WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Nasalis larvatus JMHX00000000.1 (JMHX01) 156 11 25 38 36 36 6 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Nasalis larvatus V19 trav JMHX01160255.1 1747 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQHPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Nasalis larvatus V43 trbv JMHX01260597.1 492 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEVIDKGDIPEGYNVSRKEKTNFPLILESPSPSQTSLYLCASSL
Nasalis larvatus V50 iglv JMHX01279241.1 308 SWAQSVLTHLPSVSGSPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGACLDFSSLVIVTDPQESLIDFSGFKSGNLASLTITGLWPEDEADYHCQS
Nasalis larvatus V90 trav JMHX01319530.1 32939703 MMTGTIETTGNISAKKGGSVLLQCHLSSTMAQVTQVSWEQQDQLLAICNADLGWHISPAFKDRVAPGPGLDLTLQSLTMNDTGEYFCIYHTYPDGT
Nasalis larvatus V115 trgv JMHX01319531.1 80301408 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISSGKYDTYVSTRRNLRLRVRNLIENDSGVYYCANWD
Nasalis larvatus V116 trgv JMHX01319531.1 80305763 SQKSSNLEGRTKSVTRPTGSSAEITCDFSGDSNLYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLSLGKYYTHTRTRWSWILILRSLIENDSGVYFCANWD
Nasalis larvatus V117 trgv JMHX01319531.1 80328839 RLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCVLYDGTVRKESSIPSGKFEVDRIPKMSTSTLTIHNVEKQDIATYYCALWE
Nasalis larvatus V118 trgv JMHX01319531.1 80345321 GLGLSKVEQFQLSVSTEVKKSIDIPCKIRSTNFANDVIHWYWQKPNQALEHLIYIISTKSAVQGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWV
Nasalis larvatus V119 trgv JMHX01319531.1 80363857 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFQKNVCIHWYHQKPDEPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Nasalis larvatus V120 trgv JMHX01319531.1 80365870 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTIVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Nasalis larvatus V130 trbv JMHX01319531.1 164936949 HTEPEVTQTPSHQVTQMGQEVILQCVPISNHLYFYWYRQILGQKVEFLVIFFNNNISEKSEIFDDRFSVERPDGVHFTLKIKSTKLEDSAMYFCASSE
Nasalis larvatus V131 trbv JMHX01319531.1 164940008 HTEPEVTQTPSHQVTQMGQEVILQCVPISNHLYFYWYRQILGQKVEFLVIFFNNNISEKSEIFDDRFSVERPDGVHFTLKIKSTKLEDSAMYFCASSE
Nasalis larvatus V132 trbv JMHX01319531.1 164952986 HTEPEVTQTPSHQVTRMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVIFFNNNISERSEIFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Nasalis larvatus V133 trbv JMHX01319531.1 164982463 PANAGVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSVAENTTDKGEVPDGYSVSRLNKKDFLLRLESAAPSQTSVYFCASSE
Nasalis larvatus V134 trbv JMHX01319531.1 165050196 SVDSGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGKERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Nasalis larvatus V135 trbv JMHX01319531.1 165057533 HRDAEIIQSPRHKITETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Nasalis larvatus V136 trbv JMHX01319531.1 165080395 HRDARITQSPRYKVTETGRQVTLTCHQTWSHNNMFWYRQDLGHGLRLIYYSAGAGITDKGEVPDGYVVSRSKTEDFPLTLESATRSQTSVYFCASSE
Nasalis larvatus V137 trbv JMHX01319531.1 165088763 LREAGVAQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGPELLVQFQNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAKLGDSAVYLCASSL
Nasalis larvatus V138 trbv JMHX01319531.1 165106231 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMYWYRQDPGVGLRLIHYSVGAGITDKGEVSNGYDVSRSNTEDFPLRLESAAPSQTSVYFCASSY
Nasalis larvatus V139 trbv JMHX01319531.1 165131331 HTGAGVLQSPRYRVTKRGQNVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFWNDAQQDKSGLPSGRFSAERPEGSVSTLKIQPTQQGDSAVYLCASSL
Nasalis larvatus V140 trbv JMHX01319531.1 165143255 HTGAGVSQSPRYKVSKRGQEVALRCDPISGHAALYWYQQALGQGPELLTYFSYEAQQDKSGLLSDRFSAERPEGSFSTLTIERTEQGDSAVYLCASSL
