WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pantherophis guttatus JTLQ00000000.1 (JTLQ01) 72 42 10 2 12 2 2 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pantherophis guttatus V35 ighv JTLQ01085495.1 3750 CYSQVQLVETGGGIITPGGSLSLSCKASGFTFTCCEMHWVRQAPEKGLEWVAGLSSSGSSKWYNAKVNGRFTVSRDNSKSTVHLQMNSLKIEDSALYYCA
Pantherophis guttatus V34 iglv JTLQ01082988.1 543 PSLQQLQTLKDAEFVPTGGTVTISCRYNGGNLGDGHYPLWTKEIAGHQHRGVITYTTSKAPGVPERFSGSRSGNMMSLTITGAQVEDEATYYCCVWSDNQ
Pantherophis guttatus V33 trav JTLQ01080370.1 200 SNLDAQVIQAPAKLEVQEGGSFTLNCNSSIQYQPYFWYQQLPGAPPSLILSIHSQGSQNDKGFVAKYLEKGKESQLHRRTAQLQDSGSYFCAVQ
Pantherophis guttatus V32 trav JTLQ01078968.1 1859 RSSGQSVDQTSGIVTATEGQPIFFYCSYEAQTRASYYPYWYIQHSGQPLKFLLGWHENNAEGFHATHHKDKQNGTFNLQKDASQLKDSAAYFCAFS
Pantherophis guttatus V31 ighv JTLQ01075681.1 1282 VQCEVQLVESGGDVRRPRESLHLSCQASGFTFSSYEMSWVRQAPGKGLEWVAYIWSSDLYHSDKVKGRFTISRDDAKSQLYLQMNSLKPEDTAVYYCAK
Pantherophis guttatus V30 iglv JTLQ01044002.1 1411 IDCQSSWTQPPSSSVSPGGTIALPCTMTQSSKSIYWYQQKPGEVPRYVHCSGCSNRGEGIPDRFAATRSGTTGSLTIINAETGDEADYYCGSWNSADTM
Pantherophis guttatus V29 ighv JTLQ01020150.1 429 VYLEIQLVESGGDVKRPGESLRLSCRGSGFTFSGGYLDWMRQSPGKPLEWVAYISTDSNPIYYSDKVKGRFTISRDDSNSLMFLQMNSLKTEDTAMYYCARE
Pantherophis guttatus V28 ighv JTLQ01012596.1 2957 VQSEVQLVESGGDVRRPGESLRLSCQASGFTFSYNWMSWGRQAPGKGLEWVASIHYHGERFDYSDNVKGRFTISRDNVKSQLYLQMNSLSIEDTAVYYCAT
Pantherophis guttatus V27 iglv JTLQ01012182.1 92 IDGQLSWTQPPTSSVSPGGTVTISCTTQSTSTVSWHQQKAGEAPRFVHCNGCSRGEGIPNRFTATQSGSTGSLTITNAEAGDEADYYCLSWNSASNA
Pantherophis guttatus V26 ighv JTLQ01007598.1 460 SLESNTLTQPKEAMAVPGTSVTLECLASGYDINRHHIHWTTQPTETGLAYIGGFRPRDPIIIVDKFKGRVALSTTGSTSKLRIDGLTVEDTAHYYCARGA
Pantherophis guttatus V25 ighv JTLQ01006270.1 1765 VQSQAQLVASGGGVRRPGESLRLSCQASGFNFGSYDMNWARQAPGNGLEWVAYINYPSSIIVYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAIYYCAR
Pantherophis guttatus V24 ighv JTLQ01005493.1 1775 CHSQVQLVETGGGVVAPGGSLRLTCKASGFTFASAYMDWVRCAPEKGLEWMARISDTGSSKLHNSKIAGRFTISRDNSQSSLYLQMNNLNPEDSALYYCAT
Pantherophis guttatus V23 ighv JTLQ01005493.1 1775 CHSQVQLVETGGGVVAPGGSLRLTCKASGFTFASAYMDWVRCAPEKGLEWMARISDTGSSKLHNSKIAGRFTISRDNSQSSLYLQMNNLNPEDSALYYCAT
