WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Crotalus horridus LVCR00000000.1 (LVCR01) 94 58 8 2 19 4 1 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Crotalus horridus V30 ighv LVCR01083786.1 1183 CHSQVQLVETGGGIVALGGSLRLSCKASGFTFTSYHMHWFRQGAEKEPEFVAGLDTSGSSKWYNPKVNGRFTISRDNSQSSLYLQMNNLKAEDSALYYCARE
Crotalus horridus V29 ighv LVCR01068434.1 8387 LTQSDPVLKKPGESHKLTCTVTGFNINSYYMDWIRQKPSQGLEWLVHYYSSSVNYYSPTIQGHFAASKDSSNFYLQMNNLKAEDTAVYYCAR
Crotalus horridus V28 igkv LVCR01068434.1 1794 GLSQIALTQSDPVLKKSRESHKLTCTVTGFNINSYYMDWIRQKPGQGLEWLVHYYSSSVNYYSPTIQGRFAASKDSSNFYLHMNNLKADDSSVYYCSR
Crotalus horridus V27 ighv LVCR01063228.1 2441 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYGMSWMRQAAGKGLEWVASMGTSSTYYSDKVKGRFTISRDDAKSQLYLQMSSLKAEDTAVYYCAR
Crotalus horridus V26 ighv LVCR01062117.1 11494 VKSEIQLVESGGGVRSPGGSLRLSCQASGFTFSSYYMDWVRQAPGKGLEWVARIGTSSSPISYSDKVKGRFTISRDDSRSQLYLQMDSLKLEDTAVYYCAR
Crotalus horridus V25 ighv LVCR01062117.1 905 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYYMYWVRQAPGKGLEWVARIGTSSSPINYSDKVKGRFTISRDDSRSQLYLQMNNLKLEDTAVYYCAR
Crotalus horridus V24 trav LVCR01059457.1 5822 NSQSDLVSQPQNSMEVREGEAATLPCNFTSLSSSPFLYWYRQYGNQRPERILTAYKYRNNHFQEGKFSTTLVLGSPNSVPLNIRSVSLLDGAVYFCALNPTVN
Crotalus horridus V23 trbv LVCR01059457.1 791 TSQSDSVSQTKSNMEVLEGEAATLPCNFTTLSSNPYLYWYRQYGNQRPERILTAHKYGNNPFQEGKFSTTLVLENQNLVPLNIRSVSLLDGAVYFCALNPTVN
Crotalus horridus V22 trbv LVCR01059171.1 6944 VFSDIQLVESGPGLVRPESQLNLVCKVTGFSIATSSSYAWDWIRQPPGKGLEWLAAINVNNGGKWYGNSVKGRATISADQSRNEFSLQLNSVLAADSSVYFCARE
Crotalus horridus V21 ighv LVCR01059171.1 1594 GFSQVVLTQSDPVLKKPGEAHKLTCAVTGFDVNSYNMFWIRQKPDQGLEWIVYYYSSSSNAYSPTIQGRFTASKDSPNFYLQMNNLKAEDTAVYYCAG
Crotalus horridus V20 trav LVCR01055193.1 3128 QTVNQTSGIVTVTAGQSLSLYCSYEAQFTGEFETYWYIQHPGQPPKYLLDLYSKNAQGFQATHIPHENKKKGTFSMRKPAIQLKDSAVYFCAFR
Crotalus horridus V19 ighv LVCR01054749.1 3281 AQSQVQLVESEGCVRRPGESLHLSCQASGFTFSSYYMNWVRQAPGKGLEWVSTTGGYYLDKVKGRFTTSRDDAKSQLYLQMNSLKAEDTAVYYCAR
