKSGTTGSLAITNVQTEDEADYYCGSW
Protobothrops mucrosquamatus V86 trgv BCNE02058986.1 1292 AFSQAQVTQSDPLSVGIAGTTVITCTLQGVEFISPTNPSWYQLKEGQSPRLLIYKSRERASGIPERFSADTYGNTAKLTILSVEEGDEGDYYCAVWRNDR
Protobothrops mucrosquamatus V85 trdv BCNE02054065.1 1415 VSATVTLTQPPEAFALLGRSITLTCKVSGYNISDHHLNWVRQSNGKELVFITSFRTGYNTYTANEFKGRVTPSTQGSTGQLRIDGLKVEDTAIYYCAR
Protobothrops mucrosquamatus V84 ighv BCNE02054064.1 732 VSATVTLTQPPEAFALPGRSITLTCKVSGYNINDHHLSWVRQSNGKELVFITAFKTGHTTYTANEFKGRVTPSTQGSTGQLRIDGLKVEDTAIYYCVR
Protobothrops mucrosquamatus V83 ighv BCNE02054057.1 958 IQSEIQFLQSGPEIKRPGESIRLTCKASGYTFTDYSLSWIKQAPGKGLNWVGTIRTDNFNTFYAEALKARVTITVDTSISTTFMQLTNLNTDDTAVYYCA
Protobothrops mucrosquamatus V82 ighv BCNE02054056.1 556 VSLIESGGGLKRPGVSLQLTCTCSGFNIDSYWIHWVRQADGKGLEWISEINKGTVYYANSFKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCAR
Protobothrops mucrosquamatus V81 ighv BCNE02054054.1 3383 VSVTESGGELKRPGDSLRLTCTCSGFNIDSYWIHWIRQADGKGLEWISRINKGTVYYANSFKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCAR
Protobothrops mucrosquamatus V80 ighv BCNE02054054.1 8214 VLADVSVTESGGGLKRPGVSLRLTCTCSGFNIDSYWIHWVRQADGKGLEWISAINKGTTHYANSFKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCAR
Protobothrops mucrosquamatus V79 ighv BCNE02054053.1 1357 ITISQSAAQVKRPGERMRFTCTVSGFSLGTSGISWIRQVSGKELEWIGDIWHNGGTAYSTIFRSQASITKDNSRSQVILQLNALKAEDTATYYCI
Protobothrops mucrosquamatus V78 ighv BCNE02054052.1 2211 ALCQITLTQSSPVIKNQGESLQLKCSITGFDIYNHYMQWSMKQPGNPLKWLVHYRIPKYSAYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Protobothrops mucrosquamatus V77 ighv BCNE02054051.1 1917 VLCQITLTQSSPIIKNQGESLQLKCSITGFDIYNHYMDWLMKKPGNPLKWLVHYRIPKYSAYSPTIQGRFTASKDSSNFYLQMNDLKMEDTAVYYCTSAI
Protobothrops mucrosquamatus V76 igkv BCNE02054051.1 3709 ALSQITLTQSSPIIKNQGESIQLKCSITGFDINHHYMNWVMQRPGKPLEWLVYYRILKYSGYSPRIQGRFTSSKDSSNFYLQMNDLKVEDTAVYYCTTHIDP
Protobothrops mucrosquamatus V75 trgv BCNE02054050.1 2025 ISSQITHTESGDGLKKPGDTLRLTCTFSGYAITSYGVHWIRQPPGKALEWNGAIWAGGTTNYNSALQNRITITRDKSKNQVFLQLTGLKPEDTGTYYCAG
Protobothrops mucrosquamatus V74 ighv BCNE02054048.1 3460 ISSQITLTESGDGLKKPGDTLRLTCKVSGFAITSYGVHWIRQPPGKPLEWNGAIWSGGSTDYNSALKNRITITRDTSKNQVFLQLTSLKPEDTATYYCAR