Pantherophis guttatus V22 ighv JTLQ01003362.1 78 VRSQAKLVESGGDVRRPGESLRLSCQAYGISFGGSSMNWVRQVPGKGMKWVAYINSPSSAIHYSDKVKGRFTISRDNPKSQLYLQMNSLKPEDMEVYYCTG
Pantherophis guttatus V21 ighv JTLQ01003046.1 780 ALSQVTLTQSSLVIKKQGESAQLVCSITGFDINNHYMHWVMQRPGKPLEWLVYYRIPKYSGYSPTIQGRFTASKDSSNFYLQMNDLKMDDTAVYYCTAD
Pantherophis guttatus V20 iglv JTLQ01847216.1 123 TFSQIVLTQPASLSGPLGGTIRITCSISNGTIQRGYSSWYQKKPGSVPKLLIVFDNVTDEGIPERFSGSLENSDKTAVLTISNLEAGDEADYYCLFPTDDGK
Pantherophis guttatus V19 trav JTLQ01832438.1 181 WISISQVTQTPVYQDLQEGDRLTITCKNNAEYSYFHWYRQGPRMPLSYLLSITSSQNVTKEGLTAEYLDNGQRSRLHLPSSLLQDSGTYFCGVS
Pantherophis guttatus V18 trav JTLQ01826691.1 22 PSTEDVVEQTRTAVIVTEGNPFLIQCSYEADWSVTNDPFWYIQLPGQPPKFFLSENEDHKEGFQISHILGENKRNGVFNLKKATSQLNDSAFYLCA
Pantherophis guttatus V17 trav JTLQ01808387.1 75 STGQSVKQTSGIVTVAEGQTVSLNCSYEVQFSGMNYPFWYLQHPGQPPKLLLTSFNKNAQGFQATQDEHDKKGTFNMQKQAIELKDSAVYFCA
Pantherophis guttatus V16 ighv JTLQ01455005.1 291 VQSEVQLVESGGDVRRPGESLRLSCQGSGFTFSTYYMHWVRQAPGKGLEWVSYLYTGSLHIFYSDKVKGRFTTSRDNAKSQLYLQMNNLKPEDTAVYYCAG
Pantherophis guttatus V15 ighv JTLQ01352893.1 866 GLSQVALTQSDPVLKKPGESHKLTCAVTGFDLNSYSMHWIRKKPGQGLEWIVYYYSSSSNSYSPTIQGRFTASKDSSNFYLQMNNLKGEDTAVYYCAR
Pantherophis guttatus V14 ighv JTLQ01322303.1 571 QLVESGGDLRRPTESLRLSCHGSGFIMRNYWMFWVRQVPGKGLEWLAGMGTTAIYYSDNVKGRFTISRDDSLSQVYLQMNNLKPEDTAVYYCAR
Pantherophis guttatus V13 iglv JTLQ01305953.1 513 ALAQFTMTQPPSLSVSPGETVSITCTRAGGSISDHYVSWYQQKPDTKILAVIYEDSERPSGIPERFSGSIDSSSNSATLSISNVQTEDEAVYFCLSYDDNAQ
Pantherophis guttatus V12 trav JTLQ01272781.1 323 QSVKQTTGIVTVTEGQPVYLNCSYEAEFSATHYPFWYTQSPGQPPKHLLNSYLKTAEGFQATHNADENRKNGTFNMQNPSIQLKDSAVYFCAFG
Pantherophis guttatus V11 ighv JTLQ01236142.1 95 QLAESGGDVRRPGESLHLVCQASGFTFSDYSMHWMRQAHGKGPVWVAHIRYDSTSFHYSDEVKGRFTISKDNAKDQLHLQMNSLKHEDTAVYYCVR
Pantherophis guttatus V10 iglv JTLQ01215180.1 599 ASAQFVLTQPASVSARLEGRVQISCTRSSGAMSGYYVSWYQQKSVEPPKLLIYQHVNRPADVPDRFSGVTDSSRATLTITGVQPEDEAEYYCQSYDGNWM
Pantherophis guttatus V9 ighv JTLQ01213637.1 841 QLVESGGDVRRPGDSLRLSCQASGFTFSSYGMSWVRQAPGKGLEWVASMGTSSTYYPDKVKGRFTISRDDAKSQLYLQMNNLKAEDTAVYYCAR
Pantherophis guttatus V8 ighv JTLQ01203792.1 91 QLVESGGDVRRPGESLRLSCQASGFTFSNYWVGWVRQAPGKGLEWLARIYSTSTYYSDKVKGRFTISKDDSRSQLYLQMNSLKPEDTAVYYCTR