Crotalus horridus V18 ighv LVCR01052795.1 14063 VSVTESGGGLKRPGDSLQLTCTCSGFNIDSYWIHWVRQADGKGLEWISRINKGTVYYANSLKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCAR
Crotalus horridus V17 ighv LVCR01052795.1 1016 VLADASVTESGGGVKRPGDTLRLTCTCSGFSIDSYWMEWVRQEDGKGLEWISRIKTGNTYYANSFKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCTR
Crotalus horridus V15 trav LVCR01048941.1 3131 QTVNQTSGIVTVTAGQSLSLYCSYEAQFTGEFETYWYIQHPGQPPKYLLDLYSKNAQGFQATHIPHENKKKGTFSMRKPAIQLKDSAVYFCAFR
Crotalus horridus V14 trav LVCR01048941.1 959 QSVDQTSGIVAATEGQPVVLYCSYEAQTIGSYYPYWYIQYPGQALKFLLGSYENNAPGFQATHHKDKKNGTFNLQKDSSQLKDSAAYFCAFS
Crotalus horridus V13 trav LVCR01046931.1 2489 QTVIQTEGRLTITEGQPVFLNCTYDRSVDYQPSPFWYIQYLGQPPKLFKSTFSTPNLDASLPRNFKVIYNKVEKTFNMKKSISQLNDSAIYFCALK
Crotalus horridus V12 ighv LVCR01045012.1 4905 ALCQITLTQSSPVIKNQGESLQLKCSITGFDIYNHYMDWLMKKPGNPLKWLVHYRIPKYSAYSPTIQGRFTASKDSSNFYLQMNDLKMEDTAVYYCTSAI
Crotalus horridus V11 ighv LVCR01045012.1 3124 TLSQITLTQSSLIIKNQGESIQLKCSITGFDINHHYMNWVMQRPGKPLEWLVYYRILKYSGYSPRIQGRFTSSKDSSNFYLQMNDLKVEDTAVYYCTTHIDP
Crotalus horridus V10 trbv LVCR01041997.1 15317 RSTGQMVKQKSDILTVAEGKHLSLSCSYEIQFSSSAYRDTYWYIQHPGQPLELLLSQHKKDTQGFHATHHKGEKNGTYNLEKDASQLKDSAVYFCAFRE
Crotalus horridus V9 trav LVCR01041997.1 2046 STGQSLKQTSGILTVTKEQPVSLNCSYEGQFSINYPFWYIQHPGQPLEILLNEIDNNVQGFQATHHQNDKKGTFNMRKPAIQLQDSAVYFCAFKE
Crotalus horridus V8 iglv LVCR01039314.1 1101 SFAQYVLTQPSSISVSLGQNERITCSGNGIGGKNVHWYQQKPGTPPVLIIYDDSSRPTGISDRFSGANSGNTATLSISRAQAQDEAIYYCQVYDSSQ
Crotalus horridus V7 trav LVCR01037584.1 4445 VSGQATVTQEHQFLSVKEGNSIWLNCSYQGIEYNLQWYKQHPGSQPEFMIFLTISETKAEDNFEMTLDTDKKTTSLYLKNIQFKDSAVYFCGM
Crotalus horridus V6 iglv LVCR01019712.1 16742 ASAQFTMTQPPSVSASRGQTVQITCTREGGSISSYYVSWYQQKPGTKPQLVIYQDTSRPSGIPEQFSGSVDSSSNSATMSISNVQSEDEADYFCLSYDSNAQ
Crotalus horridus V5 ighv LVCR01018552.1 28051 QLVESGGGVRRPGGSLRLSCQGSGFTFSSYWMHWMRQAPEKGLEWVTAITTGSSPSTYYPDKVKGRFTISRDDAKSQLYLQMNNLELEDTAIYYCTT
Crotalus horridus V4 ighv LVCR01018552.1 25203 QLVESGGGVRRPGGSLRLSCQASGFTFSTSWMHWVRQAPGQELEFVATILTGSSPSIYYPDKFTGRFTISRDDSRSQLYLQMNNLKPEDTAVYYCTR