Protobothrops mucrosquamatus V73 trav BCNE02032474.1 1258 VLGQVRVTQEHQFLSVKEGDSIRLKCSYSERASSLQWYKQCPGGQPEFLMILYSSKTEEKDNLEMTLDTEKKATSLYLKNTQFKDSAVYFCAWSHSARK
Protobothrops mucrosquamatus V72 trav BCNE02032474.1 5717 CSLNAQVFQTPENLEVQEGSLFILKCNYTSQYQIYFWYHQLPGAHPSLILSISSQQSQKNKGFEAKYLDNGKESQLHRPTAQLQDSGNYFCAVH
Protobothrops mucrosquamatus V71 trav BCNE02032474.1 10682 VSGQATVTQEHQFLSVKEGDSIHLNCSYQETEYSLQWYKQYPGEKPEFMMFLITSGTEAKDHFEMTLDTEKKTTSLYLKNVQFKDSAVYFCGMKHSARK
Protobothrops mucrosquamatus V70 trav BCNE02032472.1 3209 PRLDAQVFQTPENLEVQEGSSFILKCNYTSQYQSYFWYHQLPGAHPFLILSISSQESQNNKGFEAKYLDNGKESQLHRPTAQLHDSGNYFCAVQ
Protobothrops mucrosquamatus V69 trav BCNE02032472.1 5940 VSGQVKVTQEHQFLSVKEGDSILLKCSYSETASSLQWYKQCPGCQPEFLMILYSSKTEAKNNLEMTLDKKNKTTSLYLKNTQFKDSAVYFCAWSHSARK
Protobothrops mucrosquamatus V68 trav BCNE02032472.1 16876 ISSQARITQEHQFLSVKEGDSIQLNCSYQEPEDSLQWYKQYPGGQPEFMVVLYSSNTKAQDNFEMSLDTKNKTTSLYLKNTQLKDSAVYFCAW
Protobothrops mucrosquamatus V67 trav BCNE02032472.1 23820 VSDQARITQEHQFLSIKEGDSICLKCSYQETEYSLQWYKQYPGGQPEFMILLTISGTETKDHFEMTLDTENKTTSLYLKNTQFKDSAVYFCAWSTVLE
Protobothrops mucrosquamatus V66 trav BCNE02032471.1 21418 VSGQATVTQEHQFLSIKEGNSIWLNCSYQGTDYNLQWYKQYPGSRPEFMILLTISGTKAEDNFEMTLDTDKKTTSLYLKNVQFKDSAVYFCGM
Protobothrops mucrosquamatus V65 trav BCNE02032468.1 1692 STGQSVKQTTGIVTVIAGESVFLNCSYEAQISSSSSTYWYIQQPGQPLKLLLTEYENDAQGFHATHDEGKKSGTFNSEKDASQLKDSAVYFCAFRE
Protobothrops mucrosquamatus V64 trav BCNE02032468.1 2974 QSVDQTSDIVTVPEGQSLSLRCSYEAQYSGINYPFWYIQHPGQPLEILLTKFDNKSQDFQASHYENKNKGTFNMQKQAIQLKDSAVYFCA
Protobothrops mucrosquamatus V63 trav BCNE02032468.1 5971 STGQSVKQTSGIVTVTGGQLVSLNCFYEKEFPVTNYLFWYIQNPGQPLQFLLASYLKNPQGFQATHVSHEHKKGTFNLQIHACQLEDSAVYFCASSE
Protobothrops mucrosquamatus V62 trav BCNE02032467.1 2157 QSVKQTSGILTVTEEQLVSLNCSYEGQFSGNFPFWYIQHPGQPLEILLDEIDNNAQGFQATHHKNDKKGTFSMQKTAIQLGDSAVYFCGFRE
Protobothrops mucrosquamatus V61 trav BCNE02032467.1 6390 QSVNQTSGIVTVPEGQYLSLSCSYEAEYSANNYPSWYIQHPGQPLEILLDEIDNKAPGFQATHNKTRKKGTFNMQKQAIQLEDSAVYFCAFSE
