WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Thamnophis sirtalis LFLD00000000.1 (LFLD01) 73 54 7 2 4 5 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Thamnophis sirtalis V1 ighv LFLD01005478.1 933 VQSQVQLVESGGDVRRPGESLRLSCQTSGFIFSSYYMNWVRQAPGKGLEWVAHITPSSATYYSDKVKGRFTISRDNAKSQLYLQINSLKAEDTGVYYCA
Thamnophis sirtalis V0 ighv LFLD01005476.1 600 QLVETGGDVRRPGESLHLSCQASGFSGLSSYGMNWVRQAPGKGLEWVAYIWSSYLYYSDKVKGRFTISRDDAKSQLYLQMNSLKTEDTAVYYCAR
Thamnophis sirtalis V38 trbv LFLD01126265.1 48 VFAETQLAESGPGTAKPGSQLNLVCKVTGFSIGHSLYEWHWVRQPRGKGLEWLSAINANSGSKWYANSVKSRITTLADRSRNEFSLQLNSLTAADSSVYFCARE
Thamnophis sirtalis V37 trav LFLD01113377.1 628 VSGQATVTQEHQFLSIKEGDSTLLNCSYHEVEYSLQWYKQYPGGPPDFMISRSSSGTQPEDNFEMTLDKKKRTTSLYLKNTQLKDSAVYFCAWSTVLQ
Thamnophis sirtalis V36 ighv LFLD01112107.1 1615 RSEVQLVESGGDVRRPGESLRLSCQASGFSFRGDWMHWVRQAPGKGLEWVAIIHTGSSPSTYYPDKVKGCFTISRDDSRSQLYLQMNSLKLEDSAVYYCAR
Thamnophis sirtalis V35 ighv LFLD01112107.1 3299 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYCMNWARQAPGKGLEWVARICTGSSPSIYYPDKVKGRFIISRDDSRSQLYLQMNSLKLEDSAVYYCARE
Thamnophis sirtalis V34 ighv LFLD01112107.1 6679 VQSEVQLVESGGDVRRPGESLHLSCQASGFSFSDYAMSWVRQAPRKGLEWVAFIHTASSPIYYSEKMKGRFIISRDDSHSQLYLQMNSLKVEDSAVYFCTK
Thamnophis sirtalis V33 ighv LFLD01109217.1 1217 ALSDVQLVSSGPGTVRSGQNLYLVCKVTGVPLVGGGNAWHWVRWPPGKGLEWIARSYPRNREKLYSSSLRSHSTIALDNTKNEYSLQLNSMSAADTAVYYCAV
Thamnophis sirtalis V32 ighv LFLD01109215.1 813 SLSEVQLVSSGPGTVKPGQNLNLVCRVTGVSITDRSYDWDWVRQPPGKGLEWIAGIYSNDGSKWYSSSLKSRTTISSDTSKNEFSLQLNSMSASDTAVYYCARE
Thamnophis sirtalis V31 ighv LFLD01109213.1 679 SLSEVQLVSSGPGTVKPGQNLNLLCKVTGVSITDGSYAWNWVRQPPGNGLEWIAGIYIYHGQKYLASSLQSGSTISSDNSKNEFSLQLNSMSASDTAVYYCARQ
Thamnophis sirtalis V30 ighv LFLD01109210.1 653 SLSEVQLVSSGPGSVKPGQNLNLVCKVTGVSITDSSYLWDWIRQPPGKGLEWIAEISPYDGRKWYSSSLQSRTTITSDNSKNEFSLQLNSLSASDTAVYYCARQ
Thamnophis sirtalis V29 ighv LFLD01109209.1 1141 SLSEVQLVSSGPGTVKPGQNLNLLCKVTGVSITDGSYDWHWIRQPPGKGLEWIARIYPKDGRKWYSSSLQSRTTISSDNPKNEYSLQLNSLSASDTAVYYCARQ
Thamnophis sirtalis V28 ighv LFLD01109206.1 3966 SLSEVQLVSSGPGTVKPGQNLNLLCKVTGVSITDFSYSWHWVRQPPGKGLEWIASIYPHDGRKWFSSSLQSRTTISSDNSKNEYSLQLNSLSASYTAVYYCARW
Thamnophis sirtalis V27 ighv LFLD01100429.1 935 SLESPTLSQPMAATAVPGTSVTLKCLASGYDINQHHIHWTTQPANTGLAYIGGFRPRDPIIIVNKFKGRVALFTTGSTSKLRIDGVTAEDTAIYYCARGF