Pantherophis guttatus V7 trbv JTLQ01132659.1 46 QSPGQSVKLDCAVSGVEVDGWFWGWNRKCPGKSFEWLGGIKSVNQGGDTYYNSRFNNRIVITRDTSKNEVYLELRSLTTSDRAVYFCARHRAL
Pantherophis guttatus V6 igkv JTLQ01112583.1 808 CFSQAVLTQSDPVVKKPGEAHKLTCSIPGFDVNNNWMSWIRQKPGQGLEWLAYYYSSDNNYYSPIIQGRFTASKDASNFYLQMHNLKIEDTSIYYCGGE
Pantherophis guttatus V5 igkv JTLQ01100788.1 619 ANSQYTLTQPASQSFPPGETVKISCKMSQDSQVGSYSISWYQQKAAESPKYLLYNAGSNGRFTGSKDTSANAAYLTITNVLTEDEGDYYCAGGYGSGSNWWY
Pantherophis guttatus V4 ighv JTLQ01081869.1 371 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYWMYWVRQAPGKGLEWVTAIATGSSPSTYYSDKVKGRFTISRDDAKSQLYLQMNNLKSDDTAVYYCAK
Pantherophis guttatus V3 ighv JTLQ01075967.1 211 VLAGASIAESGGGVKRPGDSLRLTCTCSELNIDSYWMEWVRQADGKGLEWIARIHQSSVYYANSFKGRFTISKDSSRNLVYLDMTRLKAEDTAKYYCTT
Pantherophis guttatus V2 trav JTLQ01067462.1 138 CSLDAQVTQTPENLEVQEGRSFTLKCNYSSQYRPYVWYHQLPRAPPTLILSVDSLGRTSKEHFVAEYLENGKKSHLSCSRAQLQHSGNYFCAVQDTVV
Pantherophis guttatus V1 ighv JTLQ01054522.1 3101 CHSEIQMIQSGAGIKAPGGSLTIVCKTSGFGFTNYYMSWVRKQPEKGLEWLCRMPSLSANPWYNPAIVGRFIQTRDNAKASTTLQLNDLKLQDSAVYYCTR
Pantherophis guttatus V0 ighv JTLQ01019013.1 2058 LLEQSGGDSKRPGESLRLSCKGSGFDFDNAGLHWVRQAPGKGLEWIAVIWFDSSKQEYAESVKGRFTVSRDNTNRQLYLQMDRLRMEDTAVYYCTA
Pantherophis guttatus V70 ighv JTLQ01785322.1 99 MQSEIQFLQSGPELKRPGELIRLTCKTSGYTFNYYRLGWVKQAPGKGLNWVGSIRTDNFNTFYAEAFKDRVTITVDISISTTFLQLTNLNTEDTAVYYCAR
Pantherophis guttatus V69 trdv JTLQ01458968.1 996 EDLYTILQRPASVVIEEFGIDYSLECSTKTTSIPNFYWFRQISSGSIDLLAFSITTSSTNNVGPSHIKGSRPNNENFSLKIRSLTTNDSGIYYCALS
Pantherophis guttatus V68 ighv JTLQ01456446.1 1301 VQSQIQLVESGGNVRRLGGSLHLSCQTSGFTFGGYGMSWVRQAPGKGLEWVTFISYGAAIIHYFDKVEGRFTVSRDNDNNQLYLQMNSLKAEDTAVYYCAR
Pantherophis guttatus V67 trav JTLQ01453652.1 172 QSVKQTSGIVTVSEGQAISLNCSYETQYGGRYIFWYIQHPDQPLKLLLSVYENYGPGFHAIHLKGDKNGTYNLEKGASQLKDSAAYFCAFR
Pantherophis guttatus V66 iglv JTLQ01449952.1 500 IDGQSTWTQPLSSSVSLSETITLSCTTQSPHRIDWHQQKAGKGPRFVHCNSCSRGEGISNRLTATQSETTGSLTITNAQAEDEAIYYCGSWNSAGNM
Pantherophis guttatus V65 trdv JTLQ01432384.1 1033 VSATITLTQPPEALVLPGRSITLTCTVSGYDINNHHLGWVRQSNGEELVFITSFRTGYTTYTADEFKGRVTPSTSGSTAQLKIDALKVEDTAIYYCAR
Pantherophis guttatus V64 ighv JTLQ01423615.1 520 VQSQEQLVESGGDVRRPGESLHLVCQGSGFTFGSFHMNWMRQAPGKELEWVAGIFSDSRRIFYSDKVKGRFTISRDNAKSQLYLQMNSLKVEGTAVYYCTR
