WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Gekko japonicus LNDG00000000.1 (LNDG01) 246 105 51 5 55 24 2 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Gekko japonicus V83 igkv LNDG01135546.1 3068 RDIISHLPDVSVPLGGTEEISCNHGLTSYQRIFWYKHKVGTAPHSIISGHTTTRTEGRLTMEIDKPGRSTNLTIHEVELEDDAIYYCAAS
Gekko japonicus V0 trav LNDG01004235.1 2349 WCSESQVTQTPLSQNIQEGDPFTITCDFPAGYGSFFWYLQLPGSAPSLKVHITSKENVTSGRFLAERRENGKQSRLHLSDSRLHDSGVYWCAAA
Gekko japonicus V4 ighv LNDG01009519.1 957 VISEDQLVDSGGDIKRPGESLRLSCQASGFNFGSYGMHWVRQALGKGLEWIAVIYYDGSKQFYASSVQGRFTISRDNPSNMAYLQMDSLKVEDTAMYYCTR
Gekko japonicus V3 trav LNDG01009244.1 4999 AFSDIQLTSSGGGTLRPGENLNLVCKVTGVSITESGNLWNWIRQPPGKGLEWVAYIYPYNGDKYYAPSIQSRITISADSSRNQFSLQLNSLTAVDSAVYYCARG
Gekko japonicus V2 ighv LNDG01009244.1 1810 VLSQVVLTQSPPAVKKPGESHKLSCAVTGFDINSRWMIWIMKKPGRALEWLAWYDSPGYEHNKYSPAIQGRFTASKDNSNFYLQMNSLKAEDTAVYYCA
Gekko japonicus V1 trav LNDG01009243.1 3969 AFSDIQLSSSGPGTLRPGETLNLVCKVTGVSITDSRYSWDWIRQPPGKGLEWVAYIYAGSKYYAPSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCVRE
Gekko japonicus V42 iglv LNDG01073785.1 9058 SDSQPVLTQPPSASVTPGKTVKLSCVMSSGFDISGYDIYWYQQKPGNPPRYLLYYKSDSSKHQGSGVPSRFSASKDTSANTCHLTITGSLAEDEAD
Gekko japonicus V41 iglv LNDG01073785.1 6384 SFAQYVLTQPPSMSVSSEQSAQITCSGKSIGRKSVHWYQQKPGKAPILIIYGDDTRPSGISERFSGSNSGNTARLTIARAQAEDEADYYCQVYDG
Gekko japonicus V40 iglv LNDG01073785.1 2764 SFAQYVLTQPPSVSVSLGKNAQMTCSGNNIGSYNVHWYQQKPGMAPVLVIYNSNGRPSGISDRFSGSNSGNTATLSIARAKAEDEADYYCQVWDSST
Gekko japonicus V39 iglv LNDG01073784.1 15839 SFAQTEVLRQPLSVSVFLEKNAEITCSGDLVAEAGVNWYQQKPGMAPVLIKYWNDVWDPSEISDRFSGSKSGSTATLTISRAKAEDEADYYCLVWDSRTG
Gekko japonicus V38 iglv LNDG01073784.1 12135 SFAQYVLTQPPLVSVSLEQNAEITCSGNNLGSQYVHWYQQKPSKAPILIIYRDSKRPEEISDRFSGSISGNTATLSITRVKAEDEAGYYCQVYDG
Gekko japonicus V37 iglv LNDG01073784.1 3371 SFAQYVLTQPPFVSVSLEQNAQITCSGNSIESYLVHWYQQKPGMAPLLIIYADSNRPTGISDRFSGSNSGNTARLTIARAQAEDEAAYYCQVWDSSAG
Gekko japonicus V36 iglv LNDG01073782.1 14982 SFAQTEALRQPPSVSVSLEKNAQVTCSGDLIAEEDVNWYQQKPGMAPVLIIYWDGNRPSGISDRFSGSKSGNTATLSISRAKVEDEADYYCQVWDSSAE
Gekko japonicus V35 iglv LNDG01073782.1 11465 ALSDLTLSQPPSLSASLKGTAELPCNISKNFHFGYSVWYQHKHGTSPMFLLRYNTTSGKTIFGSEVSDRFSVSTDAPKQVAYLNIKNVQSKDEADYYCGSWGGTA
Gekko japonicus V34 iglv LNDG01073781.1 2689 VHSQPTLTQPPSQSVSPRETTKLSCTISSDSTTVYWYQQRPGKPPRFVHCDGCSSRGDGIPNRFTASRSGNVGYLTISDCQPEDEADYYSGMWYSSGSQ
Gekko japonicus V33 iglv LNDG01073778.1 31102 VSSQAAWTQPPSQSVSLGQTAKVSCTVSGSIHHFQWHRQRPGQGPHFVLYGSTRGQGIPDRFTDSSSGSVRYLTITNFQPEDEADYYCLAWTGSQ
Gekko japonicus V32 iglv LNDG01073778.1 9698 SPFTLTQPPFQSAPPGDTARLSCTISVYTFGAVSWYQQKEGKSPTFTLLQKKSGETNFGSEVSGNFSASVENPRKVAYLMITNVLAKDEATYYCGAY
Gekko japonicus V31 iglv LNDG01073778.1 5351 ASSQPTLTQPPSQSVAPGQTVQLSCTASSNKNYISWVQQRSGQSPRHIQRAGYSRGHGVPDRFTASESGNVGSLTITNTQPEDEADYYCYMWYRSGNM
Gekko japonicus V30 iglv LNDG01073774.1 7187 ATSQTTLTQPPSQSVAPGQTVQLSCTASSNKNYISWVQQRSGQSPRHIQRAGYSRGHGVPDRFTASESGNIGSLTITNTQPEDEADYYCFMWPSEGSG
Gekko japonicus V29 iglv LNDG01073770.1 735 ATSQTTLTQPPSQSVSPGQMVKLSCTVSSNKNTVCWVQQRSGQSPRFIQCHGGSRGDGVPDRFSATDSGNIGSLTIMNTQPEDEAYYYCYMWYSSGGM
Gekko japonicus V28 iglv LNDG01073769.1 84485 ATSQPTLTQPPSQSVSPGQTAKLSCTVDSSKNTIAWVQQRSGQSPRFIHYAGGSRGDGIPDRFTASESGNVGSLTITNTQPGDEADYCCYMWYSSGNQ
Gekko japonicus V27 iglv LNDG01073768.1 8873 ASSQHTLTQPPSQSGSLGQTTKLPCTISSNKNPFGWVQQIPGQAPRFLFYGSTRGTGIPDRFSVSESGNTGYLSIGSLQAGDEADYYCYMWPSGGSQ
Gekko japonicus V26 iglv LNDG01073768.1 3534 SLAQFSLLQPPAISVSPGGTVTLSCNHSDGGAMLAVYWYQQRGGKSPRYLLGASAAVSLKLRSSGVPDRFNGSMDSSYTAGSLTITNVQAEDEAEYYCQ
Gekko japonicus V25 ighv LNDG01071747.1 1664 VQSAVTLSQPGSVQLRPSETLQLTCSVSGFSLTSTGSVVSWFRQPPGKGLEWLCHVYWNDDKRYPDSLRSRLTISRYPSSSEVHLEMRGMQAGDTGTYYCAGG
Gekko japonicus V24 ighv LNDG01071742.1 150614 VQSAVTLRQPGSVQLRPSETLRLTCSVSGFSLTSAGSIVSWVRQPAGKGLEWLCHIDWDGDKFYLDSLRSRLSISSDTSKSEVHLEMRGMQPGDTGTYYCAGG
Gekko japonicus V23 ighv LNDG01071742.1 70926 CQSVIQLLETGGGVAVPGGSFRLTCKASGFTFADYTMHWISEAPGGELERVAGISPDGGYKAYSPKAQGRFTISRDNPQSSASLEMNSLKTEDTAVYYCVGESQT
Gekko japonicus V22 ighv LNDG01071742.1 54552 VLSEIKLAQSGIGIVKPGESLKLTCTFSGAPITDGYPISWVRQPPNKGLEWIGRRYYHSSKWYTDYASAFQSRVSISPDTSKNEYTLLLSTLTAADTATYYCARYPQ
Gekko japonicus V20 ighv LNDG01071742.1 40386 VLSEIKLTESGKGTVKPGESLRLTCTVSGTTITAGYGYHWIRQPPNERMEWIGRGYYSSSSTWYTHYASAFQSRVSISPDTSKNDFSLQLNSLTAADTAVYYCARD
Gekko japonicus V19 ighv LNDG01071742.1 31298 VLSEIKLTESGKGTVSPGESLRLTCTVTGTSITDTYGYHWIRQPPNEGLEWIGRGYYSSSSTWITHYASTFQSRVSISPDTSKNEFSLQLNSLTAADTAVYYCARE
Gekko japonicus V18 ighv LNDG01071742.1 26113 ALSEIQLTQPGIGIVKPGEPIGLICTVSGTSIMDGYIYNWFRQPPNQGLEWIGRRFYMGSSWHIDYTSAFRSRVSISLDSPRNYYSLHLSSLTAADTAMYYCARR
