WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Malaclemys terrapin terrapin MDXI00000000.1 (MDXI01) 322 90 42 55 77 10 37 11
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Malaclemys terrapin terrapin V30 igkv MDXI01008043.1 14066 SSGQIVMTQSSESLTVTPGDRVTINCKASSDPLTYVAWYQQKSGQPSKLLIYAVSTRPSGVPERFSGSRSGNDFILTVNRVDVDDTGDYYCGQSRNFQS
Malaclemys terrapin terrapin V29 ighv MDXI01007125.1 4945 AAGPVRPGGSEAGETLSITCKVSGVSVSSYYWGWARQPLGKGLEWMGRIRSTAGGGNTAYNAAFSSRITVSADTAKNQVSLQLRSLTAADTGTYYCARQTA
Malaclemys terrapin terrapin V28 ighv MDXI01007062.1 203095 AWSQALVESGGDVKKPGDSLRLSCKASGFTFSSYAMSWVRQAPGKGLEWVTAISSGGSTYYPDSVKGRFTISRDNSKSELYLQMTSLKLEDTARYYCA
Malaclemys terrapin terrapin V27 ighv MDXI01007062.1 197805 VLSQVQLVQTGPGTVKPGATLSITCKVSGVSVSDYYWNWNRQPPGKGLEWMGFIRSTAQGGTTEYNAALKPRVTITRDTSKNEVYLQLGSLTAADTSTYYCAR
Malaclemys terrapin terrapin V26 ighv MDXI01007062.1 182642 ARPQVQLVESGGDVKKPGDSLRISCKASGFPFSSYLMDWIRLAPGRGLEWLARAAAQGSTYYADTVQGRFTISRDNANSLVHLQISSLRAEDTALYYCVR
Malaclemys terrapin terrapin V25 ighv MDXI01007062.1 181320 VQSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSAYMSWVRQAPGKGLEWVAAIYPAGSTYYPDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Malaclemys terrapin terrapin V24 ighv MDXI01007062.1 139859 VLSQVQLVQSGPGAVKPGETLALTCAVSGYSITSGYTWNWIRQPLGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKNQFSLQLRSLTAADTATYYCARS
Malaclemys terrapin terrapin V23 ighv MDXI01007062.1 128010 LVESGGDVKKPGDSLRLSCKASGFTFSSYDMNWVRQAPGKGLEWVAQIQTTSTYYADSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Malaclemys terrapin terrapin V22 ighv MDXI01007062.1 127995 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYDMNWVRQAPGKGLEWVAQIQTTSTYYADSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Malaclemys terrapin terrapin V21 ighv MDXI01007062.1 99745 VRSEVQLVESGGDVKKPGDSLRLSCKASGFTFSSYDMHWVRQAPGKGLEWVSLISSSGGTIYYSDAVKGRFTISRDNSNNLLYLQMTGLKPEDTARYHCAR
Malaclemys terrapin terrapin V20 ighv MDXI01007062.1 87794 VRSQALVESGGDVKKPGDSLRLSCKASGLDFSSYGMNWVRQAPGKGLEWIAYIRYDGSTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Malaclemys terrapin terrapin V19 ighv MDXI01007062.1 50219 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSAMSWVRQAPGKGLEWVSLIYTDGSQQFYADSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Malaclemys terrapin terrapin V18 trgv MDXI01007062.1 19101 VYSQIKLEESDGGVKRPGETFRLTCTVSGFSVTDYGVNWVRQPAGKSPQWMGVLWGGGSTDYNSALGGRISITREPAKSQVYLQVNSAGETDSAIYYCAMRYASG