Crotalus horridus V3 ighv LVCR01018552.1 19763 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMAWIRQAPGKGLEWVAYMGTTDTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTSVYYCVR
Crotalus horridus V2 ighv LVCR01018552.1 8207 VQSDIQLVESGGDVRRPGGSLRLSCQASGFTFSSSWMHWVRQAPGKGLEWVARIGTSSSPINYSDKVKGRFTISRDDAKSQLYLQMNNLKAEDTAIYYCVG
Crotalus horridus V1 ighv LVCR01018552.1 3230 VQSQAQLVESGGDVRSPGGSLRLTCQASGFTFSSYYMGWVRQAPGKGLEWVTYITTGSSTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCVRE
Crotalus horridus V0 trbv LVCR01003196.1 2739 EQVLLTQKPAWISGELGDQIQMNCQQTNTDHNWMYWYRQAAKQKLELIGYIVKGTPQATYEDGFEKQRFEIQQKHSKHCSLQINKMSSEDAAVYFCASS
Crotalus horridus V68 trdv LVCR01066913.1 1593 SDSQIFLLQSNSVNKSGEAHKLTCDLTGFDVNSYWMSWIRQKPGQGLEWLVHYYSSTNNYYSLTIQGRFTASKDGSKFYLQMNNLKAENTALYYCAR
Crotalus horridus V67 ighv LVCR01065001.1 2571 VQSEVLLVESGGDVRRPGGSLRLSCQASGFIFSSYWMIWVRQAPGKGLEWVAYIHTGSSPSTYYSDKVKGRFTISRDDSRNQLYLQINSLKPEDTAVYYCAR
Crotalus horridus V66 ighv LVCR01065001.1 15084 VQSDVQVVESGGDVRRPGQSLSLLCQTSGFDFNVFWMNWLRQYPGKDLEWVGRITTGSPPTAYYRDKVKGRFTMSRDDSNTRVYLQMNNLKPEDSAVYYCAR
Crotalus horridus V64 trav LVCR01054334.1 2430 PRLDAQIIQTPETLEVQEGSLFTLKCNYSSQYQPYFWYHQLPGEHLSLILFISSQESQNNKGFMAKYLKNGKESQLHRPTAQLQDSGNYFCAVQ
Crotalus horridus V63 trav LVCR01053916.1 4830 WISISQVTQTPMYQDLKEGDRVTITCKNNAAYSYFYWYRQVPRMPLSYLLSITSSKNITEKGYTAEYLDNGQRSCLHLPSSLLQDSGTYFCAVN
Crotalus horridus V62 trav LVCR01052941.1 3720 RSTGQSVKQASGIVTVTEGKHLSLSCSYEGQFSSSAYRYTYWYIQHPGQPLKLLLSQYKKDSQGFYATHLKGEKNGTYNLEKDASQLKDSAVYFCAFSE
Crotalus horridus V61 ighv LVCR01049263.1 1048 IKCNVQLEQSGSYVKRPGQSLFLFCKGSGFNFGNYGMHWVRQAPEKGLEWIAVIWYDASKQEYAESVKGRFTISRNNAKSQLYLQMNSLKPEDTAVYYCAR
Crotalus horridus V60 ighv LVCR01049263.1 4488 VQSEIQLVESGGDVRRPGGSLRLSCQASGFTFSSYWMVWMRQAPGKGLEWVTQIDTSSSPIRYSGKVKGRFTVSRDDSHSQLYLQMDSLNSEDTAVYYCAR
Crotalus horridus V59 ighv LVCR01046678.1 1818 VQSQGQLVESGGDVRRPGESLHLSCQGSGYNFGSYHMNWVRQAPGKGLEWVARIYHDSNGKFYSDKVKGRFTISRDNAKSQLYLQMNTLKAEDTAVYYCV
Crotalus horridus V58 ighv LVCR01046678.1 3410 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYNMGWMRQDPGNGLEWVTYMGTSRTYYSDKVKGRFTISRDDAKSQLYLQMNSLKDEDTAVYYCTR