Gekko japonicus V17 igkv LNDG01071562.1 33798 CDAQITMTQMPSVSASSGETVKISCTLSGGRISGFYNSWYQQKPGSAPVMLIYSDDDRASGISDRFSGSLDSSANAAVLTISNVQAGDAANYYCLYHDGRVQ
Gekko japonicus V16 iglv LNDG01071562.1 30195 CNAQFTMTQPPSVLASIGETVKISCRRNSGSISGYWNSWYQQTPGTGPILLIYTDDEKASGISDRFSGSLDSSANAAVLTISNVQEGDEADYYCLSYDSSN
Gekko japonicus V15 iglv LNDG01071562.1 26975 VSSQATLTQPPFQSASPGQTVELSCTAHGSVQHTHWLQQRPGRGPRFALTGASTRGEGIPDRFTGSKSGNVHSLVITKLQAEDEADYYCVAWYGSGSQ
Gekko japonicus V14 iglv LNDG01071562.1 22575 CDAEFTMTQPPSVSTSIGETVKISCTLSGERISSTYISWYQQKPGSTPMMLIYSNDNRASGISDRFSGSVDSSANTATLTISSAQEGDEADYHCFSYYSSNK
Gekko japonicus V13 iglv LNDG01071562.1 6528 CDAQFTMTQPPSVSASVGETVKVACTRSSGSISSYDNSWYQQTPGSAPILLIYGHNRRPSGISDCFSGSLDSSANAAILTISKVQAADEATYYCSSYDSNIL
Gekko japonicus V12 iglv LNDG01071561.1 728 CNAQFTLTQPHFVSASVAETVKITCTRSSGSISSYYNSWYQQKPGSAPILLIYEHSTRASGISDRFSGSLDSSANAAILTISSVQEDDQADYYCFSYDSSYK
Gekko japonicus V11 iglv LNDG01071559.1 19736 VLSQATLTQPALVSVSPGETAKLSCMISGIVGGISWYQQRPGQAPRFVLHGTSTRGEGIPDRFTGSTAGNIGYLTITNIQAEDEADYYCGTVTYSD
Gekko japonicus V10 iglv LNDG01071557.1 7062 FSSEATPLIQPEDYVSVAVGQTTSISCTLEGVEFISANHPSWYRQRPGNPPQPLIYNARERPSGVPDRFSGETYGNRATLTIARTQADDEGGYYCAVWHSSA
Gekko japonicus V9 ighv LNDG01054101.1 350 SSESSITLTQPPKVMASSGTSVTLDCVTSGYNINDHHMHWVREGKTKGLVYIAGFRTGYNDIVANAFKGRVTPSTSDSTVKLHINSLTVEDTTMYYCARE
Gekko japonicus V8 ighv LNDG01049286.1 5823 VVLTKKGSELKRPGESFRLTCSTSGFVLNDWYTAWVRQKPGQGLEWLVRYHKSSATNYYSPTIQGRFTASKDSSNFYLQMDNLKQEDTAVYYCAR
Gekko japonicus V7 trav LNDG01048452.1 1675 SPRWVFAQVFQPVQLVFAEGQKIHISCHQNATPHNTMFWYRQPQESRRALTSLGSTYSGSISAGEFRMDVNTASRSTNLTKERAAMRDSGVYYCAVR
Gekko japonicus V6 trav LNDG01048449.1 816 FIHGDQVTQEPPEVTVPVSEQVTLNCLFFTSQTQTAIAWYRQDSNRPPRILAMVTSYGVKEFRKSHWQVLLDVKNRTTPLTFRGVTLQDTARYFCALA
Gekko japonicus V5 trav LNDG01034059.1 885 TTLTSSGPGMVRPGENLSLLCKVTGVSISSSSYVWNWIRQPPGKGLEWIARIYYDGRKWYNPSLQSRTTISADTSANQFSLQLNTLTAADSAVYFCARD
Gekko japonicus V81 trbv LNDG01135544.1 4387 CHFASDVTQMPTSQRLWEGDLFTMTCSYSTAYQPFFWYHQRPGSAPTFLFPVNSNDNNVTEGRFTIESFENGKQRRLYLPGSQLRDSGVYFCAARAQ
Gekko japonicus V80 trav LNDG01135543.1 10996 CRSNSEEVIQTPTSQHLWEGDLFIMSCNYSTAFRTFFWYRQRPGSAPTILLSVNSNNNITEGRFTVESFENGKQRHLYLPGSQLQDSAVYFCAVE
Gekko japonicus V79 trav LNDG01135541.1 9397 VSGQQDTISQGASASAKEGDPVRLNCSFTGTQYIAHWYKQYPRGQLQFMALLSASGSKPGDSFVMSLDTKNKTTSLYLNSTRLQDSALYFCAL
Gekko japonicus V78 trav LNDG01135541.1 7578 VSGQQDTISQGASASAKEGDPVRLNCSFTGTQYIAHWYKQYPRGQLQFMALLSASGSKPGDSFVISLDTKNKSTSLYLNSTRLQDSALYFCAL
Gekko japonicus V77 trbv LNDG01135151.1 5882 GAKAEITQQPSLILQEGQDAHFKCRQTNKHDHMYWYRQKAGQGPEFLYYFFKKEEQQKGDVLDQFSATQPEDYHLSLTISPVKQKDSAAYLCASSQ
Gekko japonicus V76 trbv LNDG01135151.1 45 GSNAEILQQPSLVLQEGQDAHFKCRQTNNHDYMYWYRQKAGQGPEFLYDFFNKEERLKGNISERFKAKQPEKYRLNLNISHVQQEDLAVYLCASSQ
Gekko japonicus V75 trbv LNDG01135150.1 15281 VANAEITQQPNLVLQEGQDAHFKCRQTNNHDYMYWYWQKAGQGPEFLYYFLRKEEQLKGDVPKRFVAKQPQEHHLILNISAVKREDSAVYLCASSQ
Gekko japonicus V74 trav LNDG01135150.1 6859 CSDAGVTQQPSLDLQESQTARMKCGQTNGHNAMYWYRQDVGQGLQLLFSFYNTEPEHKGNVSQRFTAAQPQNDNSNLEISPAEQKDSAVYFCATSF
Gekko japonicus V73 trbv LNDG01135148.1 9643 RPDPDIIQPRSLILQEDQAVHMKCEQRKGHNAMYWYRQKVGQALELLFAFQNNVQTAKGNSLERFEAQQFETKILYAEYLSVKPEDSSVYFCASSQ
Gekko japonicus V72 trbv LNDG01135148.1 6160 RSDPDIIQPRSLILQEGQAAHMKCEQRKGHNFMYWYQQKAGQALELLFVFQANSLVHKGNNLERFEAQQFETKYCKLNISHVKPEDSSVYFCASSQ
Gekko japonicus V71 trbv LNDG01135148.1 4388 LSDPDIIQPRNLILQEGQAAHMKCEQRKGHNVMYWYRQKAGQALEFLFVFQVNSLVHKGNNLERFEAQQFETKFCTLNISDVKPEDSSVYFCASSQ
Gekko japonicus V70 trbv LNDG01135148.1 2111 LSDPDIIQPRSLILQEGQAAHMKCEQRKGHNAMYWYQQKAGQALELLFAFQANSLVHKGNNLEHFEAQQFETKFCTLNISDVKRKDSSVYFCASSQ
Gekko japonicus V69 trbv LNDG01135147.1 24200 LSDPDIIQPRRLILQEGQTAHIKCEQRKGHNVMYWYQQRAGQALEFLFAFRSNSLVHEGNNVERFEAQQFESRYCTLNISDVKPEDSSVYFCASSQ
Gekko japonicus V68 trav LNDG01135147.1 21557 CSSAAVSQPPSRVLQEGHTAQLECQQTDGHNYMYWYRQGTGQGLQFLLYFYHQNEQERGNISQRFRARQPEKGHLNLNISSVKPEDSAVYLCASSQ
Gekko japonicus V67 iglv LNDG01126718.1 111 SRSEVVLTQPPSLTSAPGSTVQISCSVSGQSINDERARWYQQKSGGVPRFLYHYYKSNDQGRGSGVPERFTVSPDTSNNIWNLVITGVQAEDDADYYCCTWDINLSS
Gekko japonicus V66 ighv LNDG01120361.1 9726 VQSDVTLVESGGGVKRPRDSLQLTCSTSGFNIDDYWMNWVRQAPGKGLEYIAQINKATTFYANIFRGRFTISKDSSKRQVYLHMTSLKAEDSAAYYCARE
Gekko japonicus V65 ighv LNDG01120361.1 1997 VILTQEGSELKRPGESFRLTCATSGFVLNDFYTAWVRQKPGQGLEWLLFYQKSSATKYYSPATQGQFTASKDNFSFYLEKDNLKQEDTAVYYCAR
Gekko japonicus V64 ighv LNDG01120360.1 4512 VQSDVTLVESGGSVKRPGDSLQLTCTASGFSIDSYWMHWVRQAPGKGLEWIARINTGTTYYANAFKGRFTISADSSKQQTYLRMTSLTAEDTATYYCTRE