Thamnophis sirtalis V26 iglv LFLD01096685.1 673 VTSQPILTQPASQSGSSGGTIKLSCAISSNPTTIRWIQQRSGEAPCFVHCDGCSSRGPGIPDRFTGTRSGNNGYLTITNLQAEDEAIYY
Thamnophis sirtalis V25 ighv LFLD01091695.1 13 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYWMRWVRQAPGKGLEWVASIATGSSPSTYYPDKVKGRFTLSRDDSRSQLYLQMNSLKLEDSAVYYCVRE
Thamnophis sirtalis V24 ighv LFLD01091695.1 13 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYWMRWVRQAPGKGLEWVASIATGSSPSTYYPDKVKGRFTLSRDDSRSQLYLQMNSLKLEDSAVYYCVRE
Thamnophis sirtalis V23 trdv LFLD01063258.1 11610 EDLYTILQRPASVVIEEFGIDYSVECSIKTSSSIPIFYWFRQISNGSIDLLAFSITKSSTNNVGPTHIKGSRPSNENFLLKIRRMTTNDSGIYYCALS
Thamnophis sirtalis V22 trbv LFLD01052692.1 14725 FVGSGSAVEVIQTPSFAHNSSGQSITMSCSVNEAGYKFFWYQQLPGKTELTALGYLSSFDKDLQERHKDWQNRLEAKWEGSKNQEMRLDLLNLQASDTGFYLCAAV
Thamnophis sirtalis V21 ighv LFLD01175950.1 494 VQSQVQLVESGGDVRIPGESLRLSCQTSGFTFSSYEMVWVRQAPGKGLEWVAYINTGSGTLYSDKVKGRFTISRDNAKSQLYLQMNSLKLEDKAAYYCST
Thamnophis sirtalis V20 trbv LFLD01175948.1 337 ARPGSQLNLVCKVTDFSFATSSSLACHWVRKPRGEGLEWLSAINVNSGDKVYANSLKGRATISADKPRNEFSLQPNSATASDSSVYFCVR
Thamnophis sirtalis V19 trav LFLD01173929.1 188 QSVKQTTGIVTVTEGQPVYLNCSYETGFSTSYVISWYIQPPGQPPKHLLNSYLETAEGFQATYNDDKKEKRGTFNMQKPDVQLKESAVYFCAFS
Thamnophis sirtalis V18 ighv LFLD01170149.1 5839 VLADVSITESGGGVKRPGDSLQLTCTSSGFNIDNYWMVWVHQADGKGLEWIAEINKGTTYYANSFKGRVTISKDSSRNQVYLDMNGLKAEDTAKYYCTK
Thamnophis sirtalis V17 ighv LFLD01170149.1 3054 VLADVSITESGGGVKSPGDSLRLTCISSGFNIDSYWIEWIRQADGKGLEWFAAINKGTTYYANSFKGRVTISKDSSRNQVYLDMNGLKAEDTAKYYCTR
Thamnophis sirtalis V16 ighv LFLD01170149.1 791 VLADISITESGGGVKSPGNSLRLTCTSSGFNIDSHYMEWVRQADGKGLEWIARIHQHNTFYANSFKGRVTISKDSSRSQVYLDMNGLKAEDTAKYYCSR
Thamnophis sirtalis V15 ighv LFLD01170148.1 804 VLADVSITESGGGVKRPGDSLQLTCTSSGFNIDNYWMVWVHQADGKGLEWIAEINKGTTYYANSFKGRVTISKDSSRNQVYLDMNGLKAEDTAKYYCTK
Thamnophis sirtalis V14 ighv LFLD01170146.1 482 VELQNILIQPASEFKFAGETLTLTCKGVSFLQSWIEWTYKIGDEGIKWIGESNVDGSSSNVRLPLRDRFAISRDNSRDIATLEIRQLKVEDSGLYYCS
Thamnophis sirtalis V13 ighv LFLD01098026.1 4114 QLVESGGDVRSPGEPLHPSCQASGSTFSSYGMIWVRQAPGKGLEWVSYIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNSLKTEDTEVYYCTR
Thamnophis sirtalis V12 ighv LFLD01098023.1 1475 VQSQVQLVESGGDVRRLGDSLRLSCQASGFTFSNYYMYWVRQAPGKGLELLASISTGSSPSTSYSNKVKGRFTISRDDSRSQLYLQMNNLKLEDKAAYYCST