Malaclemys terrapin terrapin V17 ighv MDXI01007062.1 8037 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFTSYNMDWVRQAPGKGLEWVAEIYTDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Malaclemys terrapin terrapin V16 ighv MDXI01007062.1 3715 RLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWFRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTTRYYCAA
Malaclemys terrapin terrapin V15 ighv MDXI01006958.1 10164 VQSEVQLVQSGAEIKKPGESVKIPCKTSGFTLTDYYISWIRQTPGKGLVWLGRIDPEDGDTSYADSVKDRVTISTDNSISTVYLQLRSLRTEDTAVYYCAR
Malaclemys terrapin terrapin V14 ighv MDXI01006958.1 6358 VQLVQSGAEMKKPGESVKLSCKTSGFTFTFVYMHWVRQAPGKGLLWLGWIDPEDGSTSYSQSFKDRISITADNSISTVYLQLRSLRAEDAAVYYCA
Malaclemys terrapin terrapin V13 ighv MDXI01006958.1 2665 GQSQVQLVQSGAEIKKPGDSLKISCKTSGFPLSHYYMSWLRQAPGKGLVWVGRIDPANGATIYSQSFKDRLTITTDNSISTMYLQLRNLRAEDTAVYYCA
Malaclemys terrapin terrapin V12 ighv MDXI01006839.1 242797 LVESGGDVKKPGDSLRLSCKASGFTFSSYDMSWVRQAPGKGLEWVSLIYTDGSQQYYADSVKGRFTISRDNSNNLLYLQMSGLKPEDTARYHCA
Malaclemys terrapin terrapin V11 ighv MDXI01006839.1 155507 VQLVQSGAEMKKPGESVKLSCKTSGFTFVYMHWVRQAPGKGLLWLGWIDPEDGSTSYSQSFKDRISITADNSISTVYLQLRSLRAEDAAVYYCA
Malaclemys terrapin terrapin V9 ighv MDXI01006839.1 125326 CGAAITLTQPSSAQAEPGSSLILDCVVSGYNINDRHLSWIRQAPGKSLVWLAAFRTGYTTYITDEFKGRVTPSTSGSTGKLKINSLTAADTATYYCATD
Malaclemys terrapin terrapin V8 ighv MDXI01006839.1 119187 SVAAVTLTQPGSARAEPGSSITLDCVVSGYNINDHHLHWVRQAPGNRLVWVTAFRTGYTTLTANEFKGRVTPSTSGSTGRLKIDRLTAADTATYYCAR
Malaclemys terrapin terrapin V7 igkv MDXI01004313.1 197841 SSGQIVMTQTPESLAVSPGDRVTINCKASSSTGNHLTWYQQKSGQAPKLLIYHGSTLASGVPARFSGSQSGSGYTDYTLTISSAEIEDAGDYYCQQSYSSP
Malaclemys terrapin terrapin V6 igkv MDXI01004313.1 175931 SSGQTVMTQSPESLAVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKLLIYYASSLQSGVPARFSGSGSGTDFSFTISSVEADDAGDYYCQQCGSWP
Malaclemys terrapin terrapin V5 igkv MDXI01004313.1 160464 TVMTQSPASLSVSAGESVSISCKASSGITNDIAWYQQKSGKAPKLLIYEASSRDTGVPTRFSGSGSGTDFTFTISSVEVDDAGDYYCQQYNSWP
Malaclemys terrapin terrapin V4 igkv MDXI01004313.1 149831 TSGQIVLTQSPESLSILPGETVTIKCQSDTDIDDDMNWYQQKSGAAPKLLLSEGSSRQTGVPARFSSSGYGTDFTFTISSVENDDAGDYYCQQSDRT
Malaclemys terrapin terrapin V3 trav MDXI01004163.1 17290 SVTQSADRVTVSQGEPVLLKCTYDTSYGTPTLWWYEQHPNEAPCLLLTQYEASDEEARRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V2 igkv MDXI01002634.1 32604 SSGQIVLTQTPESLAVSPGDRVTINCKASSSIGGAIAWHQQKSGQAPKLLIHSTSTRPSGIPDRFSGSGSGTDYTFTISKVEADDAGDYYCQQHYNYP