Protobothrops mucrosquamatus V60 trav BCNE02032466.1 1885 QSVKQKSDILTVAEGKHISLSCSYEVQFSSSTYRYTYWYIQHPGQPLKLLLSEYENYGQGFHATHHKGEKNGTYNLEKDASQLKDSAVYFCAFRE
Protobothrops mucrosquamatus V59 trbv BCNE02032466.1 5160 RSTGQTVKQTSGIVTVTEGKHLSLSCSYEVQFSSSTYQNTYWYIQHPGQPLKLLLTEYENYGQGFHATHHKREKNGTYNLEKDASQLKDTAVYFCAFRE
Protobothrops mucrosquamatus V58 trav BCNE02032465.1 1785 QSVDQTSGIVTITEGQSLSLSCSYEAQNSVMHYPFWYIQHPGQPLKILLTKFYKNVQGFQAAHYENDTKGTFNMQKQGIQLEDSAVYFCA
Protobothrops mucrosquamatus V129 ighv BCNE02110780.1 64 VQSQVQLVESGGDVRRPGESLRLSCQASGFDFSSYYMSWVRQAPEKGPEWVAFISTSSGTIYYSDTVKGRFTISRDNAKSQLYLQMNSLKAEDTAIYYCTG
Protobothrops mucrosquamatus V128 ighv BCNE02102532.1 1056 CHSEIQMIQSGGGIKAPGGSLTIVCKTSGFGFTNYYMSWVRKQPEKGLEWLCRIPSLGTNPWYNPAIVGRFIQTRDNAKASTTLQLNDLKLEDSAVYYCTR
Protobothrops mucrosquamatus V127 ighv BCNE02102211.1 2681 VQSQVQLVESGGDVRRPGGSLRLSCQASGFDFSSYWMSWVRQAPGKGLEWVASMGTSSTYYSDKVKGRFTIFRDDAKSQLYLQMNSLKAEDMAIYYCAR
Protobothrops mucrosquamatus V126 ighv BCNE02102210.1 2246 VQSQVQLVESGGDVRRPGESLRLSCQGSGFTFSSYYMDWVRQAPGKGLEWVARIGTSSSPIHYSDQVKGRFTISRDDSRSQLYLQMNNLKLEDTAVYYCAR
Protobothrops mucrosquamatus V125 ighv BCNE02102208.1 487 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMHWVRQAPGKGLEWVARIGTSSSPINYSDKVKGRFTISRDDSRSQLYLQMNNLKPEDTAVYYCPR
Protobothrops mucrosquamatus V124 ighv BCNE02102207.1 2387 VQSEVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMYWVRQAPGKGLEWVARIGTSSSPISYSDKVKGRFIISRDDSRSQLYLQMNNLKSEDTAVYYCTT
Protobothrops mucrosquamatus V123 ighv BCNE02101959.1 1634 IKCSVQLEQSGSYMKSPGDSLSISCKGSGFNFGSYGMHWVRQAPGKRKEWIAVIWYDASKQEYTESVKGRFTISRDNAKSLVYLQMNSLKPEDTAVYYCTR
Protobothrops mucrosquamatus V122 ighv BCNE02101959.1 3615 VRSEVLLVESGGDVRRPGGSLSLLCQTSGFNFNVFWMNWLRQYPGKDLEWVGRITTGSPPTAYYRDKVKGRFTMSRDDSHTRVYLQMNNLKPEDSAVYYC
Protobothrops mucrosquamatus V121 ighv BCNE02101953.1 1579 VQSQIQLLESGGDVRRPGESLRLSCQASGFTFSSYGMSWVRQAPGKGLEWVAVIWYDASKQLYAESVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V120 ighv BCNE02100642.1 694 LTQSGQVVKTPGETVSLTCVATGFDINSYFMDWIRQEPGKGLEWLVSYLTPAHNFYSPDIKGRLAASKSGSNFYLQMDRLKENDTATYYCTR