Crotalus horridus V57 iglv LVCR01046370.1 613 STSQSVVSQPPSASVSLGTTEKLACILGSGLSIGSYRIRWYQQTSPSSPRFLLHYHTDSDKGQGSGVPSRFSGSKDTSTNTGYLTISGVMSEDEADYYCAI
Crotalus horridus V56 ighv LVCR01044641.1 447 VRSQAQLVESGGVVKIPGESVHLSCQASGSTFSSYYVHWARQAPGKGLEWVAYIYPDSSGKFYSDKVKGRFTISRDNAKSQMYLQMNSLKPEDTAVYYCAG
Crotalus horridus V55 ighv LVCR01044576.1 5537 VQSQAQLVESGGDVRSPGGSLRLTCQASGFTFSSYYMGWVRQAPGKGLEWLARMDTSSNYYSDKVKGRFTISRDDAKSQLYLQMNNLKAEDTAVYYCW
Crotalus horridus V54 ighv LVCR01044576.1 7771 VQSQVQLVESGGDMRRPGGSLRLSCQASGFDFSSYYMSWVRQAPGKGLEWVAYISSSSRTIYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDMAIYYCAR
Crotalus horridus V53 ighv LVCR01036634.1 2676 VQMEAQLVESGGDVRRPGGSLHLSCQASGFTFSSYQMVWVRQAPGKVLEWLAWIDNPADGNTQYYANSVKGRFTISRHDASSMLYLQMNSLKPEDTAVYFCATD
Crotalus horridus V52 ighv LVCR01036634.1 4955 AQSEVHLIESGGDVRRPGESLHLICQASGFTFSDYSMHWMRQVHGKGPVWVAHIRYDSTSFHYSDEVKGRFTISRDNAKEQLHLQMNSLKPEDTAVYYCAR
Crotalus horridus V51 trav LVCR01028771.1 12500 ANIIQPQSMMLEEGQDARLECRQDYGHLNMLWFWQRKQNQDLQLLYNFYNGNIVQKNSSLHRLNADQPILDLCVLSISVVKPEDSAVYFCASSE
Crotalus horridus V50 ighv LVCR01026557.1 586 VQMEIQLVESGGDVRRPGESLRLSCQASGFTLSSYEMNWLRQAPGKGLEWLAWIDNPGDGNTQYYANSVKGRFTISRHDTSSMLYLQMSSLKPEDTAVYYCARE
Crotalus horridus V49 ighv LVCR01026557.1 7670 VQMEIQLVESGGDVRRPGESLRLSCQASGFTLSSYEMNWLRQAPGKGLEWLAWIDNPGDGNTQYYANSVKGRFTISRHDTSSMLYLQMSSLKPEDTAVYYCARE
Crotalus horridus V48 ighv LVCR01026557.1 13806 VQMEVQLVESGGDVRRPGETLHLSCQASGFTFSSYEMAWVRQAPGKGLEWVAWIEDDGDGSSQYYANSVRGRFTISRHDASSMLYLQMNSLKPEDTAVYYCARD
Crotalus horridus V47 ighv LVCR01026557.1 15715 VQSEVQLVESVGDVRRPRESLHLSCQASGFNFGGSNMNWLRQTPGKDPEWVAWIQSDGRKTYYLNKVKGCFTISRDNAKSQMYPQMNSLKPEDTAIYYCAR
Crotalus horridus V46 ighv LVCR01026557.1 19470 VQMEVQLVESGGDVRRPAESLRLSCQGSGFTFSSYEMLWVRQAPGKGPEWLAWIDNSGDGSSHTYANSVKGRFTISRRDASSMLYLQMNSLKPEDTAVYYCAGD
Crotalus horridus V45 iglv LVCR01023022.1 4746 VTSQPTLTQSVSQSGSVEGTVKISCGISSNPSTVSWIQQRSGEGPRFVHCDGCSGRGPGIPDRFMGTRSGNNGYLTITNLQAEDEADYY