Malaclemys terrapin terrapin V1 igkv MDXI01002634.1 24858 SGGQIVLTQTPESLAVSPGDRVTINCKASSSAGGAIAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSSTDYTFTISRVEADDAGDYYCQQHSSIP
Malaclemys terrapin terrapin V0 igkv MDXI01002634.1 17358 SYGQVTMTQSPESLSVSPGQKVTIRCTASSSLDSDYVSWYQQKPRQAPKLLINYGSTLASGVPARFSGSGFGTVYTLSISRVEADDTADYYCLQMES
Malaclemys terrapin terrapin V65 igkv MDXI01013444.1 34152 SSGQIVMTQTPESLAVFPGDRVTINCKASSSVNNYIAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEAEDAGDYYCQQGWS
Malaclemys terrapin terrapin V64 igkv MDXI01013444.1 18961 SSGQIVMTQTPESLAVSPGDRVTINCKASAGITGTYIYLAWYQQKSGQAPKLLIYHASARATGIPDRFTGSGSGTDFTLTISNVQAEDVGDYYCEQGYSSP
Malaclemys terrapin terrapin V63 trbv MDXI01011425.1 24340 LCSGVTVMQKEKFIAIQNGSKGSIPCEHDDSSYYIVLWYQQKKGAERQLQLVATSSDVNSAEMEKEFKTRFKVTWPATLNTSLTINPGMVEDTAVYFCAASK
Malaclemys terrapin terrapin V62 igkv MDXI01010854.1 173029 SSGQIALTQTPDSLTVSLGDRVTINCKASSSLTSSYTGKELLAWYQQKSGHAPKLLIYYADTRQSGVPDRFSGSGSGTDFTLTISRVEAEDAGDYYCQQGKSDP
Malaclemys terrapin terrapin V61 igkv MDXI01010854.1 169352 SSGQIVMTQTPESLAVSPGDRVTIRCKASSSLTHNSYHSMAWYQQKSGQAPKLLIYAGSSLQTGVSARFSGSGSGTDFTLTISRVEAEDAGDYYCQEGWS
Malaclemys terrapin terrapin V60 igkv MDXI01010854.1 165464 SSGQTVMTQTPESLAVFPGDRVTINCKASANITGTYTYLAWYQQKSRQAPKLLIYHASTRPSGIPDRFIGSGSGTDFTLTINSLQAEDAGDYYCQQGYGWT
Malaclemys terrapin terrapin V59 igkv MDXI01010854.1 161815 AKGQIVLTQTPESLAVSPGDRVTINCKASSSVSNSYMHWYQQKSGHAPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAQSWP
Malaclemys terrapin terrapin V58 igkv MDXI01010854.1 153848 ASGQIVMTQTPESLAVSPGEKITINCKASSSLTYQGKNYLAWYQQKMGQAPKPLIYLASTRPSGIPDRFSGSGSGTDFTLTISSVEAEDAGDYYCYQSMK
Malaclemys terrapin terrapin V57 igkv MDXI01010854.1 151889 SSGDIVVTQTPESLAVSPGERVTINCKASSSLTYQGNEYLAWYQQKMGQAPKLLIYLASNHASGIPARFSGSGSGTDFTLTISRVEADDAGDYYCQQ
Malaclemys terrapin terrapin V56 igkv MDXI01010854.1 137968 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYRASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCQQYRS
Malaclemys terrapin terrapin V55 igkv MDXI01010854.1 126303 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVTSGSTHYLAWHQQKSGQAPKLLIYAGSSLQTGVPARFSGSGSGTDFTLTISRVEAEDAGDYYCQQ
Malaclemys terrapin terrapin V54 igkv MDXI01010854.1 115077 SSGDIVMTQTPESLAVFPGDTVTIRCKASSSLTGGSNHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTINKVEAEDAAVYYCQQTYGTP
Malaclemys terrapin terrapin V53 igkv MDXI01010854.1 89916 SSGQIVMTQTPESLAVSPGDRVAINCKASSSVTSGSTHYIAWYQQKSGQAPKLLIYYASTRATGIPDRFTGSGSGTDFTLTISNVQAEDAGDYYCQQGYS