Gekko japonicus V63 ighv LNDG01120360.1 1935 VQSDVTLVESGGGVKRPGDSLQLTCTASGFNIDSYWMNWVRQSPGKGLEWVARINAGRTFYASAVTGRFTISADSSKQQIHLHMTSLKAEDTAMYYCAR
Gekko japonicus V62 ighv LNDG01120359.1 3150 VQSDVTLVESGGSVKRPGDSLQLTCTASGFSIDSYWMHWVRQAPGKGLEWIARINTGTTYYANAFKGRFTISADSSKQQTYLRMTSLTAEDTATYYCAR
Gekko japonicus V61 ighv LNDG01120357.1 36138 AASEIVLTQSGPEVKRPGESTRLTCSTGGFDLSSYTMHWIRQPPGKGLEWLLYYYSSSSNSYSPAIRGRFTASKDSSNLYLQMNNLKPDDTAVYYCARE
Gekko japonicus V60 trgv LNDG01110730.1 9759 VLSRVTLVQWGPEKAKPGESIKLNCAVHGYYISKGYWWSWIRQSPGKGLEWLAVIRYSGETYYAPALQSRISISKDNSRNQFYLQVSSLTVADAATYYCAG
Gekko japonicus V59 ighv LNDG01110727.1 3280 VLAEVQLVESGGNLKKPGESVHLSCRASGFTFSNYWMSWVRQAPGKGLEWVARIATSSSYISYSDLVRGRFTISRDDSSSLLKLQMNNLKPEDTAVYYCAR
Gekko japonicus V58 ighv LNDG01100465.1 333 VVLTQGGSEMMRPSESIQLTCSTSGFVVTDYWMAWVKQKPGEGLKWLLWYRKSSETKYYSSTIQGRFTASKDSSNFYLQMNSLKVEDTTVYYCAKQD
Gekko japonicus V57 iglv LNDG01080880.1 4487 VSSQLTLTQPPSHSTSSGQTTKLSCTVSGNKNHFGWLQQRSGQAPRFLFYGSGRGSGVPDRFSVSESGNTGYLTIVYLQAEDEADYFCYTWYSSGSQ
Gekko japonicus V56 iglv LNDG01080880.1 850 ASSQHTLTQPPSQSGSLGQTTKLPCTISSNKNAFGWVQQIPGQAPRFLFYSSTRGTGVPDRFSVSESGNTGYLSIGNLQPGDEADYYCYMWPSGASQ
Gekko japonicus V55 iglv LNDG01080879.1 2437 ASSQHTLTQPPSQSGSLGQTTKLPCTISSNKNAFGWVQQIPGQAPRFLLYSSTRGTGVSDRFSVSESGNTGYLSIGNLQAGDEADYYCYMWPGGASQ
Gekko japonicus V54 iglv LNDG01073797.1 2251 SFAQYVLTQPPSVSTSLEQNAQITCSGNNIGSKSVHWYQQKPGMAPLLIIYNDNSRPSGISDRFSGSNSGNTASLTISRAKAEDEANYYCQVWDSNA
Gekko japonicus V53 iglv LNDG01073796.1 2577 SISQPTLTQPPSASVSPGNTVKVSCAISSGSSFTSYVVWYQQKPGNPPRYLLSYRTDSDKNQGSGVPSRFSGSKDASGGTGYLSIGGALAEDEAGYHCAT
Gekko japonicus V51 trav LNDG01073791.1 10037 SNSQDVISQPPSASVSPGSTVKLSCIMSSALSISGYAVHWFQQKPGNPPRFLLWYSSDSSKGQGSGVPSRFSASKDATSNTCYLNIAGALAEDEGDYHCAV
Gekko japonicus V50 iglv LNDG01073790.1 22317 SNSQPVLTQPPSVAVAPGNTATLSCVLSRAFSISGQYIYWYQQTPENPPRFLVRYYSDSNVLQGSRVPSRFSGSKDASANTAYLTITGSLAEDEADYYCLTAY
Gekko japonicus V49 iglv LNDG01073788.1 2183 SNSQPVMSQPPSASVSPGNTVKLSCVMSSGFQISAHDTYWYQQKPGNPPRFLLYYYSDSSKQQGSGVPSRFSGSKDTTSNTGYLTIVGALAEDEGDYYCAT
Gekko japonicus V48 iglv LNDG01073787.1 10089 SESQPVLTQPSSALVSPGNTAKISCVIGSGISIGGLHTYWYQQKLGNPPRYLLRYYSDSNKHQGSGVPSRFSGSKDTSTNTAYLTISGSLPEDEAAYYC
Gekko japonicus V47 iglv LNDG01073787.1 6265 SFAQYVLTQLPSMSVSLQQNAQITCSGNSIGGRFVHWYQQKPGMAPLLIIYEDSKRPEGISDRFSGSNSGNTATLSIARAKAEDEADYYCQVWDSSA
Gekko japonicus V46 iglv LNDG01073786.1 24462 SFAQYVLTQPPSVSVSLGKNAQITCSGSNIRGSFMHWYQQKPGMAPVLIMINSNGSPPGISDRFSGSNSGNTATLTISRAKVEDEADYYCQVWASST
Gekko japonicus V45 iglv LNDG01073786.1 12520 SSSQPVMTQESSMSASPGQTVKLSCSMSSGYPVQNYEQVWLQQKPGSPPKFLFYYYTSPSPGSGDLSRFSSTKESSQNTWYLTITNVQAQDEAD
Gekko japonicus V44 trav LNDG01073786.1 9496 ASSQPVVTQEPSMSASPGQTVKLSCSLSSGQVTSYYQSWYQQKPGSPLKYLVYYYSSSNTGSGDFSRFSSSKESSQNTWYLTISNVQAKDEGDYHCAVWYASASV
Gekko japonicus V121 trbv LNDG01059627.1 20306 ASSDTQLTSSGPGMVRPGENLSLLCKVTGVSISSSSYLWNWIRQPPGKALEWIARIYPYDGRKFYSSSLQSRASVSADTAANQFSLQLNTLTAADSAVYFCARDGHL
Gekko japonicus V120 trav LNDG01049327.1 25 ASQSNSVFQSPNQMEVQEGQSAILHCNFSTLSTTPYLFWYRQYVDREPQLILRAYKNREQKNSFSLGKFSTTLFVENKTVPLKIEGVSLQDRAVYFCALS
Gekko japonicus V119 trbv LNDG01049327.1 421 PVQSDAVFQPYSKMSFIAGQEAILLCNFSTTDTSPYLFWYRQFPNKSPEHMLTITKFSSVNQDLSSAKYSGNLTLEKKTVDLTIKEASLQDAAVYFCALR
Gekko japonicus V118 ighv LNDG01049211.1 1048 VSSQALVESGGGIKRPGESLKLTCTVSGFSLSSYEVLWVRQPPGKGLEFLALIRAAGSTEYNSALRNRISITKDNSKEQVFLQVNGLKPEDTCIYYCSR
Gekko japonicus V117 ighv LNDG01049211.1 5037 VFSQSLVETGGGVKSPGGTLQLTCTVSGFSLTSYGVIWVRQPAGKGLEWIGVVWGGGSTEYNPALQSRLSITRDTSKSQVYLQMNGLKSEDTATYYCA
Gekko japonicus V116 ighv LNDG01049210.1 1278 VSSQALVESGGGTKRPGETLKLTCTVSRFSLSSYETQWLRQPPGQGLEWVGLIRADGSITYNSALRNRVSITKDNSKEQLFLQVNGLKPKDTCIYYCAR
Gekko japonicus V115 ighv LNDG01049210.1 5485 VLTQRGSELKRPGESVQLTCATRGFIITDWWMEWVRQKPGEGLEWLVHYWKSSKTNYYSPTIHGRFTASKDSTNFYFQMSSLKVEDTAVYYCTAG
Gekko japonicus V114 ighv LNDG01029059.1 16985 IRLLESGGNVIKPGQSLRFSCQAPGFGFSSYWMSWVRQAPGKGLEWVGQINPTESEQYQSGSMAGRFTLSRNNPSNMLYLQMNSLKLEDIAVYYCARD
Gekko japonicus V113 ighv LNDG01029059.1 20797 VQSEIQLMESGGEVKRPGESLRLSCQASGFNFGSYSMFWVTQVPGKGLKWVAWIHDNGNQVRYADSVRGRFTISRNNPSNTVYLQMSSLKLEDTAVYYCAR
Gekko japonicus V112 trav LNDG01028840.1 286 SAFGDPVFQAKATVAVPEGKSILLPCRYETSYSPTLFWYEQHPNEGPQFLVSSSSKEAKGLVAHHDKQETSFNLTKVSGELRDSAVYFCAMS
Gekko japonicus V111 trav LNDG01028839.1 385 IGQRDSVSQPLSKMSIMEGQEAIFNCSFNTTYDNFDLFWYRQFPHKLPEHILTQKKYSPPNQRLSSEKYSGKLDPEKKIVNLKIEQVSLQDAAVYFCALS
Gekko japonicus V110 trav LNDG01028838.1 2758 SDGQFVNQSEGTMAVTQGHPIFLECKYKPYSSQDYPFWYVQHPGEPPKIFLKDLGRDGSDEGVRQGFDAKHDKNLKTFHMTKPTSQLSDSAVYFCAVS
Gekko japonicus V109 trav LNDG01028838.1 11071 CRGDSEVVQKPAVQNVWEGDLSTITCSTPYAHRPIFWYHQLPGSAPSLRLSMTTKENVTEGHFTAERSADGKQSLLHISGICLHDSGIYLCASD