Thamnophis sirtalis V11 ighv LFLD01098019.1 1073 VQSQVHLVESGGDVRRPGESLRLSCQTSGFTFSSAYMHWVRQAPGKGLEWVARINPSSTTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCTG
Thamnophis sirtalis V10 ighv LFLD01098018.1 158 VQSQYQLVGSGGDLRRPGESLHLFCQGSGFNFGGYNMNWVRQVPGKRLECVAWTRYDGGATYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAG
Thamnophis sirtalis V9 ighv LFLD01091696.1 376 QLVESGGNVRRPGESLRLSCQASGFTFRSFEMNWVRQAPGKGLEWVAYIDTSSSPIYYSDKVKGRFTISRDDSRSQLYLQMNNLKTEDTAVYYCAR
Thamnophis sirtalis V8 ighv LFLD01084729.1 1200 VRCEIQLVESGGDVRRPGESLRLSCQASGFSFSSYWMYWVRQAPGKGLEWVAHINAGSSPLTRYPQKVKGRFTISRDDSRSQLYLKMNSLKLKDSAVYYCAR
Thamnophis sirtalis V7 ighv LFLD01084727.1 1449 LIGGVWRDVRNPGESLRLSCQASGFTFSSTYMIWVRQAPGKGLEWVAYINTASSTYYSDKVKDRSRDNAKSQLYLQMNNLKEEDTAVYYCAG
Thamnophis sirtalis V6 ighv LFLD01084726.1 354 VRSDIQLVESGGDVRRPGESLRLSCQASGFTFSSYQMFWVRQAPGKGLEWVARISTSYINYSDKVKGRFTISRDDGKSQLYLQMNNLKEEDTAVYYCAR
Thamnophis sirtalis V5 ighv LFLD01075842.1 1557 QSQVQLVESGGAVRRPGESLHLSCQASGFPFFIYAMHWVRQAPGKGLEWVSWITQTSSTYYSDKVKGRFTISRDNDKSQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V4 trbv LFLD01063249.1 994 CSDANIIQPQSMILEEGQDARLECRQDYGHRNMLWFRQHKQQQDFQLLYSFYNGNILQKNPSLHRLNADQPMLDRCLLSISAVKPEDSAVYFCASS
Thamnophis sirtalis V3 ighv LFLD01056585.1 900 QLVESGGDVRRPGESLHLSCQASGFTFSSHAMSWVRQYPGKGLEWVAFIHTASSPIYYSDKVRGRFTISRDDSRSQIYLQMNNMKPEDTAVYYCAR
Thamnophis sirtalis V71 ighv LFLD01167262.1 1309 VHSSVQLVESGPGRVSPGGSFKLTCKVTGDSVTNRYWEWIRQAPGKGLEWVGQIDWYSSNWRTYYASSLQSRTTLTADSSRNEFYLTMRSLTAADSATYYCARA
Thamnophis sirtalis V70 ighv LFLD01165321.1 946 VQSQAQMVESGGDLRRPGESLRLSCLASGFTFSSHGMNWVIQAPGKGLEWMAHISPGSSPIYYSDKVKGRFTISRDDARSQLYLQMNSLKAEDTAVYYCAA
Thamnophis sirtalis V69 ighv LFLD01165320.1 190 AKSQVQLVESGGDVRSPGESLRLPCQASGFTFSSYWMAWVRQAPGKGLEWLCHIHPTSSNIYYSDKVKGRFTISRDNAKSQLYLQMNNLKTEDTGVYYCAR
Thamnophis sirtalis V68 ighv LFLD01165319.1 432 VQSEGLLGDSGGDVRRPGEYLHLSCQGSGFTFSYSYMVWVRQAPGKGLEWVAYRSFHSAKIYYLDKVKGRFIISRENAKRQLYLQMNNLKPEDTGVYYCAR