Malaclemys terrapin terrapin V52 igkv MDXI01010854.1 30057 AKGQIVLTQTPESLAVSPGDRVTINCKASSNANRNIHWYQQKSGQAPKLLIYTASCRPSGVPDRFSGSGSGTDFTFTINRVEADDAGDYYCQQAQSWP
Malaclemys terrapin terrapin V51 igkv MDXI01010854.1 23153 SSGQLVLTQTPESLAVSPGDRVTINCKASTSVGSYMSWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTFTISRVEVDDAGDYYCQSST
Malaclemys terrapin terrapin V50 trav MDXI01010034.1 9408 GIYGADSVTQTDDTVIISQGDPVRLNCTYQISGFPYPFWYVQFPNQPPRLFLRDVGREDSDEGIRKGFDAKTGKNPTSFHLWKPFSEVSDSGTYYCAV
Malaclemys terrapin terrapin V49 ighv MDXI01008971.1 189708 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSWMSWVRQAPGKGLEWIGEIHPTSTTINYAQPFKGRFTISRDNPNNLLYLQLTGLKPEDTARYYCAS
Malaclemys terrapin terrapin V48 ighv MDXI01008971.1 187713 VRSQVQLVESGGGIQTPGGSLRLSCKASGFTFSSYRMDWVCQAPGKGLEWVLEPANNLAAYYSDSVKGRFTISRDEFSSSVYLQMNSLRAEDTARYYCAR
Malaclemys terrapin terrapin V47 ighv MDXI01008971.1 172520 ARSQGALTQSGTAVKKPGESHTVKCAVSGFNVMGYNMFWIRQAPGKGMEWIIHYYSPSRNNYSPTIQGRFTASKDSSNFYLQMTSLKPEDTAVYYCAR
Malaclemys terrapin terrapin V46 ighv MDXI01008971.1 157416 VLSQVQLRETGPGVVKPGESLTVTCTISGDSVSSDSAAWHWFRQPPGKWPEWMGRTWYRSSMWNTEYASSVQSRGIITQDTAKNQFSLQLRSLTAADTATYYCVRQ
Malaclemys terrapin terrapin V45 ighv MDXI01008971.1 140274 VYSQIILVESGGGVRKPGETLRLTCTVSGFSLSSYNRHWARQAVEKGLEWMGVIWGGGSNNYNDVLKNRLSITRDTSKSHVFLQLTGLQLGDTSLYYCAG
Malaclemys terrapin terrapin V44 ighv MDXI01008971.1 115787 VKPGETLTLTCAVSGDSSSVISSGCCYWSWIRQSPGKGLEWMGRITKGGSTNYATSLQSRITITVESSKNQFSLQLRSLTAADTAAYYCAR
Malaclemys terrapin terrapin V43 ighv MDXI01008971.1 115745 IHSQVQLVPSGPGAVKPGETLTLTCAVSGDSSSVISSGCCYWSWIRQSPGKGLEWMGRITKGGSTNYATSLQSRITITVESSKNQFSLQLRSLTAADTAAYYCAR
Malaclemys terrapin terrapin V42 ighv MDXI01008971.1 98571 ARSQINLVESGGDVKKPGDSLRLSCKASGFTFSDYGMDWVRRASGKGLEWVAYISRSGSDIYYLGSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCARDTV
Malaclemys terrapin terrapin V41 ighv MDXI01008971.1 78415 VRSQVQLVESGGGIQTPGGSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAQILNPAYSSATYYSDAVKERFTISRDESRSSVYLQMNSLRAEDTARYYCVR
Malaclemys terrapin terrapin V40 ighv MDXI01008971.1 36792 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMDWVRQAPGKGLEWVAEIKSDGSSQWYSPAVQGRFRISRDNSKNLLYLQMTGLKPEDTARYHCA
Malaclemys terrapin terrapin V39 ighv MDXI01008971.1 33374 ARSQVQLVESGGDVKKPGDSLRLSCKASRCTSSSCHMDWIQQAAGGLEWLARAAAQGAPTTLIPCKGDSPSPETTPTAWCFEMCSLRVEDTTLYYCVR