Pantherophis guttatus V63 ighv JTLQ01341293.1 966 VQSQVQLLESGGDVRRPEESLHLTCQASGFTFSSYGMHWVRQAPGKGLEWMTTIGTGSSPSIYYSDKVKGRLTISRDDAKSQLYLQMNSLKLEDTAVYYCA
Pantherophis guttatus V62 ighv JTLQ01333963.1 2717 GLLQVSLTQSDSVLKKPGVSHKLICAVAGFNINHKNMYWVRKKPGQGLELLVYYYSSSDNSYSPTIQGYFNASKNNFNFYLQTNKLKAVYTAVYYCA
Pantherophis guttatus V61 ighv JTLQ01333963.1 3465 GLSQVALTQSDAVLKKPGESHKLTCTATGFNVNSYYMGWIRQRPGQGLEWLVYYYTSSSNYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Pantherophis guttatus V60 ighv JTLQ01332691.1 46 VQSAVQLVASGGDVRKPGESLRLSCQAAGFTFADHWMTWVRQAPGKTLEWVLYIGTSSSPIYYSDKVKGRFTVSRDDSRSQVHLQMNSLKPEDTAVYYCGK
Pantherophis guttatus V59 trgv JTLQ01325203.1 387 VLSQAQVIQSDPLSVGLAGTTVVTCTLQGVEFISPTNPSWYQQKAEQPPKLLFYKSRERASGIPDRFSAETYGNIAKLTISSVEEGDEGAYYCAVWHSDQ
Pantherophis guttatus V58 ighv JTLQ01306119.1 339 VQSQVQLVESGGDVRTPGESLRLTCQASGFTFSSYRMSWVRQAPGKGLEWVAYISTSSSPIYYSDKVKGRFTISRDDAKSQLYLQMNSLKLEDTAVYYCAR
Pantherophis guttatus V57 ighv JTLQ01300634.1 676 VKSEVHLVESGGDVRSPGQSLDLSCQASGFNFGGSQMNWERQAPGKGLEWVAYISPSSGTIYYSEKAKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Pantherophis guttatus V56 trgv JTLQ01298947.1 193 ASIQQLQSLKNSESVVLGGTVTMSCSYSGGMISDNNYLRWVQQKPGKVLKLLVATSNTRPSNVPARFTGTTSGNTMSLTIAGTLGEDEATYYCAVWTGSG
Pantherophis guttatus V55 ighv JTLQ01279302.1 1754 GFSQVALTQSDPVVKKPGESHKLTCAATGFDVNSYNMFWIRQKPGQGLEWIVYYYSSSSNSYSPTIQGRFTASKDSSNLYLQMNNLKAEDTAVYYCAR
Pantherophis guttatus V54 ighv JTLQ01271481.1 878 VQSEIQLVESGGDVRRPGESLRLSCQASGFTFSSYHMGWVRQAPGKGLEWVASIWPSNIYHSDKVKGRFTISRDDAKSQLYLQMNSLKLEDTAVYYCA
Pantherophis guttatus V53 ighv JTLQ01261474.1 1321 VQSDVQLVESGGNVRRPGESLHLSCQGSGFTFSSKWMVWVRQAPGKGLEWVSYIQPSSASIFYSNKVKGRFTISRDNAKSQQYLQMNSLKPEDTAVYYCS
Pantherophis guttatus V52 trav JTLQ01258582.1 380 STGQTVDQTSGVVTITEGQSLYLRCAYEAQFSGINYPFWYIQHPGQPLEILLPNFSNDAQGFQATHIENKQKGTFNMEKPAIQLKDSAVYFCA
Pantherophis guttatus V51 ighv JTLQ01244877.1 303 VKSQAQLMESGGDVRRPGESLRLSCQASGFTFSSSYMDWMRQAPGKGLEWVSEILPSSSSIYYSDKVKGRFTISRDDAKSQLYLQMNSLKPEDTAIYYCTR
Pantherophis guttatus V50 trbv JTLQ01240172.1 1876 EQILLTQKPTWISGQLGDQIEMNCYQNNTDHNWMYWYRQTAAKQQLELIGYISMGAPKATMEDEFEDRGFTIQRMHGKHCSLQINKMSSEDAAVYFCASS