Crotalus horridus V44 iglv LVCR01023022.1 18009 SCSQFVLNQPDSVSGSPTETIDISCTKSSGTIGSGYSSWYQQKPGSPPKLLIYADSSRASGIPARFSGSVENSRTSAILTISNLEAEDTSIYYCSS
Crotalus horridus V43 iglv LVCR01023022.1 20021 SFSQFVLNQPDSVSGSLGGTVRISCKKSSGTIGSGYSSWYQQKPGDPPKLLIYADSSRASGIPARFSGSVENSRTSAVLSISSLEVGDEATYYCASDTGSGS
Crotalus horridus V42 iglv LVCR01021389.1 1891 ASAQFTMTQPPSVSASRGQTVQLTCTREGGSISSHYVSWYQQKPGTKPQLVIYDHSSRPSGIPERFSGSVDSSSNSATMSISNVQSEDEADYYCLSYDSNYQ
Crotalus horridus V41 iglv LVCR01021389.1 5512 DAAISFLQPVSVSASLGSAIQISCTPSNGTMATYTISWFQHQQPSPPKYLLYYKDGSNQRRKTGVSERFAASKDASLNACYLTISEVQAADEGTYYCLASTGSE
Crotalus horridus V40 trgv LVCR01020814.1 8081 SSIQQLQSLKDSDFVAQGGTITTSCRYDSGTITDSNYPVWVQQKSEQVPRLLIHSTSTRHTGVPARFSGSRSGNTMSLTITEALVEDEAMYYCAVWTGSG
Crotalus horridus V39 igkv LVCR01020814.1 9791 LSLQQLQSLKDAESVPLGGTVTLSCRYTLGGIANGNHPWWAQQHPGKPPRLLFYNTNIKVSDVPARFSASKSGNVMSLTITGASAEDGAMYYCCLNPVSS
Crotalus horridus V38 trav LVCR01016840.1 2082 VFPNVQLSQPLFKTQTSGRSVKLDCTVSGVEVGGWYWGWNRKGPGKRLEWLGGIKSTNDGGEAYYNSRFNNRIVITRDTSKNEFYLELRSPAAADSGVYFCA
Crotalus horridus V37 trdv LVCR01003196.1 32821 EDLYTILQRPTSVVIDEFGIGPSLECSAKTSSIPSFYWFRQISNRSIDLLAFSISTRSTKNVGPSHIKGSRPNNENFLLNIRSMTTKDSGTYYCALS
Crotalus horridus V36 ighv LVCR01174101.1 44 VRSEVLLVESGGDVRSPGGSLRLTCQGSGFTFSSYVMNWVRQAPGKGLEWVAFVHTGSTSIYYSDKVKGRFTISRDDGKSQLYLQMNSLKAEDMAVYYCTG
Crotalus horridus V35 ighv LVCR01147811.1 82 VRSEVLLVESGGDVRSPGGSLRLTCQASGFTFSSYPMNWVRQAPGKGLEWVAFISTRSTPIYYSDKVKGRFTISRDDAKSQIYLQMNSLKAEDTAVYYCAR
Crotalus horridus V34 ighv LVCR01123247.1 897 QLVESGGDVRRPGESLRLTCQASGFTFSNYWMGWVRQAPGKGLEWVASMDTSSTYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAIYYCTR
Crotalus horridus V33 trav LVCR01115270.1 209 PSAEDAVEQITGTLSVSEGNPFSIQCSYEADWSVTNDPFWYIQFPGQPPRFLLSENKGHNQGFQASHILGENKRTGTFNLKKATSQLSDSAFYLCA
Crotalus horridus V32 ighv LVCR01097386.1 246 ALCQITLTQSSPVIKNQGESLQLKCSITGFDIYNHYMQWSMKQPGNPLKWLVHYHIPKYNAYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Crotalus horridus V31 trav LVCR01088469.1 5990 ISSQARITQEPQFLSVKEGDSIQLNCSYQETADSLQWYKQYPGGQPEFMMVLYSSNTEAKDNFEMTLDTKNKTTSLYLKNTQLKDSAVYFCAW