Malaclemys terrapin terrapin V38 ighv MDXI01008971.1 22650 VRSQVLLVESGGGIQKPGGSLRLSCKASGFTLSSYFMGWVRQAPGKGLEWVSLIYNPANSLSTFYSDAVKGRFTISRDDSNSLVYLQMNSLKAEDTARYYCAR
Malaclemys terrapin terrapin V37 ighv MDXI01008971.1 18122 VLSEVVLTQSGPEVRKPGESTILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAIQGRFTASMDSSSLYLQMYSLKEEDTAVYYCVRLGV
Malaclemys terrapin terrapin V36 ighv MDXI01008971.1 18122 VLSEVVLTQSGPEVRKPGESTILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAIQGRFTASMDSSSLYLQMYSLKEEDTAVYYCVRLGV
Malaclemys terrapin terrapin V35 iglv MDXI01008807.1 1355 VSSQPVVTQEPSMSVTPGGAVTLSCSLSSGAITTSNYPAWFQQKPGSAPRQLIYNTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCAVWPGSV
Malaclemys terrapin terrapin V34 ighv MDXI01008634.1 6472 ARSQVVLTQSGPEMKKPGESTQLKCAVSGFTVSGYYMAWVRQEPGKELEWLVSYYTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Malaclemys terrapin terrapin V33 ighv MDXI01008472.1 18426 VLCEVQLVQSGPGAVKPGETLTLSCAVSGETVDSGSGWSWIRQPAGKGLEWMGHVFQNVDDEWETAYAPSLQSRVTISADTAKSQFSLQLRSLTAADTGTYYCARR
Malaclemys terrapin terrapin V32 ighv MDXI01008472.1 10081 VLAQVQLGQSSSSMAKPGETLTLTCTISGPSSDTLSSSCCWWTWIRQEPGKGLEWMGDVAKEGTTHYAPSLQSRVTISAEPSKNQFSLQLRSLTAADTATYYCAR
Malaclemys terrapin terrapin V31 ighv MDXI01008436.1 31164 RPGAVKAGETLSITCKVSGVSVSNYCWSWVWQPPGKRLEWMGFIRSTARGGTTEYNSALTPRVTSTRDTSKDEVYLQLGSLTAADTGTYYCARDTV
Malaclemys terrapin terrapin V101 iglv MDXI01019928.1 82056 SLAQYLLTQPPSVSASPGKNAPLTCSGNNIGSYHVQWYQQKPGTAPLLLIYHSSNRRSRIPARFSGVSSGNTATLTITGVRAEDEADYYCQAWDSGSDQ
Malaclemys terrapin terrapin V100 iglv MDXI01019928.1 72788 SSSQTVVTQPPSVSVSPGNTVKLSCALSSGTSIGDYYVSWYQQKSGNSPRYLLYYYSDSDKHQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAVIKS
Malaclemys terrapin terrapin V99 iglv MDXI01019928.1 44002 SSSQTVVTQLPSVSVSPGNTVKLSCTLSSGTSIGDYYVSWYQQKPGNSPRYLLYYYSDSSKGQGSGVPARFSGSKDSSSNAGYLTISGALAEDEADYYCSVIKS
Malaclemys terrapin terrapin V98 iglv MDXI01019928.1 25335 SLAQYVLTQPPSVSVSPGQNAKLTCSGNNIEDYGVHWYQQKPGSAPVLVIYSDSNRPSGIPDRFSGANSSNTATLTITGVQAQDEADYYCQVWDSNA
Malaclemys terrapin terrapin V97 iglv MDXI01019928.1 9831 VSSQPVVTQEPSMSVTPGGAVTLSCSLSSGAISTSNYPSWYQQKPGSAPRQLIYRTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCVVWASSV
Malaclemys terrapin terrapin V96 trdv MDXI01019572.1 23554 PVAGNSVTQIRASASAREGRPVKLNCQYSTTYTYYALRWYQQLPGQQPLFLLYRNERGNEHKPRSVAARFSSEVSTDVKSFTLSIDGAQRADSAVYFCALWD
Malaclemys terrapin terrapin V95 trdv MDXI01019572.1 21905 VGSDVVLEQGAQALAVREGEEVSFQCSVKGGEMSSYWMYWYRKGQRGPLTWIYREGDHYGEGFQGRFLGKVDSSNNRFTLRILSAELRDRAVYYCASS