Nasalis larvatus V141 trbv JMHX01319531.1 165151196 PVDTEVTQSPTHLIKTRGQQVTLRCSPISGHSSVYWHQQTLGQGPQLIFKYDRKEERGRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Nasalis larvatus V142 trbv JMHX01319531.1 165190662 HTGAGVSQSPRYKVTKRGQDVTLRCDPISGHEYIYWYQQVPGQGPEFLTYFQNDAQLDKSGLPSDRFSAERPEGSVSTLKIQPTQQGDSAVYLCASSL
Nasalis larvatus V143 trbv JMHX01319531.1 165197938 PVDTGVTQSPTHLIKTRGQQVILRCSPISGHSSVSWYQQALGQGPQFIFEYYKEEERERGNFPERFSSRQFPNYSSELNVNTLEMGDSALYLCASSL
Nasalis larvatus V144 trbv JMHX01319531.1 165205671 PGNADVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRLNTEDFPLRLELAALSQTSVYFCASS
Nasalis larvatus V145 trbv JMHX01319531.1 165218258 SVDAGVTQSPTHLIKTRGEQVTPRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSGLQFPNYSSELNVNALLLGDSALYLCASSL
Nasalis larvatus V146 trbv JMHX01319531.1 165225541 PVNAGVTQTPKFQVLKTGQSMTVQCAQDMNHDYMYWYRQDPGMGLRLIYYSVTAGITTKGEVSNGYNVSRINTEDFLLRLESAAPSQTSVYFCASSY
Nasalis larvatus V147 trbv JMHX01319531.1 165253410 SVAAGVIQAPRHLIKVKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSELNMSSLELEDSALYLCASSL
Nasalis larvatus V148 trbv JMHX01319531.1 165261295 HVDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGHGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATHSQTSVYLCASSE
Nasalis larvatus V149 trbv JMHX01319531.1 165272285 LTEAGVTQSPKYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENKEAIDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Nasalis larvatus V150 trbv JMHX01319531.1 165276981 HTDAGVIQSPRHEVTEMRKEVTLRCEPISGHSSLFWYRQTMMWGLELLIYFNNKAAIDDSGMPKDQFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Nasalis larvatus V151 trbv JMHX01319531.1 165280267 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLRIQPSEPRDSAVYFCASSL
Nasalis larvatus V152 trbv JMHX01319531.1 165289218 HTDAGVIQSPRHEVTEMRKEVTLRCEPISGHSSLFWYRQTMMWGLELLIYFNNKAAIDDSGMPKDQFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Nasalis larvatus V153 trbv JMHX01319531.1 165292504 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLRIQPSEPRDSAVYFCASSL
Nasalis larvatus V154 trbv JMHX01319531.1 165330169 DSGLGAVISQSPSRVICRRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSSVTYEQGIKKDKFPINHPDLTFSTLTVTNAHPEDSSFYICSAR
Nasalis larvatus V155 trbv JMHX01319531.1 165342096 SMDADVTQTPRNMIAKTGKKIMLECSQTKRHDQMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQEQAQFSLSLESATPNQTALYFCATSD
Nasalis larvatus V156 trbv JMHX01319531.1 165355841 SMDADVTQTPRNMIAKTGKKIMLECSQTKRHDQMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQEQAQFSLSLESATPNQTALYFCATSD
Nasalis larvatus V157 trbv JMHX01319531.1 165369217 SMDADVTQTPRNMIAKTGKKIMLECSQTKRHDQMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQEQAQFSLSLESATPNQTALYFCATSD
Nasalis larvatus V158 trbv JMHX01319531.1 165435656 SVFSALVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYEGGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Nasalis larvatus V219 trav JMHX01319535.1 77114978 MCLVLGTTGQNIDQPTEMTAMAGAIVQINCTYKTSGFNGLSWYQQHDGEAPTLLFYNVLDGLEEKGRFSSFLSNSKGYSYLLLKELQMKDSASYLCAVR
Nasalis larvatus V220 trav JMHX01319535.1 77224142 MSRGEDVEQSLFLSVREGDISVINCTYKDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKQDQRLTVLLNKKDKHLSLRIADTQTRDSAIYFCAES
Nasalis larvatus V221 trav JMHX01319535.1 77232608 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Nasalis larvatus V222 trav JMHX01319535.1 77265062 EINGDSVVEREGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKALMANDKESNKGFEATYHKETTSFHLKKDSVQESDSAVYFCALS