Protobothrops mucrosquamatus V119 ighv BCNE02091176.1 3319 LSVQQLKNLKDPELVAPGETVVLSCSYSAGTITDNSYPLWIQQKSEEVPRLLIYTTSTRASGTPARFSGSKSANTMSLIITESQVEDDATYYCVVWSGSG
Protobothrops mucrosquamatus V118 iglv BCNE02091176.1 9959 LSLQQLQSLKDPEFVAPGGTVTLSCRYDGGNLGDSHEPSWSQQVAGQQPRGLIYHTSSRLPGVPERFSGSRSGNVMSLTITGALVEDEATYYCSIWTSSQ
Protobothrops mucrosquamatus V117 iglv BCNE02091176.1 13209 IDSQPAWIQPPSSSVAPGGTITLLCTTDVANTIFWYQQKAGKGPRFVHCDGCSSRGEGIPNRFTATRSGTTGSLAITNAEPGDEADYYCGSWKSSV
Protobothrops mucrosquamatus V115 trgv BCNE02091175.1 6210 TSVQQLQSLKNSESVAIHGTVTMSCSYSGGTISDNNYLRWLQQKPGKVLKLLVATSNSRPTGVPARFTGTTSGNTMSLTIAGTLGEDEATYYCAVWTGSG
Protobothrops mucrosquamatus V114 iglv BCNE02091175.1 11602 SSIQQLQSLKDPDFVALAGTITISCRYDSGTITDSNYPVWVQQKSEQTPRLLIHSTSTRHTGVPARFSGSRSGNTMSLTITGTLVEDEAVYYCGVWTGSG
Protobothrops mucrosquamatus V113 iglv BCNE02091175.1 14984 LSLQQLQSLKDAESVPRGETVTISCRYSTGIITDNNYPWWAQQHPGKPPRLLLYQTSVKPSDVPARFSGSKSGNVMSLIITGALAEDEANYYCSLNPGGS
Protobothrops mucrosquamatus V112 iglv BCNE02091173.1 2755 ASIQQLQSLKDPDFVAPGGTITMSCRYDGGTITDNNYPQWIQQKSEQTPRPLIHSTSSRPSGVPARFSSSRSGNTMSLTITGALVEDEATYYCLVWIVDR
Protobothrops mucrosquamatus V111 iglv BCNE02091172.1 6734 ASAQFVLTQPASVTARLEEKVQISCTRSSGAMSGYYVSWYQQKSIEPPKLLIYQHMYRPADIPDRFSGATDSSRATLTINGVQSEDEADYYCQSYDSNWM
Protobothrops mucrosquamatus V110 ighv BCNE02085538.1 2236 ISSQITLTESGDGLKKPGDTLRLTCKVSGFAITSYGVSWIRQPPGKPLEWNGAIWSGGSTNYNSALQNRITITRDTSKNQVFLQLTSLKPEDTATYYCAR
Protobothrops mucrosquamatus V109 ighv BCNE02085533.1 5575 ISSQITLTESGDGLKKPGDTLRLTCTVSGFAITSYGVSWIRQPPGKALEWNGVIWDDGSTDYNSALKNRITITRDTSKNQVFLQLTGLKPEDTGTYYCAG
Protobothrops mucrosquamatus V108 trbv BCNE02079074.1 3362 VFSDIQLVESGPGMVRPGSQLNLVCKVTGFSIATSSSYAWHWIRQPNGKGLEWLSAINVNSGSKWYGNSVKSRATISADQSRNEFSLQLNSVLAADSSVYFCARE
Protobothrops mucrosquamatus V107 ighv BCNE02079074.1 5227 GLSQVVLTQSDPVLKKPGEAHKLTCAATGFDVNSYFMYWIRQKPGQGLEWLVYYYDSSDNAYSPTIQGRFTASKDSSNFYLQMKNLKAEDTAVYYCAR
Protobothrops mucrosquamatus V106 ighv BCNE02079074.1 7319 GFSQVVLTQSDPVLKKPGESHKLTCAVTGFNVNSYYMGWIRQKPGQGLEWLVYYYSSTNNYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Protobothrops mucrosquamatus V105 ighv BCNE02079073.1 2767 LTQSDPVLKKPGESHKLTCAVTGFNINSYYMDWIRQKPGQGLEWLVHYYSPSSNYYSPTIQGHFAASKDSSNFYLQMNNLKAEDTAVYYCTR