Malaclemys terrapin terrapin V94 trav MDXI01019572.1 18573 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRQEDLEERFRNRFKAKINKTSRVFPLDISSVQLSDSATYYCALR
Malaclemys terrapin terrapin V93 trav MDXI01019570.1 27072 AALGDSVLSREPEKSRSEGDTVTLSCSYTTSGSYVFLYWYRQYPNQAPQYILYRGAKAYSHLSDTASFAQERFSSQADGSSTVLTIAALELADTAVYLCALRL
Malaclemys terrapin terrapin V92 ighv MDXI01019192.1 230 GWTIEFVESGGDIRKPGDSLHLSCKTSGFKFSDYWMSWYRVSPGKGLEWVSSMGKSPTSDKYYASSVKGRFTISRDNSKNTAYLQMNKLNPEDTAMYYCRD
Malaclemys terrapin terrapin V91 ighv MDXI01019191.1 85931 VKAQIQLVQSGAEVKKPGESVKMSCKGSGYTFTSYAISWVRQAPGKGLVYIGWTNTNTEVPTYADSFKGKVTMTLDTSLSTAFLQVSSLKAEDTAVYYCAR
Malaclemys terrapin terrapin V90 ighv MDXI01019191.1 73501 QSQMQLVESGGTVRNEGESIRLSCKGSGFTFSSYTMFWYRQSPGKSPEFVSRINYDGSSPYYAAWVQGRFAISRDNAKSELYLAMSRLRQEDTARYHCAARE
Malaclemys terrapin terrapin V89 trav MDXI01019191.1 28699 SVAGNSLTQIPASLSATEGQRVEIRCQYSTSYTSYALDWYQELPGKQPLFLLRRYSSGSERKSDSLARRFSSQLHTGAKSFKLTIDGAQRADSAVYFCGLWD
Malaclemys terrapin terrapin V88 ighv MDXI01019191.1 13820 AWAQVVLTQSSPEIKKPGESTKLTCAVSGFDLSSTNMHWVRQAPGKRLEWLIYYYSSSDNSYSPAIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Malaclemys terrapin terrapin V87 ighv MDXI01019191.1 12847 AQAQVRLEESGGGAAKTGGSRRLSCTGSGFTFSSYYMFWYRQRPGEGLEWVSWISSTGGSTDYPDSVKGRFTVSRDNAKNQLYLQMRRLGPEDTARYHCAAR
Malaclemys terrapin terrapin V86 trdv MDXI01019191.1 4754 PVAGNSVTQIRASASAREGRPVKLNCQYSTTHTYYALGWYQQLPGQQPLFLLYRNERGNEHKPRSVAARFSSEVSTDVKSFTLSIDGAQRADSAVYFCALWD
Malaclemys terrapin terrapin V85 ighv MDXI01018852.1 32930 VLSQVQLVQSGLGMVKPGETLTLTCAVSGVSITDGSYAWNWIRQPLGKGLEWMGYVYPYSGSTSYAPSLQGRVTISADTAKSQVSLQLRSLTAADTATYYCARG
Malaclemys terrapin terrapin V84 ighv MDXI01018852.1 16972 ARSQVVLTQSGPALKKPGESHKLQCATSGFTLSSYWMGWVRQEPGNGLEWLAWYYSEGSKYYASSIQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Malaclemys terrapin terrapin V83 trbv MDXI01015830.1 27093 CSGAQINQPPSLVLEKGHRAQLVCKQTYGHNNMFWYRQDPGQGFQLLFLFVHKQQTDKGNVTDRFQAERLQTELFHLDISPVKPEDSAVYFCASSSDTVLQ
Malaclemys terrapin terrapin V82 trbv MDXI01015830.1 13393 LCSGVTVTQKEKFIAIQNGREARIPCEHDDKTYITVLWYQQKGAERQLQLVAFSVDGNPAVIEDQFKTRFNVTRPATLNTSLTINPGTVEDTAVYFCAASKAQ
Malaclemys terrapin terrapin V81 trav MDXI01015830.1 11202 AGVGDLISQWPTSAIQKPGEAVTMNCYQNGTVRTNMLWYQQPQGEGLKLIAITYTGSRPSYEKDFNESKFVISREQQRLSDMTVKKVTARDAATYFCAAS
Malaclemys terrapin terrapin V80 trbv MDXI01015830.1 6462 SGLGVLISQFPRTVTQRPGETMKITCVQNETSYSYMYWYKQLQGEGPRLIAQSVDGFNATYEERYNATKFPITRLNTRISSMSIVDLRTQDSASYFCAAS