Nasalis larvatus V223 trav JMHX01319535.1 77278285 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPISLTIMTFSENTKLNGRYTATLDADTKQSSLHITATQLSDSASYICVVS
Nasalis larvatus V224 trav JMHX01319535.1 77286521 EINGDSVVEREGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKALMANDKESNKGFEATYHKETTSFHLKKDSVQESDSAVYFCALS
Nasalis larvatus V225 trav JMHX01319535.1 77299744 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPISLTIMTFSENTKLNGRYTATLDADTKQSSLHITATQLSDSASYICVVS
Nasalis larvatus V226 trav JMHX01319535.1 77337418 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAVG
Nasalis larvatus V227 trav JMHX01319535.1 77351305 VSRRESVGLHLPTVSVQEGDNSVINCTYSDSVSDYFLWYKQESGKGPQFIIDIRSNMAKRQGQRLTVLLNKTVKHLSLQIAATEPGDSAVYFCAEN
Nasalis larvatus V228 trdv JMHX01319535.1 77357168 SGIAQKITQTQPAMFMQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLIRQESYDKQNATEGRYSLNFQKARKSINLVISASQVGDSAMYFCAMR
Nasalis larvatus V229 trav JMHX01319535.1 77367531 RTRGDSVTQMQGPVTLSERAFLTINCTYTATGYPYLFWYVQYPGEGPQLLLKAAKDDDKGSNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Nasalis larvatus V230 trav JMHX01319535.1 77395240 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Nasalis larvatus V231 trav JMHX01319535.1 77407774 GTRAQSVTQLDSQVSVSEEAPVLLRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISNTAEYFCAVS
Nasalis larvatus V232 trav JMHX01319535.1 77419616 GARAQSVTQPEKLLSVFKGAPVELKCNYSYSGSPDLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSETSFHLKKLFAQEEDSAMYYCALS
Nasalis larvatus V233 trav JMHX01319535.1 77429022 VNSQQGEEDPQALSIQEGENATVNCSYKTSIDNLQWYRQDSGRSLVQLILIRSNEREKSSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Nasalis larvatus V234 trav JMHX01319535.1 77434943 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFMFWYVQYLNKEPELLLKSSENQETDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Nasalis larvatus V235 trav JMHX01319535.1 77438159 SSMAQKVTQAQTEISVVEKEDVNLDCVYETRDSTYYLFWYKQPPSGELIFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Nasalis larvatus V236 trav JMHX01319535.1 77473779 LSGEDQVTQSPEALRLQEGENGSLNCSYTVSSLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Nasalis larvatus V237 trav JMHX01319535.1 77480357 VSSKQEVTQIPAALSVPEGYNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSRHSTLYITASEPGDSATYLCAV
Nasalis larvatus V238 trav JMHX01319535.1 77506957 VIGIQVEQSPPDLILQEGANSTLRCNYSATVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTSERYSLLYISSSQTTDSGIYFCAVEPQYSP
Nasalis larvatus V239 trav JMHX01319535.1 77548166 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIVLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Nasalis larvatus V240 trdv JMHX01319535.1 77616855 FSMAQKVTQAQSSVSMPVGKAVTLNCQYETSSWLYLIFWYKQLPGKEMIFLIRQGSSEQNAKNGRYSVNFKKAASSITLTISALQLLDSATYFCALRE
Nasalis larvatus V241 trav JMHX01319535.1 77626069 VSSILNVEQSPQSLSVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPRALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Nasalis larvatus V242 trav JMHX01319535.1 77643952 TIIDAKATQPTSMDCAEGRAANLPCNHSTISGNEYIYWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Nasalis larvatus V243 trav JMHX01319535.1 77658329 VSTQQLEQSPRFLSIQEGENFTAYCNSSSALTSLQWYRQDPGEGPVLLVTVVAGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Nasalis larvatus V244 trav JMHX01319535.1 77677043 VRSQKPVQGPQAVILQEGEDAIINCNSSKALYSVHWYRQKHGEVPVFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGVE
Nasalis larvatus V245 trav JMHX01319535.1 77711688 VRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQLPSQGPEYVIHGLTSNVNNRMVSLTIAEDRKSSTLILHHATLRDAAVYYCILR