Crotalus horridus V92 trav LVCR01148130.1 282 CSLDAQVFQTPENLEVQEGSLFILKCNYTSQYQPYFWYHQLPGAHPSLILSISSQASQNNKGFVTKYLDNGKESQLHRPTAQLQDSGNYFCAVQ
Crotalus horridus V91 ighv LVCR01138746.1 510 VQSEVQLVETGGDVRSPGGSLRLTCQASGFTFSGYYMGWVRQAPGNGLEWVAYIGTSSSPIYYSDKVKGRFIISRDDAKSQMYLQMNSLKAEDTAVYYCAR
Crotalus horridus V90 ighv LVCR01134292.1 678 VRSEVLLVESGGDVRSPGGSLRLTCQASGFTFSSYGMHWVRQAPGKGLEWVAYISSSSGTIDYSDKVKGRFTISRDNAKSQLYLQMSSLKAEDTAVYYCAR
Crotalus horridus V89 ighv LVCR01130257.1 227 VYSTIQLVESGPGRVSPGGSFRLTCKVTGDSIENVYLAWIRQAPGKGLEWVGDIALVNDEWSTDYASSLQSRTTLTADDSKNECYLTMKSLTAADSATYYCAGE
Crotalus horridus V88 ighv LVCR01125426.1 768 SLSQIVLTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMGWIRQKPGQGLEWLVWYYDPRNTIYYSPIIQGRFTPSKDSSNFYLQMKNLKTEDTAVYYCAR
Crotalus horridus V86 ighv LVCR01119121.1 344 VQSEVLLVESGGDVRRPGGSLSLSCQASGFNFAGTNMNWVRQAPGKGLEWVAYINHPSSAIHYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Crotalus horridus V85 ighv LVCR01118188.1 506 VQSEAQLVESGGEGRRPGETLHLSCQGSGFTFGNYWMVWVRQVPGKGLEWVVHTWSSYFYYSDKVNGHFTISKDEDKIQLYLQMNSLKLQNTAIYYCVRG
Crotalus horridus V84 ighv LVCR01115319.1 835 ITITQSAAQVKRPGERMRFTCTVSGFSLGSSGISWIHQVSGKELEWIGDIWHNGGTAYSTIFRSQASITKDNSRSQVILQLNVLKAEDTATYYCI
Crotalus horridus V83 ighv LVCR01104663.1 239 CYSEVKLVETGGGVVVPGGSLRLICKASGFNFTGYAMHWIRQSPGKGLEWVAGVSQPKGTKQWYNSKVEGRFTVSRDNSQTSAYLQMNDLKPEDSALYYCA
Crotalus horridus V82 ighv LVCR01101244.1 495 VLADASVTESGGGVKRPGDTLRLTCTCSGFSIDSYWMEWVRQEDGKGLEWISRIKTGSTYYANSFKGRFTISKDSSRNLVYLDMNGLKAEDTAKYYCTR
Crotalus horridus V81 ighv LVCR01101082.1 688 VRSQAQLVESGGDVKRPGETLHLSCQASGFTFSSYDMDWVRQAPGKGLEWVAGIYTDSSGKFYSDKVKGRFTISRDNAKRQLYLQMNSLKPEDSGIYYCAG
Crotalus horridus V80 ighv LVCR01099907.1 70 VQSEVQLVESGGDVKRPGGSLHLSCQASGFTFSSYWMSWVRQAPGKGLEWVAFINTGSSTIYYSDKVKGRFTVFRDNAKSQLYLQVNNLKPEDTAVYYCAR
Crotalus horridus V79 trav LVCR01098519.1 7223 VSDQARITQEHQFLSVKEGDSIRLKCSYQETEYSLQWYKQYPGGQPEFMILLTISGTEAKDHFEMTLDTDNKTTSLHLKNTQFKDSAVYFCAWSTVLE