Malaclemys terrapin terrapin V79 trav MDXI01014032.1 71216 ALGQYTVTQDRSQAAAHEGEPTQLNCSYTGTASSVHWYRQPRGGQPRFLALLYSSRRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Malaclemys terrapin terrapin V78 trav MDXI01014032.1 64770 AVLSDSVQSNEPEVSRSEGDTVTLGCSYETRYTAGVYLYWYRQYPNRAPQNIFLRGAKGIRTRDTAGFAEERISSPADDSSTVLNITALELADTAVYYCALQP
Malaclemys terrapin terrapin V77 trdv MDXI01014032.1 63391 LSQGQGSVTQTQGQLAKLGGQTVTLECTFSTGYQYFYLFWYRQHRSGTMDFLFRTDESNAQKNGAGRRFSAQFSKSFKFFSLTIKELEPTDSALYFCALRE
Malaclemys terrapin terrapin V76 trav MDXI01014032.1 57458 AALGDSVQSREPEVSKSEGNTVSLSCSYDTSSSNVYLYWYRQYPHQAPQYILWRGAKSYRDLSDTAGFAQERFSSQANDSSTVLNITALELADTAVYLCALQKAQ
Malaclemys terrapin terrapin V75 trav MDXI01014032.1 53620 AALGDSVQSREPHFSGREGDSVTLTCSYDTSSTGYVYLYWYRQFPNQAPQYILFRGVKQARDESNTADFAQKRFSSQADDSSTVLSIKALELADTAVYLCALDV
Malaclemys terrapin terrapin V74 trav MDXI01014032.1 42803 APGRAEIQQPGSAEALEGAELNLTCSQSSTKASDSTVWYRQLPDLEPQFAVTGYKETTKSPEPAGALHISAEREPSPLALSPVRRGDAAVYFCARR
Malaclemys terrapin terrapin V73 trav MDXI01014032.1 31423 ALGQYTVTQDQPQAAVHEGEPTQLNCSYTGTAFSVHWYRQPRGRGQPRFLALLSSSGRDTRENFTVSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Malaclemys terrapin terrapin V72 trdv MDXI01014032.1 15957 LSQGQGSVTQTQGQLAKLGGKTVTLECTFSTGYQNYYLFWYRQHRSGAMDFLFRISQSNAKQNGAGRRFSAEFRKSSKFVSLTIKELEPTDSALYFCALWE
Malaclemys terrapin terrapin V71 trdv MDXI01014032.1 14054 LSTEKNSVTQRQGQLTGVQSDSVTLGCTFSTEDAVYDIYWYKQDSSGQVKYLFRRSARSQHNGAGSRFSLDFRRAEKYVGLRIAELERSDSAMYFCAIAERALG
Malaclemys terrapin terrapin V70 trav MDXI01014029.1 30187 ANGESVTQPDDRVTVSQGEPVLLKCIYDYDTSYSTPTLWWYEQRPNEAPRLFLTQYEASDEEERRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMRDTVI
Malaclemys terrapin terrapin V69 trav MDXI01014029.1 26616 ANGESVTQPDDRVTVSQGEPVLLRCIYDYVTSYGTPTLWWYEQHPNEAPRLLLTQYEASDEEARSSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V68 trav MDXI01014029.1 19895 ANGESVTQPDDRVTVSQGEPVLLKCTYNTTLIPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMRDTVI
Malaclemys terrapin terrapin V67 igkv MDXI01013444.1 53239 AKGQIVLTQTPESLAVFPGDKVTIICKASSSVGSYMHWYQKKSGQAPKLIIHSASTRPSGIPDRFSGSGSGNDFTFTISQVEPDDAGNYYCLQSNNFP
Malaclemys terrapin terrapin V115 trav MDXI01020486.1 80449 DSVTQTDGSVFISQGDPVLLNCTYQISGFPYLFWYVQFPNQPPRLFLRDPGREDSDEGIIKGFDATHDKEQKSFQLWKLSSEVSDSATYYCAGT
Malaclemys terrapin terrapin V114 trav MDXI01020486.1 72192 QSNGEPVTQTKGSVLISQGESVVVNCTYEAVSPSLFWYVQFPSQPPRLFLRDLGREDSDEGIRKGFDATHDKNHKSFHLWKPSSELSDSATYYCAARDTV