Thamnophis sirtalis V67 ighv LFLD01165318.1 1480 VHSAVMLLESGGDARRPGESLRLSCQGSGYNFADNSMNWVRQAPGKGLDWVAYIRYDASTIYYSDKVKGRFTISRDNAKSQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V66 ighv LFLD01165318.1 1480 VHSAVMLLESGGDARRPGESLRLSCQGSGYNFADNSMNWVRQAPGKGLDWVAYIRYDASTIYYSDKVKGRFTISRDNAKSQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V65 ighv LFLD01165316.1 570 VQSDVQLVESGGDVRRPGESLRLSCQGSGYSFGDHSMYWVRQAPGKGLEWIAYIRYDAGAISYSDKVKGRFTISRDNAKSQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V64 ighv LFLD01165316.1 2773 AKSQVQLVESGGDVRRPGESLRLSCQASGYSFDGYSMVWVRQAPGKGLDWVAYIRYDAGATSYSDKVKGRFTISRVNAKRQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V63 ighv LFLD01165312.1 1626 VQSQAQLVESEGDVRRPGESLRLSCQASGFTFSSYNMVWVRQAPGKGLEWVAYRSFHSANIYYSDKVKGRFIISRDNAKRQLYLQMNYLKPEDTGGHYCAR
Thamnophis sirtalis V62 ighv LFLD01165312.1 5599 VQSQVQLVESGGDVRRPGEDLHLSCQASGFSFSSYNMMWVRQAPGKGLEWVAWIRHDGGQAYYSGKVKGRFTISRDNAKSQLHLQMSSLKPEDTAVYHCST
Thamnophis sirtalis V61 ighv LFLD01151546.1 2408 GLSQIVLTQSDAALKKPGESHKLTCAVTGFNVNSYYMSWIRQKPGQGLEWLVYYYDSANKYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAS
Thamnophis sirtalis V60 ighv LFLD01151545.1 423 IHLVETGGGVVIPGGSLLLTCKASGFNFTDYTIHWIRQSPGKGLEWVAGVSKPQGTSQWYNPKVEGRFTISRNNSQTSAYLQMNNLKPEDSALYYCA
Thamnophis sirtalis V59 ighv LFLD01151544.1 2689 GLSQVVLTQSDAVMKKPGESHKLICAVSGFDLNSYYMNWARQKAGQGLEWLVYYYSSNTGYYSPNIQGRFTASRDSSNCYLQMNNLKAEDTAVYYCA
Thamnophis sirtalis V58 ighv LFLD01151543.1 852 GLSQIALTQSDAVVKKPGESHKLTCAVSGFSVNSYGMHWVRQKPGQGLEWLLYYFSSSSNYYSPTIQGRFTGSKDSSNYYLQMNSLKPEDTAVYYCAR
Thamnophis sirtalis V57 ighv LFLD01151542.1 892 LSQIVLTQSDAALKKPGESHKLTCAVTGFNINSYYMDWIRQKPGQGLEWLVHYYDSGSKYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Thamnophis sirtalis V56 trbv LFLD01151542.1 2972 GLSQKVLTQSDPVLKKAGEAHRLTCAVTGFNIHSYGMDWVRQKHGQRLEWIVYHHTTSSNSYSSAVQGRFTSYKDSSNFYLQMNDLKMEDTAVYFCAGE
Thamnophis sirtalis V55 trav LFLD01151542.1 5804 IQLTQSGQGVLRPGSQLNLVCKVTGFSIATSSSYAWHWVRQPHGKGVEWLSAINVNNGGKWYASPVKSRTTTSADQSRNEFSLQVNSLVAADSAVYFCFREHTA
Thamnophis sirtalis V54 ighv LFLD01151540.1 633 CYSQVQLVETGGTIVSPGGSLSLSCKASGFTFTCCEMHWVRQAPEKGLEWVAGLSSSGSSKWYNSKVNGRFTISRDNSQSLVFLQMNSIKTEDSALYYCA
Thamnophis sirtalis V53 ighv LFLD01151538.1 3172 CHSKVQLVETGGNVVVAPGSSLRLTCKASGFTFASAYMDWVHHSPEEGLEWMARISDTGSSKLYNSKIAERFTISRDNSQSSLYLQMNSLKPEDSALYYCAT
Thamnophis sirtalis V52 trav LFLD01151538.1 13685 CHSQVQLVETGGAVVAPGGSLRLSCKTSGFTLTSYHMHWFRQVAEKEMEWVAGLDPSGSSKWYNSKFNGRFTISSDISQSSVYLQMNSLKIEDSALYHCA