Gekko japonicus V108 trdv LNDG01028835.1 146 ILCNAQPEQDSLVIASEGREANLSCRHPSSTSDTIFWYRQFPNKTVHFIVSGYFSGSKSSAPEGVLDVRNDRKENVFSITKAALLDSAVYYCALSGTV
Gekko japonicus V107 trbv LNDG01028833.1 177 TTGEKVTQPLGPLLIKEAAPLFINCTYESTGYPTLFWYIQRSGSRALELLLKEGPEEQRGDGFSAKNNRTAKSFNLQKRASDMNDSAMYFCATS
Gekko japonicus V106 ighv LNDG01018987.1 2187 VVLTQKGSELKRPGESVRLTCSTSGFVLNDWYTAWVRQKPGQGLEWLVRYHKSSATNYYSPTIQGRFTASKDSSNFYLQMDNLKQEDTAVYYCAR
Gekko japonicus V105 trbv LNDG01014138.1 2121 TFSDIQLTTSGPGMVRPGENLHLFCTVSGLSVSAQYSVWHWVQRFPGKHLEWLALLYPYDGSKGFAPSLQSRLTISSDTSKNQVFLQLNSLTAADSAVYFCVREP
Gekko japonicus V104 iglv LNDG01014007.1 2735 VTSQPTLTQPASQSVSLGQMVKFSCTVSSSMGTIYWYQQRVGKAPRFVLYGTSNRGDGIPDRFTGSTSGNTGYLTVTNTKPEDEADYYCGMWYSN
Gekko japonicus V103 ighv LNDG01011669.1 4915 AESQGNTKIQPKAEEILASPGTEVTIHCSLPSWQSRTSTGVPWYKEELNRSLRMIYASSSYSKPDGKYSGPSNTRPYGSLTISNVQRNDSGVYYCTA
Gekko japonicus V102 iglv LNDG01200025.1 1806 ASSQPTLTQSPSQSVSLGQTVKFSCTVSSDKNTVCWVQQRSGQSPRFIHCAGYSSRGDGVPDRFTATDSGNVGSLTITNTQPEDEADFYCYMWYSSGKM
Gekko japonicus V100 trdv LNDG01190581.1 165 CNAQFTMTQPPSVSASEGETIKVTCRRSSGSISDYYNSWYQQKPGSAPILLIYDHSSRASGISDRFSGSLDSSANAAVLTISSVQVDDESDYFCASYDSSW
Gekko japonicus V99 iglv LNDG01183227.1 267 SDSQPVLTQPSLASVSPGDPKKLSCVMGSGFSISGYTVYWYQQKPGNPPRYLLYYYSDSSKHQGSGVPSRFSASKDTSSNTCYLNNAGALAEDEADYYCAV
Gekko japonicus V98 ighv LNDG01179349.1 1269 VQSDVTLVESGGSVKRPGDSLQLTCTASGFSIDSYWMHWVRQAPGKGLEWIARINTGTTYYANAFKGRFTISADSSKQQTYLRMTSLTAEDTATYYCTRE
Gekko japonicus V97 iglv LNDG01176811.1 879 ASSQPALTQPPSQSVAPGQTVKLSCTVSSDKNGFCWIQQRSGQSPRLIQCVGGSRGDGVPDRFTATASGNVGSLTITNTQPEDEADYYCCMWYTSGRM
Gekko japonicus V96 iglv LNDG01174221.1 1171 CNAQFTMTQPPSVSASVGETIKVTCTRSSGSISSYYNSWYQQKPGSAPIQLIHQHSTRASGISDRFSGSIDSSASAAILTISSVQAGDEAHYYCASYDGSW
Gekko japonicus V95 ighv LNDG01169721.1 290 VLSEVQLIQPGSKVVKPGETLSLTCRVSSSDASESTDAYYWNWIRQPPGKGLEWMGDIDPESDDTDYGPAFQSRISISADSSSKEIHLQLSSMATEDTATYYCAR
Gekko japonicus V94 ighv LNDG01168115.1 1308 VVLTQGGSEMKRPSESIQLTCSTSGFVVTDYWMAWVKQKPGEGLKWLLWYRKSSETKYYSTTIQGRFTASKDSSNFYLQMNSLKVEDTAVYYCAKQD
Gekko japonicus V93 trav LNDG01167359.1 346 SVGQSVNQSEGTLTVTQGQPIFLRCGYTSPVQVYPFWYVQHRGQPPKVFLREVGRDGSEEGARQGFDADHNKTSKSYNMKKAASQLSDAAIYFCAVS
Gekko japonicus V92 ighv LNDG01160220.1 2929 SFSSLQVTQSGPAMMKPGGSFKVTCIVSGGQVNDYYWNWNRQLPGKVLEWLGFIRSTDRGGTTQHSPTFSSRISTTRDNSRNEVYLQLSSLTAADTAVYYCAG
Gekko japonicus V91 ighv LNDG01151371.1 1336 VLSEVTLVESGGDVKRPGESLRLSCRASGFTFSSYWMHWVRQAPGKGLEWVAYVNSDGSAQNYAGSVRGRFTISRDNPSSMVYLQMSSLKPEDTAVYYCA
Gekko japonicus V90 trbv LNDG01141867.1 5487 TTGERVTQPPGPLLIKEAAPLFVNCTYESTGYPTLFWYIQRSGSRALELLLKEGPEEQRGDGFTAKNNRTAKSFHLQKRASDMNDSATYFCAMS
Gekko japonicus V89 trav LNDG01135550.1 2327 RTTAQSVKQSQGTVTVTQGNWILLECSYDETTLYQYYPFWYVQHPGQPPKLFLRDAGKKSDSGDGIRQGFEADHIKKNKTFHMWKPTSQLNDSAVYFCAVS
Gekko japonicus V88 trav LNDG01135548.1 18201 WTTGLSVKQLQGTVTVPQGNLILLKCSYDGTLIGQYYPFWYIQHPGQPPKLFLRDVGQSLLGDGIRQGFEADHVKKNKTFHMRKPTSQLSDSAVYFCAVS
Gekko japonicus V87 trav LNDG01135548.1 13634 WCSESQVTQTPLSQNIQEGDPFTITCDFPAGYGSFFWYLQLPGSAPSLKVYITSKENVTSGRFLAERRENGKQSRLHLSDSRLHDSGVYWCAAA
Gekko japonicus V86 trdv LNDG01135548.1 7240 TIQGDPIFQTEAPVAIGEGQRVSLPCRYETSYLTTLFWYEQPPSKGPRLLVSSLPGQDEEARKHGRGFTAHLNKTETSFNLTKDSVELRDSSVYFCALS
Gekko japonicus V85 trbv LNDG01135547.1 1937 LPCQAEITQEPLVVASEGRELNLSCSHPSASSETIFWYRQFPSQGPRSIASTFSKPAESTDPPGVLYVSSDRKRSVFSFSKVTRVDSAVYLCALS
Gekko japonicus V84 trav LNDG01135546.1 7293 SVGQSVNQSEGTLTVTQGQPIFLRCGYTSSVQVYPFWYVQHRGQPPKVFLREVGRDGSEEGARQGFDADHDKTSKSYNMKKAASQLSDAAIYFCAVS
Gekko japonicus V159 trav LNDG01100442.1 3441 AFSDIQLTSSGPGTLRPGENLNLVCKVTGVSITDSSYGWNWIRQPPGKELEWVAYIYLYNGNKYYASSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCARN
Gekko japonicus V158 ighv LNDG01100442.1 5931 VLLQVVLPQSAPAVKKPGESHKLSCAITRFDINSYYMSWVMQKAAKKLEWLVQYYRPGSGNSDYSPAIQGRFTASKDSSNFYLKMGSLKAEDTAVYYCSR
Gekko japonicus V157 trav LNDG01100442.1 8343 AFSDMQLTLSGRGTLRPGENLNLVCKVTGFSITTQDYGWDFIRQPSGKGLEWVAGIYPDDGGKWYNPSLQSRATISADSSKNQVSVQLNSVTAADSAVYFCARG
Gekko japonicus V156 trav LNDG01100442.1 11433 AVSDIQLTSSGPGTLRPSENLNLVCKVTGFSISTRYYAWNWIRQPPGKGLEWVAHIYLYDGGKYYASSLQSRATISADSSTDRFSLQLNSVTAADSAVYYCAR
Gekko japonicus V155 ighv LNDG01100441.1 4041 VQLVSSGPGTLRPGENLSLVCKVTGVSITDSSYAWHWTRQPPGKGLEWVGRIYLYDGSKYNASSLQSRATISADSSKNQFSLQLTRLTAADSAVYYCARQ
Gekko japonicus V154 igkv LNDG01100229.1 2598 SRSQVVLTQPPSLTSAPGSTVQISCSASGQSINDESARWYQQKSRGVPRFLYNYYRSNNQKRGSGVPERFTVSPDTSRNLWNLVITGVQAEDDAGYYCSTWDIKLSS
Gekko japonicus V153 igkv LNDG01100228.1 6644 ALAQGTLTQPPAASTSPGETVRIPCTRSSGSITSYYVSWYQQKPGSVPKLMLYKYSERPTGIPDRFTGSTDSSANSATLTISNTQAEDAADYYCFSYVGNDQ