Nasalis larvatus V246 trav JMHX01319535.1 77716423 VSSQELEQSPQSLIIQEGKNLTINCTSSETLYGLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Nasalis larvatus V247 trav JMHX01319535.1 77729503 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNNLLWYKQDPGEGPVLLIALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Nasalis larvatus V248 trav JMHX01319535.1 77734299 VSSEDKVVQNPLSLVVHEGDTVTLNCSYEVINFRSLLWYKQEKKAPTFLFMLTSSGFDKKKGRLSGILDKKELFSILNITATQTRDSAVYLCAVE
Nasalis larvatus V249 trav JMHX01319535.1 77743912 SGRADWIEPQETEVSATEGKTVNLLCNYGTSSGSYLDLYWFRQYLSQAPEYILYRGWGYSGKGDANFAIGKFYSKSTANATNLYIRNLVPADTALYYCVL
Nasalis larvatus V250 trav JMHX01319535.1 77770373 SGMAQTVTQSQPEMSVQEAETVTLNCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Nasalis larvatus V251 trav JMHX01319535.1 77779178 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAASYFCAYR
Nasalis larvatus V252 trav JMHX01319535.1 77802870 LSGELKVGQNPLFLSTQEGKNYTVYCNYSTALDRLYWYRQNPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLYITAALQDLSATYFCAV
Nasalis larvatus V253 trav JMHX01319535.1 77819606 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINALHWLQQHPGRGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Nasalis larvatus V254 trdv JMHX01319535.1 77925255 VMSAIELVPEYQTVIVSVGNPATLRCSMKGEAISNYYINWYRKTQDNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Nasalis larvatus V316 iglv JMHX01319539.1 59968289 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Nasalis larvatus V317 iglv JMHX01319539.1 59988650 SWAEVVFTQPYSVSGSPGQTVTISCTRSSGSIDSKYVYWYQERPGSDPTTVIYNDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSAADSYN
Nasalis larvatus V318 iglv JMHX01319539.1 60047335 SLSQPVLTQPPSLSASLGASARLTCTLSSDISVGGKIVYWYQQKPGSNLRYLLSYYSESSKHQGSGVPSRFSGSKDASTNLGILHISGLQPEDEADYYCKIWHD
Nasalis larvatus V319 iglv JMHX01319539.1 60055202 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQPEKAPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWATG
Nasalis larvatus V320 iglv JMHX01319539.1 60196500 SWAEVVFTQPYSVSGSPGQTVTISCTRSSGSIDSEYVHWYQQRPGSAPTTVIYNDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSAADSYN
Nasalis larvatus V321 iglv JMHX01319539.1 60263857 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYEVEWHQQRPGKGPQFVMRVGIGGIVGSEGDGIPDRFLGSGSGLNRYLTIKNIQEEDESDYHCGA
Nasalis larvatus V322 iglv JMHX01319539.1 60274480 SWAQSVLTQPLSASGTPGQSVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDSSLSD
Nasalis larvatus V323 iglv JMHX01319539.1 60292278 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRFEDEADYYCEAWDDSLST
Nasalis larvatus V324 iglv JMHX01319539.1 60307287 SLSQPVLTQPTSLSASPGASARLTCTLRSGINVGSYRIFWYQQKPGSPPQYLLWYKSDSDKHQGSGVPSHFSGSKDASANAGILLISELQSEDEADYYCTI
Nasalis larvatus V325 iglv JMHX01319539.1 60312416 SWAQSVLTQPPSASGAPGQTVTISCSGSSSNIRSNYVSWYRQLPGMAPKLLISYDDELASGVSDRFSGSKSGTSASLAISGLKSEDEADYYCAAWDDSLSG
Nasalis larvatus V326 iglv JMHX01319539.1 60342366 SWTQSVLTQPPSVSADPGQKVTISCSGSSSNIGRSYVSWYQQLPGTAPKLLIYESNKRPSGISDRFSGSKSGTSASLGITGLQTGDEADYYCSAWITA
Nasalis larvatus V327 iglv JMHX01319539.1 60355341 SWAQSVLTQPPSVSGTPGQKVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLQSEDEADYYCQSYDSSLN
Nasalis larvatus V328 iglv JMHX01319539.1 60359693 SWAQSVLTQPPSVSGTPGQKVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLQSEDEADYYCQSYDSSLN
Nasalis larvatus V329 iglv JMHX01319539.1 60379714 SLSQPVLTQPPSFSASPGESARLTCTLSSDISVGSYNIYWYQQKPGSPPRYLLSYYSDSDKHQGSGVPSHFSGSKDASANTGILLISGLQSEDEADYYCMI