Crotalus horridus V78 trav LVCR01094939.1 448 VLHLVSSQVFQSEQLILMEKEEIVLKCTHNITVINNMYWYKQTGGVLTFLGANYNGKLDLPGGFTMDVDQKSRSSKLTRDVARLKDAGVYFCAVR
Crotalus horridus V77 trav LVCR01093832.1 1218 STGQLVNQTSGIVTVTEGQSLSLRCSYEAEYSGTNYPSWYIQHPGQPLEILLDETDNKAPGFQATHNKTRKKGTFNMQKQTIQLEDSAVYFCAFRE
Crotalus horridus V76 ighv LVCR01088044.1 1521 VQSQGQLVESGGDVRRPGQSLRLSCQGSGYNFGGYSMDWVRQAPGKGLEWVAHIYHDSSGKFYSDKVKGRFTVSRDNAKSQLYLQMNSLKAEDTAVYYCT
Crotalus horridus V75 ighv LVCR01087010.1 66 LTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMSWIRQKPGQGLEWLVYYLSSSSNYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAG
Crotalus horridus V74 ighv LVCR01083473.1 441 ISSQITLTESGDGLKKPGDSLRLTCTVSGFAITSYGVSWIRQPPGKALEWYGVIWASGSTYYNSALQNRISITRDTSKNQVFLQLTGLKPEDTGTYYCA
Crotalus horridus V73 ighv LVCR01077115.1 1922 LLVESGGDVRRPGGSLRLTCQASGYTFSSYNVGWVRQAPGKGLEWVSTTGGYYSDKVKGRFTISSDNAKSQMYLQMNSLRAEDTAVYYCAR
Crotalus horridus V72 ighv LVCR01071323.1 1484 IHLEVQLVESGGDTKRPGQSLHLSCQYSGTTFRRDEMHWVRQTPGKGLECVAWVDNTGDQSPVYYADSVKGRFTISRRDASNTIYLQMNSLKPEDSAFYYCAREP
Crotalus horridus V71 ighv LVCR01071323.1 8225 VHSTILLVESGPGTASPGGSFRLTCKVTGDSIKNAYWEWIRQAPGKGLEWVGQIDWASDNWRIYYASSLQSRTTLSADDSRNEYYLTMSSLTAADSATYYCARR
Crotalus horridus V70 ighv LVCR01070764.1 2608 VQMEIQLVESGGDVRRPGESLRLSCQASGFTLSSYEMNWLRQAPGKGLEWLAWIDNPGDGNTQYYANSVKGRFTISRHDTSSMLYLQMSSLKPEDTAVYYCARE
Crotalus horridus V93 ighv LVCR01178644.1 7 VQLVESGPGRVSPGGSFRLTCKVTGDSIKNVYWEWIRQAPGKGLEWVGQIDWEGSKWRTYYASSLQSRTTLSADDSHNEYYLTMRSLTAADSATYYCAGE
Crotalus horridus V87 ighv LVCR01124245.1 374 VRSEDQFMESGGDVKRPGESIRLSCQSSGFTFSSYGMHWVRKFPGKGLEWFAWIFTDSSSIFYSDKVKGRFTISRDNAKSQLYLQMDSLKPEDTAVYYCTRNPMAQL
Crotalus horridus V69 ighv LVCR01070015.1 2051 LTQSGQVVKTPGETVSLTCVATGFDINCYFMDWIRQEPGKGLEWLVSYHTPAHNFYSLDIKGRFAASKSGSNFYLKMDHLKENDTATYYCTR
Crotalus horridus V65 ighv LVCR01064776.1 1021 VLSEVQLVESGGDVRSPGGSLRLTCQGSGFTFSSAYLDWLRQAPGKGLEWVAYISTASTPIYYSDKVKGRFTISRDDAKSQMYLQMNNLKPEDTAVYYCAR
Crotalus horridus V16 trav LVCR01048941.1 5971 STGQSVDQTSGIVAVTEGESVFLNCSYEATFSDSFFTFWYVQFPGQSLRFYLASYWNNSQGFQAVHIPHESQQKGTFNLQRRASQLNDSAAYFCSFSGFKALR