Gekko japonicus V152 iglv LNDG01100228.1 10018 TFAQFVLTQPPSSSASPGETVKILCTRSSGGIRDSYVSWYQQKPGTAPKLLIYQFSNRYSGISDRFSGSTDTSANSATLTISGVQAEDENDYYCLSYTSSNQ
Gekko japonicus V151 iglv LNDG01100228.1 21539 VTQQPSMAKAPGSTVNIPCALSSGYSISADRVRWFQQKPGGAPLFLYHYHKSDDQGRGSGVPERFTVSPDTSNNLWNLAITGVQAEDDADYYCCAWDNKLSS
Gekko japonicus V150 iglv LNDG01100227.1 2845 CDARYTMTQPPSVSASIGKTVEITCTKSGGSLDKYDSSWYQQKPGSPPILLIYRDASRASGISDRFSGSTDTSALSATLTISSMQAEDEADYYCLYIESASE
Gekko japonicus V149 trbv LNDG01100226.1 3851 VSSQPWTQPASESVSLGQTGKLSCTTDSGSYAIHWYQQKPGQAPRFVHCQGCSRGEGIPDRFTASVSGITGHLTITGTQPEDEADYFCAKWNSGGSQ
Gekko japonicus V148 trbv LNDG01090707.1 298 CHSASDVTQAPTSQHLSEGDVFTTTCSYSTAYQTFFWYLQLPGSAPAFLFSEGISKGNVTKGRFTLESLENGKQQRLYLPGSQLHDSGVYLCAVT
Gekko japonicus V147 trbv LNDG01090706.1 285 IPSSSPQIKWKSKKGSPQFCTAISPLSAQLHTFSGIVNMWTDQVILRAYKNSKQKNSFSLGKFSTTLFVENKTVPLKIEGISLQDGAVYFCALS
Gekko japonicus V146 trav LNDG01090705.1 2549 CHSASDVTQAPTSQHLSEGDVFTTTCSYSTAYRTFFWYRQLPDSSLTFLFSEGTSNNNVTKGRFTLESLENGKQQRLYLPGSQLHDSGVYFCAVT
Gekko japonicus V145 ighv LNDG01090513.1 2139 SFSSPQFTQSGPAMVKPGGSFKVTCAVSGVQVSDHFWGWNRHLPGKSLEWLGNIQSTSAGGNTYYNSAFGSRISVTRDSSRNEVYLQMSSLTAADTAMYYCAR
Gekko japonicus V144 ighv LNDG01090513.1 5567 TFSSPQLTESGPAMVKPGGSFKVTCTVSGVQVSDHYWEWNRHLPGKRLEWLGFIRDTERGGTTKYSPAFSSRISVTRDTSRNEVYLQLSSLTASDTATYYCA
Gekko japonicus V143 ighv LNDG01090513.1 15463 LQNDLQDPFHFAQNQNPGQSLSLTCAVTGYFVSGGAYFSWIRQPQGKGLEWIGRIDWPGSRRRTNDASSLQRRISISADTSASSISLQLSSLTAADTATYYCAR
Gekko japonicus V142 ighv LNDG01090513.1 20261 TFSSPQLTQSGPAMVKPGGSFKVTCTVSGTQVSDYYWHWNRQLPGKSLEWLGFVRSTSAGGTTHYNSAVSGRISVTRDTSRNEVYLQLSSLTAADTAVYYCAR
Gekko japonicus V141 ighv LNDG01090513.1 22589 TFPSPQLTQSGPVMVKLGGSFKLTCTVSGAQVSDYYWNWNRQLPGKCLEWLGFIRSTSAGGTTHYSSAFSGRISITRDTSRNEVYLQLSSLTAADTAAYYCA
Gekko japonicus V140 ighv LNDG01090512.1 5880 TFSSPQLTQSGPVMLKPGGSFKLTCAVSGTQVSYEYWAWHRQVPGKSLQWLGNIRNTGDGGTSYYNSAFGSRISVTRDTSRNEVYLQLNSLTATDTATYYCVR
Gekko japonicus V139 ighv LNDG01090512.1 9463 TFSSPQLTQSGTAMVKPGESFKLTCTVSGVQVSGYYWGWNRQLPGKNLEWLGNIRSTSAGGSSYYSSAFSGRISVTRDTSRNEVYLQLRSLTAADTAAYYCVG
Gekko japonicus V138 ighv LNDG01090512.1 14464 TFSSPQLTESGPAMVKPGESFKVTCTVSGAQVSDYYWNWNRQSLRKGLESLGYIRDTANGGTTQYSSAFSGRISITRDISRNEVYLQLNSLTAMDTATYYCA
Gekko japonicus V137 ighv LNDG01090512.1 18054 LSSQLQLQESGPEVLRPRETLQLTCTVTGVTITGGYGYGWDWVQQSPGKGLVWMGYWTKSTNYAPAFRDRMSITVNPSNTKYFLTLTSVTAADSATYYCARV
Gekko japonicus V136 ighv LNDG01090511.1 2386 SFSSLQVTQSGPAMMKPGGSFKVTCIVSGGQVNDYYWNWNRQLPGKVLEWLGFIRSTDRGGTTQYSPTFSSRISITRDNSRNEVYLQLTSLTAADTAVYYCAG
Gekko japonicus V135 ighv LNDG01069155.1 2827 ASSQMVLTQSGSVLRKPGESHQLTCATSGFDSSNWIAWTRQKPGKGLEWLANYYSSGDEHYSPTIQGRFTGSKSGSTFYLQMSSLKVEDSAIYYCSR
Gekko japonicus V134 ighv LNDG01069155.1 6277 ASSQVVLTQSEPVLKKPGESHRLTCATSGFDLSGYWMIWVRQKPGKGLEWLVYYYTPGSGSEFYSPAIQGRFTASKSGSNFYLQMNSLKVEDTAVYYCA
Gekko japonicus V133 ighv LNDG01069155.1 11014 ASSQVVLTQSEPVLKQPGESHQLTCATSGFTLSSTWMGWVRQKPGKGLEWLVYYYSPGSNEHYSPAIRGRFTSSKSGSNFYLQMSSLKVEDTAVYYCAR
Gekko japonicus V132 ighv LNDG01069155.1 18364 ASSQVVLTQSEPILKNPGESHRLTCATSGFELSSTWMNWVRQKPGKGLEWLIWYLKPGSGYEYYSPAIQGRFTASKSGSNFYLQMSSLKVEDSAVYYCAR
Gekko japonicus V131 ighv LNDG01069155.1 20326 TSSQVVLTQSESVLKQTGESHRLTCATSGLTLSNTWMNWIRQKPGKGVEWLVNYYSPSTEYYSPAIQGRFTSSKSGSNFYLQMSSLKVEDSAIYYCAR
Gekko japonicus V130 ighv LNDG01069155.1 27566 ASSQVILTQSEPVLKQPGESHRLTCATSGFTLNDYYMDWVRQKPGKGLEWLVHYYRHGSGEHYSPAIQGRFTASKSGSNFYLQMSSLKVEDTAVYYCAR
Gekko japonicus V129 ighv LNDG01069155.1 31230 ASSQVVLTQSEPMLKQPGESHRLTCATSGFTLSSYYMNWVRQKPGKGLEWLVRCRYYMPGFAHEFYSPAIQGRFTASKSGSNFYLQMNSLKVEDTAVYYCAR
Gekko japonicus V128 ighv LNDG01069155.1 38232 VQSEVKLVESGGDVKRPGDSLLLSCRTSGFTFSSYYFAWVRQAPRKGLEWVAYIGTYSSPIYYSDSVRGRFTVSRDDSNSLLKLQMNNLKLEDTAVYYCAR
Gekko japonicus V127 ighv LNDG01069155.1 56767 ASTQVVLTQSEPVLKTPGESHRLTCATSGFDLSSTWMNWVRQKPGKGLEWLVRYYNTVSGNSYYSSVIQGRFTASKSGSSFYLQMSSLKVEDTAVYYCAR
Gekko japonicus V126 ighv LNDG01069155.1 64795 VQSEVKLVESGGDVKRPGDSLLLSCQASGFTFSSYAMNWVRQAPGNGLEWVAFIHTSSSHIYYADSVRGRFTVSRDDSNSLLKLQMNNLKLEDTAMYYCAR
Gekko japonicus V125 iglv LNDG01060016.1 347 ASSQPALTQPPSQSVAPGQTVKLSCTVSSDKNGFCWIQQRSGQSPHLIQCAGGSRGDGVPDRFTATASGNVGSLTITNTQPEDEADYYCCMWYSSGRM
Gekko japonicus V124 ighv LNDG01059627.1 6716 VQLVESGGDVKRPGESLRLSCRASGFSFEGSHMNWVRQTPGKGLEWVAFISNGGSSQYYASSVRGHFTISRSNPSSMVYLQMDSLKLEDMAMYYCARD
Gekko japonicus V123 ighv LNDG01059627.1 12899 VLSEVQLVESGGDIKRPGESLRLSCRASGFRFRDYGMHWVRQAPGKGLEWIAHIYSDGSQQFYASSVQGRFTITRNNPSNMLYLQMGSLKLEDTAVYYCAG