Nasalis larvatus V330 iglv JMHX01319539.1 60384284 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNNQRPSGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLNA
Nasalis larvatus V331 iglv JMHX01319539.1 60676971 SVASYELTQPPSVSVSPGRTARITCSGDVLKENYADWYQQKPGQAPVLVIYEDSKRPSGIPERLSGSTSGDTNTLTISSSLSEDEADYYCFSGNENN
Nasalis larvatus V332 iglv JMHX01319539.1 60690270 SAASYDVTQPQSVSVSPGQTARITCGGENIGSKVVHWYQQKPEQAPVLVIYDDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Nasalis larvatus V333 iglv JMHX01319539.1 60712090 SWAQSALTQPHSVSGSPGQSVTISCTGTSSDISGYNRVSWYQQHPGTAPRLLIYSVSNWPSGISERFSGSKSGNTASLTISGLQAEDKADYYCCSYTTS
Nasalis larvatus V334 iglv JMHX01319539.1 60753174 SWAQSALTQPRSVSGSPGQSVTVSCTGTSNDVGSYNSVSWYQQHPGKAPKLVIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGT
Nasalis larvatus V335 iglv JMHX01319539.1 60776818 SAASYELTQPPSVSVSPGQTARITCSGDTLPDNYAYWFQQKPGQSPVLIIYEDSKWPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSSDSSGN
Nasalis larvatus V336 iglv JMHX01319539.1 60787599 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDFGGYNYVSWYQRHPGTALKLVIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYSSSYY
Nasalis larvatus V337 iglv JMHX01319539.1 60826934 LCALPVLTQAPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPQYIMKVNSDGTHSKGGGIPNRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Nasalis larvatus V338 iglv JMHX01319539.1 60836337 SWAQSALTQPHSVSGSSGQLVTISCTGTSSDVGSYNIVSWYQQHPGTGPQLMIYHVSYRPSGVPDRFSGSKSGNTASMTISGFQVEEEADYYCYS
Nasalis larvatus V370 igkv JMHX01319542.1 82067995 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDMAVYYCQQYY
Nasalis larvatus V371 igkv JMHX01319542.1 82138234 AKCDVQLTQSPTFLSASVGDRVTIACRASQSINKGLAWYQQKPGKAPKLLISYASSLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Nasalis larvatus V372 igkv JMHX01319542.1 82155679 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDMFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQI
Nasalis larvatus V373 igkv JMHX01319542.1 82173850 TAGQVILTQSPATLSLSAGEIATLSCRASQSVNRYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLIISSLEPEDVGVYHCYQYNSGY
Nasalis larvatus V374 igkv JMHX01319542.1 82187642 TAGQVILTQSPATLSLSAGEIATLSCRASQSVNRYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLIISSLEPEDVGVYHCYQYNSGY
Nasalis larvatus V375 igkv JMHX01319542.1 104108308 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFDSDDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Nasalis larvatus V376 igkv JMHX01319542.1 104146167 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYATP
Nasalis larvatus V377 igkv JMHX01319542.1 104164577 SSGDIVMTHTPLSLPITPGEPASISCRSSQSLMDSDDGFTYLYWYLQKPSQSPQLLMHFASYQASGVPDRFSGSGPGTDFTLEISKVEAEDIGVYYCMQALELP
Nasalis larvatus V378 igkv JMHX01319542.1 104225719 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVSDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALELL
Nasalis larvatus V379 igkv JMHX01319542.1 104253552 ARCDIQMTQSPSSLSASVGDRVTITCQVSQGISNNLNWYQQKPEKTPKLLIYAASGLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSY
Nasalis larvatus V380 igkv JMHX01319542.1 104274666 ARCDIQMTQSPSSLSASAGDRVTISCRASQNVYSNLAWYQQKPGKAPKLLIYAASSLQSGSPSQFSGSGSGTDFTLTISSLQHNDSATYYCQHYYSTP
Nasalis larvatus V381 igkv JMHX01319542.1 104337246 ARCDIQMTHSPSSLSASVGDRVTITCQASQGISSYLAWYQQKLGETPKLLIYDASSLQSGIPSRFSGSGSGTDFTLTISSLLPEDFATYYCQHYYSAP
Nasalis larvatus V382 igkv JMHX01319542.1 104359746 ARCDIQMTQSLSSLSASVGDRVTISCQASQKICSNLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHGYITP
Nasalis larvatus V383 igkv JMHX01319542.1 104374271 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGESPKLLIYEASSLQSGIPSWFSGSGSGTDFTFTISSLQPKDFATYYCQHYYSTP
Nasalis larvatus V384 igkv JMHX01319542.1 104386945 SRGDIMMTQTPLSLPITLGEPVSISCRSSQSLLDSDDKNTYLDWYLQKPGQSPQPLIYFVSSRASGVPDRFSGSGSGSDFTLKISRVEAEDVGVYYCMQCIELI
Nasalis larvatus V385 igkv JMHX01319542.1 104412926 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGRTYLYWYLQKPGQSPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Nasalis larvatus V386 igkv JMHX01319542.1 104457510 ARCNIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYYTSNLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNSP
Nasalis larvatus V387 igkv JMHX01319542.1 104461246 ARCNIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYYTSNLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNSP
Nasalis larvatus V388 igkv JMHX01319542.1 104464820 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQ
Nasalis larvatus V471 trbv JMHX01045128.1 590 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFSYDYEKLSLNESVPSRFSPECSKSSLLYLHIHALQPEDSALYLCASSQ
Nasalis larvatus V479 trbv JMHX01090223.1 612 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKERFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Nasalis larvatus V484 trbv JMHX01148947.1 1505 HGDVMVIQNPRYQVTQSGKPVTLSCFQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Nasalis larvatus V487 trbv JMHX01165128.1 408 SPGEEVTQTPKHLVKGEGQKAKLYCAPITGHSYVFWYQQVLKKEFKFLISFQNEDVVDETRMPKERFSAKCPRNSPCSLEIQATKLKDSATYFCASSQ
Nasalis larvatus V495 trbv JMHX01212265.1 345 STDTKVTQRPRLLVKANEQKAKMDCVPIKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Nasalis larvatus V507 iglv JMHX01290354.1 457 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTISNYTDWFQQQPNQVPRGLTGDNTYRNPNVPEWFSGSLSAGKAIFTTTGAQPEDEAFYYCALW
Nasalis larvatus V562 trbv JMHX01319531.1 165610593 VRSQTVHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGVGQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Nasalis larvatus V612 ighv JMHX01319535.1 153811545 VLSQVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIAHIYGSSESTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCTR
Nasalis larvatus V613 ighv JMHX01319535.1 153756262 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Nasalis larvatus V614 ighv JMHX01319535.1 153736413 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQAPGKGLEWVSYISSASGSTIYYADSVKGRFTISRDNAENSLSLQMNSLRAEDTAVYYCAR
Nasalis larvatus V615 ighv JMHX01319535.1 153731422 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVAVIWYDGSKTYYADSVKDRFTISRDNSKNMLYLQMNNLRDEDTAVYYCAK
Nasalis larvatus V616 ighv JMHX01319535.1 153668149 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSFSDYAMHWVRQASGKGLEWIGRIRSKSNNYATDYAASVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Nasalis larvatus V617 ighv JMHX01319535.1 153662296 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSFSDYAMHWVRQASGKGLEWIGRIRSKSNNYATDYAASVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Nasalis larvatus V618 ighv JMHX01319535.1 153596077 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMGWVRQAPGKGLEWVGRIKKTTDGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Nasalis larvatus V619 ighv JMHX01319535.1 153555594 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSSTKMNWIRQAPRKRLEWVADIKYDGSEKNYVDSVKGRFTISRDNTKNSLYLQMNSLRAEDTAVYYCVR
Nasalis larvatus V620 ighv JMHX01319535.1 153477197 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTTGMGVSWIRQPPGKALEWLASIDWDDDKYYSPSLKSRLTISKDTSRNQVVLTMTNMDPVDTATYYCAQG