Pantherophis guttatus V49 trav JTLQ01237741.1 232 QSVDQTPGILIVTEGQPVSLHCSYEAEFPVSNYPSWYIQRPGQPLKIWLTKLDNKAQGFQATHYEDKQKGTFNMEKPAVQLKDSSVYFCALT
Pantherophis guttatus V48 ighv JTLQ01236219.1 2895 VQLVQTGGRVVVPGSSIRLTCKASGFNFTNYAMDWIRKARGKRLEWVASVSQPQGTKRWVNSKLEGRFIIARENSQTSAYLQMNNLKLEDSAVYYCAR
Pantherophis guttatus V47 iglv JTLQ01221269.1 750 DAAISLVQPPSVSASLGKAVQISCTLSGGTMATHTISWFQHQLPNPPRYLLYYKDGSNQRRKTGVSDRFAASKDDGLNACYLTISEVQAGDEATYYCLS
Pantherophis guttatus V46 trav JTLQ01220280.1 745 TSQSDSVLQTQNSVEILEGEDATLPCNFNTLSSNPYLYWYRQYKDQNLERILIAYKGGPRNNHFQEGKFSTTLVLGSQKSAHLNISSVSLLDGAVYFCALN
Pantherophis guttatus V45 ighv JTLQ01190760.1 705 ALSQITVTQSSPVIKNQGESVQLKCSITGFDINNHYMQWSMKKLGDPLKWLVHYRIPKYSAYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Pantherophis guttatus V44 ighv JTLQ01179207.1 879 CFSQVVLTQSGPMVKKLGESHKLTCAVTGFDLNRYSMYWIRKKPGQGLELLVYYYSSSSNYYSSTIQEWFTASKDSSNFYLQMNNLKAEDTAIYYCSRG
Pantherophis guttatus V43 ighv JTLQ01174986.1 1285 QLVDSGGDVRRPGESLRLSCQASGFTFSSYHMNWFRQAPEKGLEWVALISSGSDTYYSDQVKGRFTISRDNAKSQLYLQMNSLKTEDMAVYYCAK
Pantherophis guttatus V42 ighv JTLQ01173439.1 732 VQSEVQLVESGGHVRRPGESLRLSCQASGFTFSESYMVWVRQAPGKGLEWVAYIYEGSSYIIYSDNVNGRFTNSRDDAQNQLHLQMNNLKPEDTAAYYCARRIVTD
Pantherophis guttatus V41 ighv JTLQ01168898.1 139 ISSQITLTESGDGMKKPGDTPRLTCTVSGFAITSYGVSWIRQTPGKAIEWNGIIWGSGSTNYNSALQNRISITRDASKNQVFLQLTGLKTEDTGTYYCAS
Pantherophis guttatus V40 iglv JTLQ01168515.1 468 VTSQPTLTQPASQSGSPGGTIKLSCAISSNPYTIGWIQQRSGEAPRFVHCDGCSSRGEGIPDRFTGTRSGNNGYLTITNLQAGDEADYY
Pantherophis guttatus V39 ighv JTLQ01148344.1 277 VQSEVQLVETGGDIRRPGESLRLSCQASGFIFGGYGMGWVRQAPGKRLEWVSYTYSSEKYYSDKIKGRFTTSRDDDKSQLYLQMNSLKPEDMAVYYCTG
Pantherophis guttatus V38 trav JTLQ01128903.1 2642 VQCQDRVDQKPVEVIKEGEDSTIVCQFSSSNVYNMHWYRQYPGEGPVFLLMVTSVELEKRDHFSASFEKQKESQLNITRVHLKDAAVYFCAAGDTQ
Pantherophis guttatus V37 iglv JTLQ01125933.1 2607 SWGQFVLTQPPTLSVAPGGRAVISCTRNTASINKYHVSWYQQKPNSLPKLLIYQHNKRPPGIPERFSGFTGGSSATLTISNVQAEDLADYYCSSYDSNWL
Pantherophis guttatus V36 ighv JTLQ01086151.1 269 LSVQQLKNLKDPELVAPGETVVLSCSYSAGSITNDNAPLWIQQKSEEVPRLVMYATGTRASGTPARFSGSKSANTMSLIITESQLEDDATYYCVVWGGNG
Pantherophis guttatus V71 ighv JTLQ01785384.1 80 AQTQVQLLESGGDVRRPEGSLRLSCQGSGFNFSTYPMNWVRQARGKGLEWVAGISIGSSPYIYYPDKVKGRFTISRDNAKSQLYLQINNLKPEDTAAYYCAR