Gekko japonicus V197 trav LNDG01140774.1 167 AVSDIQLTSSGPGTLRPGENLNLVCQVTGFSISTRYYAWNWIRQPPGKGLEWVAHIYLYDGGKYYASSLQSRATISADSSTDRFSLQLNSVTAVDSAVYYCAR
Gekko japonicus V196 trav LNDG01140774.1 4203 AFSDIQLTSSGPGTLRPGENLNLVCKVSGFLITMQYYYWFWIRQPPGKGLEWVAEIYPYDGSKWYSSSLQSRITISADGSRNQFSLQLSSMTAADSAVYYCVRE
Gekko japonicus V195 ighv LNDG01136391.1 3987 VHCSIQLRESGPGTVKPEKSFRLICAITGDTVKNINVYWAWIRQAPGKGLEYLGWIAWFSSAWRTSYAPSLQGRITISADSSSNEYYLQLSSLTTADTATYYCARQ
Gekko japonicus V194 trbv LNDG01135152.1 79077 DASPTITQNPPSVTGWLGSNISVDCNLKGYGNPNFYWYRQIPGGPMEMLFYSVNKGDIETTGPGHIKASRPEDNRFGLSIPSLTADDTGVYFCAWSH
Gekko japonicus V193 ighv LNDG01131251.1 1801 VLSQVVLTQSDPVVKKPGESHKLTCAVTGFNPNSYWMDWFRQKPGKELEGLVHYYTSGSKYYSSAIQGRFTASMDSSNFYLQTNSLKAEDTAVYYCAR
Gekko japonicus V192 ighv LNDG01131251.1 6376 VHCDVQLRESGPAFVKPGESIRLTCAITGDLVTNTNVYWAWIRQAPGKGPEWVAEIDMSPSGWRRRYAPSLQLSISADAAKNEYYLQLTSVTAADTARYYCAR
Gekko japonicus V191 ighv LNDG01131251.1 17860 VHSAIQLVESGGDVKRPGESIRLSCQASGFDFGSTWMSWVRQAPGKGLVWLGEIRGDGQVQNYAPLVKGHFVISRNNPSNTLFLKMNSLKAEDTGRYYCAR
Gekko japonicus V190 ighv LNDG01131251.1 19115 TRTQVVITQSAAVVKRPGESTELTCTMDRAEEWWMSWLRQEAGKAPEWLVSYWKPSVQNHYASTIRDRFTASKSGSNFYLQMKTLKAEDTSVYYCTRRE
Gekko japonicus V189 trav LNDG01131250.1 47 VQLVSSGPEILRPRQNLNLVCKVTGVAIATRSYNWDWIHQPPGKGLEWVGRIYPYDGSKYYASSLRSRATISADSSKNQVSLQLNLVTAADSAVYFCTGD
Gekko japonicus V188 iglv LNDG01126401.1 2290 SLAQFSLLQPPAISVSPGGTVTLSCNHSDGGAMLAVYWYQQRGGESPRYLLGASAAVSLKLRSSGVPDRFNGSMDSSYTAGSLTITNVQAEDEAEYYCQ
Gekko japonicus V187 ighv LNDG01120959.1 8666 KILFSFYSQTLVETGGGVKSPGGTLQLICTVSGFSLTSYGVHWVRQPPGKGLEWIGVVWAGGSTDYNPALQSRPSITRDTSKSQVYLQMNGLKLEDTSTYYCAR
Gekko japonicus V186 ighv LNDG01120959.1 14405 AFSQSLVQIGGGVKKPGETLQLTCTVSGFSSTNYLVHWVRQPVGRGLEWIGVIGWVGDNLYNPALRSRLSISRDTSKSQFYLQMRGLKPEDSGVYYCTRE
Gekko japonicus V185 ighv LNDG01120959.1 16740 ISSQTLLESGGSIKRPGETLQLTCTVIGFSLSSNSMHWVRQPPGKGLEWVGRITAGGSLDYNSALRNRITITKDNSKGQMYLQMNSLKPEDTCIYYCA
Gekko japonicus V184 ighv LNDG01120959.1 18077 AFSQSLVQIGGGVKKPGETLQLTCTVSGFSSTNYLVHWVRQPVGRGLEWIGVIGWVGDNLYNPALRSRLSISRDTSKSQFYLQMRGLKPEDSGVYYCARET
Gekko japonicus V183 ighv LNDG01120959.1 22486 VSSQALVESGGGIKRPGESLKLTCTVSGFSLSSYEVHWVRQPPGKGLEWVALIRAAGSTEYNSTLRNRISITKDNSKGQLFLQVNGLKPEDTCIYYCAR
Gekko japonicus V182 ighv LNDG01120958.1 2414 ISSQTLVESGGGIKRPGDHLQLTCTVSGFSLSSYYMHWVRQPPGKGLEWVGRITAGGSLDYNSALRNRITITKDNSKGQMYLQMNSLKPEDTCIYYCA
Gekko japonicus V181 ighv LNDG01120777.1 1335 VLSEGQLVESGGDVKRLGESLRLSCQASRYDFSTYGMNWIRHASRQGLEWVAYINSGGGTQYYAGSVRGRFTISRNDPSNTAYLQMGSLKLEDTAVYYCARD
Gekko japonicus V180 trbv LNDG01120776.1 686 ALSDTQLISSGPGMVRPGDNLRLLCKVTGVSISSSCCAWNWFRQPPGKGLEWIARIYPYDGRKWHNPSLQSRTTISADTSANQYSLQLNTLTAADSAVYFCARD
Gekko japonicus V179 ighv LNDG01120775.1 4492 IQVQVQLVESGGGIRRPGESLRLSCKGSGYNFGGFQMSWIREAPQKGLEWVAYIDITTIHYANSVKGRFTISRDNSISMLYLQMNSLKEEDTAVYFCA
Gekko japonicus V178 ighv LNDG01120774.1 4229 VLGSVQLVESGPGTAKPGESLRLTCTITGDSVKSNFWEWIRQAPGKGLEWLGQIDWSGSRWRTYYAPSLQGRITLSADSSSNTYYLQLSSLTAADTATYYCAR
Gekko japonicus V177 ighv LNDG01120773.1 2781 VLSEVQLVESGGDVKRPGESLRLSCRASGFSFDNYEMNWVRQAPGKGLEWVAIIGSSGGTKYYASSVKGRFTMSRDNPSNMVYLQMDSLKLEDTAMYYCAR
Gekko japonicus V176 ighv LNDG01120773.1 6922 VLSQVQLVESGGDVKRPGESLRLSCRASGFNFGGYEMHWVRQAPGKGLEWVAYISSGGGSILYAGSVKRRFTISRDNPSSMLYLQMGSLKPEDTAVYYCARE
Gekko japonicus V175 ighv LNDG01120773.1 10754 VLSQVQLVESGGDVKRPGESLRLSCRASGFNFGGYSMHWVRQAPAKGLEWVAVISSTGGTIYYASLVKGRFTISRDNPSNMLYLQMGSLKPEDAAVYYCSRE
Gekko japonicus V174 ighv LNDG01120773.1 14085 VLSVVQLVESGGDVKRPGESLRLSCRASGFTFSNHAMEWVRQAPGKGLEWIVEISGNGGFQNYAGSVRGRFTISRDNPSNMLYLQMGSLKPEDTAVYYCAR
Gekko japonicus V173 ighv LNDG01105704.1 4540 VLSEVQFFQPGSKVVRPGDSLSLTCSVSLIDEILEFDIFNWGWVRQAPGKGLEWMGETAMFLMNVTYAPEFQSRITISADSSTNETHLQLSSMTAADTATYYCVRP
Gekko japonicus V172 ighv LNDG01105703.1 453 VLSEVQFFQPGSKVVRPGDSLSLTCSVSLIDEILEFEYYEWGWVRQVPGKGLEWMGHIYPLRENASYVPKSQSRITISAEPSTNETHLQLSSMTPADTATYYCVGL
Gekko japonicus V171 ighv LNDG01105702.1 1425 VLSEVQLGQPGSKVVKPGENLSLTCNISFSDASESIDVYYWSWIRQPPGKGLEWMGEIDPESDSPDYAPAFQSRISISADSSSKEIHLQLSSMATEDTATYYCAR
Gekko japonicus V170 ighv LNDG01105701.1 1942 VLSEVQLGQPGSKVVKPGESLSLTCTVSFSDASDGINDYAWSWIRQPPGKGLEWMGAIFPLLDSTNYAPAFQSRITILVDSSTSELHLQLSSIAAADTATYYCAR
Gekko japonicus V169 ighv LNDG01105700.1 1127 TFPSPQLTQSGPAMVKMGGSFKFTCTVSGAQVSDYYWNWNRQLPGKSLEWLGFIRDTERGGTTKYSPAFSSRISITRDTSRNEVYLQLSSLTAADTATYYCAR
Gekko japonicus V168 ighv LNDG01105700.1 1127 TFPSPQLTQSGPAMVKMGGSFKFTCTVSGAQVSDYYWNWNRQLPGKSLEWLGFIRDTERGGTTKYSPAFSSRISITRDTSRNEVYLQLSSLTAADTATYYCAR
Gekko japonicus V167 ighv LNDG01105700.1 4362 HSSQVQLQESGPGVVRPGEILELTCTATDDSSSNAWHCLRQSPGKRLVWMGLWNLGTIYAPAFRDRITISVDSSRTKSSLRLTSMTTADSAVYYCAVR