Protobothrops mucrosquamatus V104 ighv BCNE02079073.1 3615 CYSEVKLVETGGGVVVPGGSLRLICKASGFKFTDHAMDWIRQSSGKGLEWVATVSKPEGTSQWYNSKVEGRFTVSRDNSQTSAYLQMNDLKPEDSALYYCAR
Protobothrops mucrosquamatus V103 ighv BCNE02079073.1 6869 GLSQVALTQSDPVLKKPGESHKLTCAVTGFNINSYNMYWIRQKPGQGLEWIVYYYSPSSNAYSPTIQGRFTASKDSSNFYLQMNNLKAEDSTVYYCAR
Protobothrops mucrosquamatus V102 ighv BCNE02079072.1 447 SLSQIVLTQSDLVLKKPGEAHKLTCAVTGFNVNGYWMGWIRQKRGQGLEWLVNYYDPSNTIFYSPTIKGRFTPSKDSSNFYLQMNNLKTEDTAVYYCAR
Protobothrops mucrosquamatus V101 ighv BCNE02079072.1 2056 GLSQKVLTQSDPVLKKPGEAHKLTCSVTGFNIHSYGMDWVRQKLGQKLEWIVYHHTASSNFYSPTIQGRFTSSKDNSNFYLQMNNLKVEDTAIYYCAGE
Protobothrops mucrosquamatus V100 ighv BCNE02079071.1 2437 SLSQIILTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMGWIRQKPGQGLEWLVYYYDPSNTIFYSPTIQGRFTPSKDSSNFYLQMNNLKTEDTAVYYCAR
Protobothrops mucrosquamatus V99 ighv BCNE02079071.1 4074 LTQSDPVLKKPGEAHKLICSVTGFNIHSYGMDWVRQKLGQRLEWIVYHHTASSNFYSPTIQGRFTSSKDNSNFYLQMKNLKLEDTAIYYCVGE
Protobothrops mucrosquamatus V98 trdv BCNE02079069.1 3794 SLSQIILTQSDPVLKKPGEAHKLTCAVSGFNVNHYWMDWIRQKPGQGLEWLVHYYDPKNTIYYSPTIQGRFTPSKDSSNFYLQMNNLKAEDSALYYCAR
Protobothrops mucrosquamatus V97 ighv BCNE02079068.1 1484 VQLIKLEESGGAVRRPGESLHLSCQASGFTFSSYWMEWVRQYPGKGLEWVARISTGSSSTYYPNNVKGRFIISRDDSNSLLYLQMNNLKPEDTAVYYCAR
Protobothrops mucrosquamatus V96 ighv BCNE02079068.1 5078 LTQSGQVVKTPGETVSLTCVATGFDINSYFMDWIRQEPGKGLEWLVSYLTPAHNFYSPDIKGRFAASKSGSNFYLQMDRLKENDTATYYCTR
Protobothrops mucrosquamatus V95 trgv BCNE02079068.1 7661 CYSQIELVETGGGFVAPGGSLRLSCKASGFTMGSNEMHWIRRAPKKGLEWVGGTSGSGGSQWYNPKVIGRCIISVDVSQSFVYLQMNSVKLEDAAWYYCTR
Protobothrops mucrosquamatus V94 ighv BCNE02079068.1 11952 CNSAVQLLENGGGVVTPGGSLHLSCKASGFNFAGYSMAWFREAHEKGLEWVASIHSNGANQWYNSKVNGRFTIYRDNFQSVLYLRMSSLKAEDCALYYCVT
Protobothrops mucrosquamatus V136 ighv BCNE02138391.1 1357 VRSEVLLVESGGDVRSPGGSLRLTCQASGFTFSSYYMSWVRQAPGKGLEWVAYIGTSSTPIYYSDTVKGRFTISRDDAKSQMYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V135 ighv BCNE02126401.1 167 ISSQITLTESGDGLKKPGDTLRLTCTVSGFAITSYGVHWIRQPPGKPLEWNGVIWGGGSTQYNSALQNRITITRDTSKNQVFLQLTGLKTEDTGTYYCAG