Thamnophis sirtalis V51 iglv LFLD01140655.1 821 IDGQSTWTQPHSSSVSPRGTVTLSCSTTHNSYQISWYQQKAGEGPHFVHCSGCSRRGERIPNWFTAITNAEAGDEAVYYCGNLNSAVTE
Thamnophis sirtalis V50 iglv LFLD01140652.1 322 ALAQFTMTQPPSVSVSPGGTVRITCTRTGGSFSDYYVSWYQQKPGTKPLAVIYKDSERPSGIPERFSDSYDSSSNSATLTISNVQPEDEADYYCLTYDGNNQ
Thamnophis sirtalis V49 iglv LFLD01140652.1 2669 SLAQFTLTQPPSVSVSSGGTVRITCTRAGGSFSDHYVYWYQQKPGSKPLAVIIEDSERPSGIPERFSGSVDLSSKTATLSISNVQPEDEADYYCFSGENNQ
Thamnophis sirtalis V48 iglv LFLD01139247.1 2394 ATSQPTLTQPVSQSGSTGGTIKLSCAISSSPYYIGWIQQRPGESPRFVHCDGCSSRGEGIPDRFTGTRSGNNGYLTITNLQAEDEADYYCSMWYSSGGV
Thamnophis sirtalis V47 igkv LFLD01139090.1 985 ANSEYTLTQPAAQSFPMRQAAKISCTMSRDSQVGGYTIFWYQQKGGERPKYLLYNTGTNGRFTGSKDTSANAAYLSISNLQAEDEADYYCGGAYGGVGNWR
Thamnophis sirtalis V46 iglv LFLD01139087.1 1488 ANSQYTLTQPAAQSFPPAQPAKISCTMRQDSQVGSYNISWYQQKAGESPKYLLYETGRNGRFTGSKDTSANAAYLTISNLQAEDEADYYCGSYYSSGGNWW
Thamnophis sirtalis V45 igkv LFLD01139078.1 2729 ANSQYTLTQPASQSFPPGQPAKISCTMSRDSQVGSYAIYWYQQKAGESPKYLLYDSNSNGRFKGSIDASANAAYLTITNLQAEDEADYYCAGAYSSGGNWWY
Thamnophis sirtalis V44 iglv LFLD01139077.1 2713 NSQYTLTQPAAQSFPPAQPAKISCTMSQDSQVGSHGISWYQQKAGESTKYLLYNTGTNGRFTGSKDTSANAVYLTITNLQAEDEADYYCGGAYGSG
Thamnophis sirtalis V43 ighv LFLD01138881.1 455 GLSQVLTQSDSVLKEPGESHRLTCTVSGFDINSYYTDWIRQKPGQGLEWLVHYYSSSTNYNSPPIQSRFTASKGSSNYYLQMNNLKTEDAAVYYCAR
Thamnophis sirtalis V42 ighv LFLD01137314.1 5 VRSEVQLVESGGDVRRPGESLHLICQASGFTFSSSYMIWVRQAPGKGLEWVAYISLSSSYIYYSDKVKGRFTVSRDNAKSQLYLQMNNLKEEDTAVYYCAK
Thamnophis sirtalis V41 ighv LFLD01136596.1 1126 VQSQVQLVESGGDVRRPGESLHLSCHASGFTFSSYNMHWARQPPGKGLEWVSWITYHSGTITYSDKMKGRFTVSRDNFESQLYLQMNSLKTEDTGVYYCAR
Thamnophis sirtalis V40 ighv LFLD01132888.1 523 VQSEVQVAESGGDVRRPGESFHLSCQASGFTFSNYHMNWARRAPGKDPEWVANIRIGSSPSTYYPDKVKGRFTISRDDSRSQLYMQMNSLKLEDTPVYYCVR
Thamnophis sirtalis V72 ighv LFLD01171436.1 2947 VHSTVQLVESGPGIVSPGGSFKLMCKVTGDSIKNVYWEWIRQAPGKGLEWVGQIDWANNNWRTSYASSLQSRTTLTADSSRNEYYLAMSSLTAADSATYYCA
Thamnophis sirtalis V39 ighv LFLD01126266.1 266 CHPEIQMTQSGGGIKEPGGSLTVLCQTSGFTFSNYYMTWVRKQPKKGLEWLCRMPTLGASPWYNPAIVGRFIQTRDNAKASTTLQLNDLKLEDSAVYYCTR
Thamnophis sirtalis V2 ighv LFLD01056584.1 950 QLVESGGDVKRPGDSLRLSCQASGFTFSDYAMSWVRQYPGKGLEWVAYISTYSTPIYYSDKVKGRFTISRDDSRSQIYLQMNNLKPEDTAVYYCAR