Gekko japonicus V166 igkv LNDG01105700.1 8388 TFPSPQLTQSGPTIAKPGGSFKVTCVVSGAQVMDYYWTWNRQLPGKLLEWLGFIRSTSAGGTSYYNPVFSSRISISRDISRNEVYLQLSSLMAADTAAYYCMG
Gekko japonicus V165 ighv LNDG01105700.1 10920 ISLSLQLTQSDPGAVKPGGSFKLTCAISGAQVSSTYWIWVRQPPGKGLLWVGRISGSGGTEYYPAFSGRISISRDTSRNEYYLQLSSVTDADTAVYYCAR
Gekko japonicus V164 ighv LNDG01105263.1 1819 VSSQTCTESGGGIKKTGETLQLTCTVSGLPLESNAMSWLRQPPGKIAEWMGDIWSGGGTAYNSVFQNRIRITKDDSKSQVFLQLSSLKPEDTSLYYCAKA
Gekko japonicus V163 ighv LNDG01105262.1 2149 CHSEDLLVESGGGIVLPGGSLRLSCKASGFTFTDYQIHWVRQAAGKGLEWVAGVSSSSGSTQWYNPNVQSRFTVSRDNSQTSSYLQMNSLKHEDTGLYYCA
Gekko japonicus V162 ighv LNDG01105262.1 9053 CHSEVLLVESGGGVVLPGGSLRLSCKASGFTFTDYRIHWVRQAAGKGLEWVAGVSQPSGSSQWYNSKVQGRFTISRDNSQMSASLQMNSLKPEDTGLYYCARK
Gekko japonicus V161 ighv LNDG01105262.1 14428 VLSQIQLVESGGDVKRPGESLRLSCQASGFTFSNYAMNWVRQAPGKGLEWIALIYSDGSKQFYASSVQGRFTISRNNPSNMLYLQMGSLKIEDTAVYYCAI
Gekko japonicus V236 ighv LNDG01180380.1 2662 VHCNIQLRESGPGTVKPGKSFRLTCAITGDTVTNVNVYWAWNRQAPGKGLEYLGRIDWYSSDWRTSYAPSLQGRVTISADSSSNEYYLQLSSLTAADTATYYCARQ
Gekko japonicus V235 trbv LNDG01180375.1 190 AFSDVQLISSGPGMVRPGENLSLVCKVTGLSISTSSYVSHWIRQPPGRSLEWIAAIQPHYGNKWFAFSLQSRCSVSSDTSTNHISLQLNSLTAADSAVYFCVGE
Gekko japonicus V234 ighv LNDG01180375.1 4095 CRSEVLLVESGGGIALPGGSLRLSCKASGFTFTSYNIHWVWQAAGKGLEWVAGVSGSGSTQWYNPKVRGRFTISRDNSQTSAYLQLSSLKPEDTGLYYCAR
Gekko japonicus V233 trav LNDG01180375.1 8061 VLSDIQLTSSGPELVRPGENLNLVCKVTGFSISAKHYAWHWSRQPPGRGLEWIGRMYVYLGTKDYTPSFQSRATISADGSRNQFSLQLNSLTAADSAVYYCIRQAE
Gekko japonicus V232 ighv LNDG01175371.1 9982 FSSQPLVETGGGMKRPGETLRLTCTVSGVHLTTHAVKWVHKPPGKGLEWVGDIWKAGSTYYSSALQSRASITRDSSKGHFFLQLKDLKLEDTGMYYCA
Gekko japonicus V230 iglv LNDG01169311.1 1360 ASSQPALTQPPSQSVAPGQTVKLSCTVSSDKNGFCWIQQRSGQSPRLIQCVGGSRGDGVPDRFTATASGNVGSLTITNTQPEDEADYYCCMWYTSGRM
Gekko japonicus V229 trav LNDG01166150.1 108 SQSDSVFQSPNQMEVQEGQSAILHCNFSTLDSSPYLFWYHQYVDREPHLILRASKNREQKNSAALGKFSTTLFVENKTVPLKIEGVSLQDRAVYFCALS
Gekko japonicus V228 trav LNDG01166150.1 505 TVQSDGVFQPHLETSFIAGQEATLLCNFSTIDPNPYLFWYRQFPNKSTEHVLTKMRFSSGGQELPLGKYSGNLTLDKKIVDLKIKEVSLQDAAVYFCALR
Gekko japonicus V227 ighv LNDG01164338.1 364 VLTQRGSELKRPGESVQLTCATRGFIITDWWMEWVRQKPGEGLEWLVHYWKSSKTNYYSPTIHGRFTASKDSTNFYFQMSSLKVEDTAVYYCTAG
Gekko japonicus V226 trav LNDG01163476.1 151 IQLTSSGPGTLRPGENLNLVCKVTGVSITDSRYSWDWIRQPPGKGLEWVAYIYAGSKYYAPSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCARE
Gekko japonicus V225 trav LNDG01161936.1 2006 SDGQSVNQTEGTVAVLEGHQILLGCRYPGSSSLDISPFWYVQHPGQPPKLFLKALGRDGSEEGARQGFDAKHDKTLNTFHMRKATSQLSDSAVYFCAAS
Gekko japonicus V224 trav LNDG01161875.1 2398 AFSDIQLTSSGPGTVRPGENLNLLCKVTGVSISAEYYYWHWIRQPPGKGLEWVGEVYPYNGVKKYNPSLRSRTTISADSSKNQVSLQLNSLTAADSAVYYCTKG
Gekko japonicus V223 trav LNDG01161863.1 1357 ALSDIQLTSSGPEMVRPGENLNLVCKVTGFSITAKHYAWHWSRQSPGRGLEWMGRMYVYLGTKDYTPSFQSHATISADGSRNQFSLQLNSLTAADSAVYYCIRQPE
Gekko japonicus V222 trav LNDG01156196.1 1024 ASGQSVNQSEGPIMVTQGKPIFLNCSYQSSFSAYPFWYVQHPGQSPKLFLSYLSNDGTEGARQGFNADHNKDLKTFNMRKTTSQLKDSAVYYCAVS
Gekko japonicus V221 trav LNDG01156196.1 5478 CEIHGDVSQPPEVRILLGATGQIPCNHSISAYDIIFWYKQRQGAPPQVVISGYSAKKEGKFTMDVEKASLSTKLSIEVAEMEDAVVYYCAVR
Gekko japonicus V220 trav LNDG01156195.1 1066 SLGRAQKIEQPGSATALGRTSYNLSCNLSSVTTEKVLWYRQFPGRGPQYIAGAFPGKTGESADSKSMLHFPEDKKSATLVLHHVTLSDAAVYFCALSD
Gekko japonicus V219 ighv LNDG01156085.1 1913 VQSAVTLSQPGSVQLRPSDTLRLTCSVSGFSLTSTGSVVSWVRQPPGKGLEWLCHVYWNDDKRYPDSLRSRLTISRYPSSSEFNLEMRGMQAGDTGTYYCAGG
Gekko japonicus V218 trav LNDG01146083.1 6840 VSQSDSVFQSRNQMEIQEGQPAVLFCNFTTLRSDPNVFWYRRYVDREPQLILHAYKNREQKNSFSLGKFSTTLFVENNTVPLKIEGVSLQDGAVYFCALR
Gekko japonicus V217 trav LNDG01146083.1 7414 IVHSDAVFQSYSEISITEGQEAILPCNFSNTDSNPYLFWYRQFPSKYLEHVLTKTQFPSGDRELSLAKYSGNLTLEKKTVDLKIKEVSLQDAAVYFCALR
Gekko japonicus V216 ighv LNDG01145576.1 42816 VQSAVTLDQSGPAQLRASETLRLTCYAYGFSLTDEGSSVSWIRQPPGKDLEWLCLVFWNDNKHYLGSLRNRLTVSRDTSKNQVYLEMRGMQTGDTGTYYCAGS
Gekko japonicus V215 ighv LNDG01145576.1 45477 VQLVESGGDVKRPGDSLHLSCRGSGFTFSSYYFAWVRQAHGKGLEWVAYIQSTSTYYSDSVKGRFTISRDNSNSLLHLQMTNLKPEDTAVYYCAG
Gekko japonicus V214 ighv LNDG01145576.1 47157 ALSKVQLVASGGDMKKPRDSLHLSCQGSGFTFSSYHFDWVRQAPGKGLEWVALIQANPTYYSDSVKGRFTISRDNSNSLLHLQMNNLKLEDTAMYYCVR
Gekko japonicus V213 ighv LNDG01145576.1 51636 ILSEVQLVESGGDVKRPGESLQLSCQASGFSFGSYRFNWVRQASGKGLEWLAYISTSSNPIYYSDSVKGRFTISREDSNNLLKLQMNNLKTEDTAVYYCA
Gekko japonicus V212 ighv LNDG01141216.1 547 VQLTSSGPGVVRPGENLSLLCKLTGISISSSTYAWNWFRQPLGESPEWIAEIYPYGGKQWQNPSLRSRMTISADTSKNEFSLQLTSLTAADSAVYYCAR
Gekko japonicus V211 ighv LNDG01141216.1 3915 LLVETGGGIVMPGGSLRLSCKASGFTFTSYQIHCVRQKELEWVAGVSSSSGSTQWYNPKVQGRFTTSRDNSQTSAYLQMSSLKPGDTGLYYCAR