Protobothrops mucrosquamatus V134 ighv BCNE02124452.1 371 VQSQVQFVESGGDLRRPGGSLRLSCQASGFTFSSYHMGWVRQVPGKGLEWVAYINPGSSGTYYSEKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCTR
Protobothrops mucrosquamatus V133 iglv BCNE02124035.1 1162 VTSQPTLTQPVSQSGSPAGTVKITCAISSNPYTVGWIQQRSGEGPRFVHCDGCSSRGPGIPDRFTGTRSGNNGYLTITNLQPEDEADYY
Protobothrops mucrosquamatus V132 ighv BCNE02112296.1 760 VQSQGQLVESGGDVRRPGESLRLSCQGSGYNFGGYSMDWVRQAPGKALEWVAHIYHDSSGKIYSDKVKGHFTVSRDNAKSQLYLQMNTLKAEDTAVYYCAR
Protobothrops mucrosquamatus V131 ighv BCNE02112295.1 374 VQSQVQFVESGGDLRRPGGSLHLSCQASGFTFSSYHMGWVRQVPGKGLEWVAYINPGSSGTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAIYYCTR
Protobothrops mucrosquamatus V137 iglv BCNE02152042.1 214 SFAQYVLTQPSSVSVSLGQNERITCSGSDIGEKNVHWYQQKPGNPPVLIIYADSSRPTGISDRFSGTNSGNTATLSISRAQAQDEADYYCQVWDSSQ
Protobothrops mucrosquamatus V130 ighv BCNE02110781.1 1514 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSGYWMGWVRQAPGKGLEWVASMGTSSTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Protobothrops mucrosquamatus V116 iglv BCNE02091175.1 1877 ASIQQLQSLKDPDFVAPGGAITMSCRYDDGTITDNNYPRWIQQKSEQAPRLLIHSTSSRPSGIPARFSGSRSGNTMSLTITEALVEDEATYYCLVWTGN
Protobothrops mucrosquamatus V93 ighv BCNE02079068.1 13802 CHSQVQLVETGGGIVVPGGFLHLTCKTSGFNFVSAYMDWVRQAPEKGLEWIARISDSGSSKLYNSKVTGRFTISRDNSQNSLYLQMNSLKPEDSAFYYCAT
Protobothrops mucrosquamatus V57 trav BCNE02032464.1 1042 PSAEDAVEQITGTLSVSEGNPFSIQCSYEADWSVTNDPFWYIQFPGQTPRFFLSENKGHNQGFQASHILGENKRQGTFNLNKATSQLNDSAFYLCA
Protobothrops mucrosquamatus V56 trav BCNE02032464.1 8124 QSVDQTSGIVAAIEGQHVFLYCSYEAQTIGSYYPYWYIQHPGQPLKFLLGSYENNPQGFQATHHKDKKNGTFNLQKDSSQLKDSAAYFCAFN
Protobothrops mucrosquamatus V46 ighv BCNE02134514.1 1094 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSSWMVWVRQAPGKGLEWVARIGTSSSPIQYSDQVKGRFTISRDDSRSQLYLQMNSLKSEDTAVYYCAR
Protobothrops mucrosquamatus V16 ighv BCNE02080404.1 13286 AQSQVQLVESGGDLRRPGESIRISCQASGFTFSSSWMYWMRQAPGKGLEWVSHINPSSSNIFYSDKVKGRFTISRDNAKSQLYLQMNSVKSEDTAVYHCMA