Nasalis larvatus V621 ighv JMHX01319535.1 153460536 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPSGDTYYADAVKGRFTISRDNTKNSLYLQMNSLRAEDTAVYYCAR
Nasalis larvatus V622 ighv JMHX01319535.1 153347559 VLSQVQLQESGPELVKPSQTLSLTCAISGDSVSSNSAAWNWIRQLPSRGLEWLGRTYYRSKWYNDYALSVQSRITINPDTSKNQFSLQLSSVTPEDTAMYYCAR
Nasalis larvatus V627 trdv JMHX01319535.1 77972334 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDNTYSNPYLFWYRIRPDYNFQFVFYGDKSRSQGAYFTQGRFSVKHLLTQKAFHLVISPVRTEDSATYYCAM
Nasalis larvatus V683 igkv JMHX01319539.1 55498797 ISGDIVMTQTPLSLPVTPGEPASISCRSSQSLFDSDDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Nasalis larvatus V684 igkv JMHX01319539.1 55487981 ARCDIQMTQSPSSLSASAGDRVTISCRASQNVYSNLAWYQQKPGKAPKLLIYAASSLQSGSPSQFSGSGSGTDFTLTISSLQHNDSATYYCQHYYSTP
Nasalis larvatus V687 trav JMHX01319539.1 31636634 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Nasalis larvatus V721 igkv JMHX01319542.1 104058730 SGDIILNQTPASLTAPLGETVSISCQASADVHGEISWIQIKLGQRLEPLISHVTTLAPGVPARYSSEGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Nasalis larvatus V722 igkv JMHX01319542.1 82857767 SSGDAVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGNTYLNWFQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQA
Nasalis larvatus V723 igkv JMHX01319542.1 82823115 SSGDIVMTQTPLSLPITIGEPASISCRSSQSLLSSNGYNYLSWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Nasalis larvatus V724 igkv JMHX01319542.1 82814863 TRCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPRKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKCDSAP
Nasalis larvatus V725 igkv JMHX01319542.1 82779274 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPERFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Nasalis larvatus V726 igkv JMHX01319542.1 82762860 SKGEIVLTQSPAFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Nasalis larvatus V727 igkv JMHX01319542.1 82733653 TTGEIVLTQSPAILSLSPGERATFSCRASQSIGSNLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Nasalis larvatus V728 igkv JMHX01319542.1 82728157 VRCDIQMTQSPSFLSASVEDTVTVTCQVSQSISNDLAWYQPKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Nasalis larvatus V729 igkv JMHX01319542.1 82683313 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQSPQLLIYGSSNHFAGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQGIQFP
Nasalis larvatus V730 igkv JMHX01319542.1 82668401 SKGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLLIQYASQPISGVPSRFSGSGSGTDFTFTISSLEVEDAATYYCQQGN
Nasalis larvatus V731 igkv JMHX01319542.1 82655522 VRCDIQMTQSPSSLSASVGDSVTITCRASQSFSSLAWYQQKLGKAPKLLIYGASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDVAAYYCQQYYSYP
Nasalis larvatus V732 igkv JMHX01319542.1 82529246 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTDFSLTISNLQPEDFATYYCLQYNSAP
Nasalis larvatus V733 igkv JMHX01319542.1 82504392 TTGEIVMTQSPATLSLSPGERATLSCRTSQSVGSNLAWYQQKPGQAPRLLIYGASSRATGIPVRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDSNWP
Nasalis larvatus V734 igkv JMHX01319542.1 82446526 ARCDIQMSQSPSSLSASVGDRVTITCQASQGISNALAWYQQKPGKAPKLLIYDASSLDSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSAP
Nasalis larvatus V735 igkv JMHX01319542.1 82434945 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTEFILTISSLQPEDFAAYYCQQHN
Nasalis larvatus V736 igkv JMHX01319542.1 82315768 ARCDIQMTQSPSSLSASVGDTVTITCHASQGISSWLAWYQQKPGKAPTLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQDSSSP
Nasalis larvatus V737 igkv JMHX01319542.1 82283020 TTGEIVMMQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSGTEFTLTISSLEPEDFAVYFCQQYSNWN