Gekko japonicus V210 ighv LNDG01141216.1 6955 ALSDIQLTSSGPEMVRPGENLNLVCKVTGFSITAKHYAWHWSRQPPGRGLEWIGRMYVYLGTKDYTPSVQSRTSISADGSRNQFSLQLNSLTAADTAVYYCIRQPE
Gekko japonicus V209 ighv LNDG01141216.1 9037 VLSEAQLVDSGGDIKRPGWSLRLSCRASGFTFTNYGMHWVRQAPGKGLEWIALIYYDGSKQFYASSVQGRFTISRNNPSNMLYLQMDRLKTEDTAVYYCAR
Gekko japonicus V208 trgv LNDG01140992.1 267 SSSQSTLSQPAAASVSPGNTVKLSCVMSSGSSISSYNIYWYQQKPGNSPRYLLWYRSDSSKGQGSGVPSRFSASKDGSSNTCYLTITGALAEDESAYYCAYWTGNA
Gekko japonicus V207 trbv LNDG01140775.1 4144 AFSDIQLTSSGPGTLRPGENLNLVCKVTGVSITHSSYGWDWIRQPPGKGLEWVAGIYPYDGSKSYPSSLQSRVTISADSSENQLSFQLNSVTAADSAVYFCARS
Gekko japonicus V206 trdv LNDG01140775.1 7375 AFSDIQLTLSGPGTLRPGENLNLVCKVTGVSVTVNSYAWNWFRLPPGKGLEWVSYIHPSGGGKYYAPSLRSRATISADGSKNQFSLQLNSVTAADSALYYCAR
Gekko japonicus V205 trav LNDG01140775.1 10791 AFSDIQLTSSGPGTLRPRENLNLVCKVTGISITDSSNGWNWIRHPPGKGLEWVAGLYPYGGSIYYPSSLQGRVTISADSSTNQLSLQLNSVTTADSAVYYCGRE
Gekko japonicus V204 trav LNDG01140775.1 14376 AFSDIQLTLSGPGTLRPGENLNLVCKVTGVSITDSSYAWNWIRQPPGKGLEWVAYIYPYIGGKGYASSLQSRATISADGTRNQFSLQLNSVTAADSAVYYCARQ
Gekko japonicus V203 trav LNDG01140775.1 19052 IQLTSSGPGTLRPGENLNLVCKVTDFSITTRDYAWNWIRQPPGKGLEWVAYIYPYDGTKYYASSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCAR
Gekko japonicus V202 trav LNDG01140775.1 29006 AFSDIQLTSSGPGTLRPGENLNLVCKVTGVSVTHSSYAWNWVRQASGKGLEWVAYIYPYNGDIYYAPSLRSRATISADGSRNQFSLQLNSVTAADSAVYYCAR
Gekko japonicus V201 trav LNDG01140775.1 32664 AFSDIQLTSLGPGTVRPRENLNLVCKVKGFSITTQSYAWHWIRQAPGKGLEWVAYIYPYDGTKYYSSSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCARE
Gekko japonicus V200 trav LNDG01140775.1 36999 IRLTSSGPGTLTPGENLNLVCKVTDFSITTQYYSWHWIRQAPGKGLEWVAIIYPYGGNKYPSLQSHATISADGSKNQFSLQLNSVTAADSAVYYCAR
Gekko japonicus V199 trav LNDG01140775.1 42638 AFSSIQLTSSGPGTLRPGENLNLVCKVTDFSISTRGYAWNWIRQPPGKGLEWVAYIYPYNGNIYYAPSLRSRATISADSSRNQFSLQLNSVTAADSAVYYCARR
Gekko japonicus V244 trav LNDG01207529.1 211 GVTGQSVTQTPSHLTIKEGTATFINCTYQYSGVVYVFWYIQRSHSEAPQLLLTEFTGKEKKDGFFAEHLKPARSFHLEKEASVPNDSATYFCAVS
Gekko japonicus V243 ighv LNDG01194766.1 185 VLSQVVLTQSDPVVKKPGESHKLTCAVTGFNLNSNWMIWVRQKPGKGLEWLVYYYSSASGNSYYSPAIQGRFTASKDSPNFYLQMNSLKAEDTAVYYCARE
Gekko japonicus V242 ighv LNDG01194207.1 178 VSSQVTLTESGGGIKRPGDTLQLTCMVSFDLTSYHVSWIRQPPGKGLEWMGIIWTAGTTSYNCALQSRISITRDTNKREVSLQLSSLKSEDTSMYYCAR
Gekko japonicus V241 iglv LNDG01191488.1 760 SDSQPVLTQPSLASVSPGDPKKLSCVMGSGFSISGYTVYWYQQKPGNPPRYLLYYYSDSSKHQGSGVPSRFSASKDTSSNTCYLNNAGALAEDEADYYCAV
Gekko japonicus V240 ighv LNDG01190768.1 229 VFSQISLTESGGGIKRPGETLRLTCTDSFDLMGNLVSWAHQPLGRGLEWMGIIRKDGSTAYNPAFQSQISITRETSKGQVLLQLNSLKPEETSIYYCAR
Gekko japonicus V239 trav LNDG01187837.1 142 ASSDVQLTSSGPGVVRPGENLSLLCKVTGVSISGSTYAWNWFRQPLGESPEWIAEIYPYGGKQWQNPSLRSRTTISADTSKNEFSLQLTSLTAADSSVYYC
Gekko japonicus V238 ighv LNDG01187777.1 937 VFSQSLVETGGGVKSPGGTLQLTCTVSGFSLTNNGVIWVRQPAGKRLEWIGVIWSGGSTHYNPALQSRLSITRDTSKSQVYLQMNGLKPEDTSTYYCT
Gekko japonicus V245 trav LNDG01211182.1 382 VEIYGDIFQLPEISVSLDGTAEISCNHTVSGYNGLFWYKHSPDTALRSIIFTYLEAVKEGRLTMEVDKPNLATKLSISQVEIEDSAVYYCAVS
Gekko japonicus V237 iglv LNDG01185284.1 1365 VSSQASLTQPPFQSASPGQTDELSCTAHGSVGSTHWLQQRPGWGPRFVLTGASTRGEGIPDRFTGSKSGNVHSLVIANLQAEDEADYYCVAWDNSGSQ
Gekko japonicus V231 ighv LNDG01175371.1 12055 VFSQSLLGTGGGVKSPGGTLQLTCTVSGFSLTSYDVHWVRQPPGKGLEWIGAMWKGGSNAYSSTLQNRLSITRDTSKSQVYLQMNGLKHEDTGTYYCARQ
Gekko japonicus V198 trav LNDG01140775.1 44887 AFSDIQLTSSGPGMLRPGENLNLVCKVTGVSITRKSYPWNWICQPPGKGLEWVARIYPYGGSKWYNPSLQSRATISADSSTNQFSLQLNSVTAADSAVYYCAGE
Gekko japonicus V160 trav LNDG01100443.1 2442 AFSDIQLTSSGPGTLRPGENLNLVCKVSGFSITTQYYYWFWIRQPPGKGLEWVAEIYPYDGSKWYSSSLQSRITISADSSKNQFSLQLSSMTAADSAVYYCVRE
Gekko japonicus V122 trbv LNDG01059627.1 18015 TFSDIQLTTSGPGMVRPGENLHLFCTVSGLSVSAQYSVWHWVQRFPGKHLEWLALLYPYDGSKGFAPSLQSRLTISSDTSKNQVFLQLNSLTAADSAVYFCVREP
Gekko japonicus V101 trav LNDG01192856.1 137 AFSDIQLTSSGGGTLRPGENLNLVCKVTGVSITESGNLWNWIRQPPGKGLEWVAYIYPYNGDKYYAPSIQSRITISADSSRNQFSLQLNSLTAVDSAVYYCARG
Gekko japonicus V82 trbv LNDG01135545.1 3053 AWSSMSQVVQTPTSQQIWEGDLSTITCSNPNAYQPFFWYHQLPGSAPSLRLSMTTKENVTEGHFTAERSSDGKQSRLHISGAQLRDSGIYLCASD
Gekko japonicus V52 iglv LNDG01073792.1 1404 SSSQPVLSQPPSTSVSPGTSTKLPCVLGSGYSIGNYRVAWYQQKSTNSPRFLLHYYTDSDKGQGLGVPSRFSDSKDTSRNTWYLNIAGAFAEDEADYYCG
Gekko japonicus V43 iglv LNDG01073786.1 1009 SDSQPVLTQPPSASVTPGKTVKLSCVMSSGFDISGYYIYWYQQKPGNPPRYLLWYYSDSSKGQGSGVPSRFSASKDTSANTCHLTITGSLVEDEAD
Gekko japonicus V21 ighv LNDG01071742.1 43475 VLSEIKLTESGKGTVKPGESLRLTCTVSGTTISDTYGYHWIRQPPNKGLEWVGRGYYSRSSTWYTDYDSAFQSRVSISPDTSKNEFSLQLNSLTAADTAVYYCARQ