Malaclemys terrapin terrapin V113 trav MDXI01020486.1 61483 SIYGADSVTQTEGSVTISQGEPVRLNCTYQFSVTPYPFWYVQFPSQALTLFLRDVGREDSDEGIRKGFDATHDKKNKSFHLWKPSSELSDSGTYYCAASSTV
Malaclemys terrapin terrapin V112 trav MDXI01020486.1 59693 GIYGADSVTQTDGTIMISQWDPVRLNCTYQFSASVTVYPFWYVQFTNQPPRLLLRDLGRENSDEGIRKGFDATHDKKNKSFHLWKPSSELSDSATYYCAASDTV
Malaclemys terrapin terrapin V111 trav MDXI01020486.1 55746 SCCEAQVDQSPESLVTGEGKVSTMSCSFTSAYQTFQWYQQLPGQGPTHLLTVSSNENVTVGRFIGERLESGKCSSLHITDSQLGDSGSYLCAVDAQ
Malaclemys terrapin terrapin V110 trav MDXI01020486.1 48916 SALGDSVKSNEPEVSGSVGGSVTLSCSYATTDSYVYLYWYRQYPNQAPQYILYRGAKSYSGQSHTANFAQQRFSSQADDSSTALNFTALELADTAVYYCALQR
Malaclemys terrapin terrapin V109 trav MDXI01020486.1 43696 DSVFQSPLEVTVSEGHDVLLHCNFTTTSSGPYLFWYRQYPNQPPQHILTAYKSPAEKNTFTTGKFSTVLFDHNKTVPLKIEAVSLQDSAVYYCALR
Malaclemys terrapin terrapin V108 trav MDXI01020486.1 38545 ANGESVTQPDDRVTVSQGEPVLLKCTYDNTPIPTLWWYEQHPNEAPRLLLTQYEASDEEDRKRRRGFSATPEKQESFHLKKNSSELSDSAVYYCGMS
Malaclemys terrapin terrapin V107 trav MDXI01020486.1 36028 ANGESVTQPDDRVTVSQGEPVLLKCTYDTSYGTPTLWWYEQRPNEAPRLLLGDYEASDEEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V106 trav MDXI01020486.1 33760 ANGESVTQPDDRVTVSQGEPVLLKCIYDYDTSYSTPTLWWYEQRPNEAPRLLLTQYEASDEEARRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V105 trav MDXI01020486.1 20455 SCCEAQVDQSPESLVTGEGEVSTMSCSFTSAFKIFQWYQQLPGQGPIHLLTVSSNENVTLGRFTGERLESGKRSSLHITDSQLGDSGSYLCAVDAQ
Malaclemys terrapin terrapin V104 trav MDXI01020486.1 17691 SCCEAQVDQNPQSLVTGEGKVSTMSCAFTSKYQTFHWYQQLPGRGLTYLLSVSPQENATEKRFVGQPLEDGKRSSLHITDSQLGDSGSYLCAVDAQ
Malaclemys terrapin terrapin V103 iglv MDXI01019934.1 43689 RADSAAFSVCVSRAKGSTHLLREQHWGQECALVPTETWQRPVLVIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSSSDQ
Malaclemys terrapin terrapin V138 igkv MDXI01004217.1 245281 SSGQKVMTQTPESLAVSPGDRVTINCKASSSIGGAIAWYQQKTGQTPKLLIYSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQYNSWP
Malaclemys terrapin terrapin V137 igkv MDXI01004217.1 247993 SSGQIVMTQSPESLAVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKPLIYSASNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQCSSYP
Malaclemys terrapin terrapin V136 igkv MDXI01004217.1 256130 SSGQTVLTQTPEFLAVSPGDRVTINCKASSSASTGMAWYQQKSGQAPKLLIHNASTRPSGVPDRFSGSGSGTDYTFTISRVEADDAGNYYCQQYYNWP
Malaclemys terrapin terrapin V135 ighv MDXI01004094.1 6398 VRSQALVESGGDVKKPGDSLRLSCKASGFTFTSYYMDWVRQAPGKGLEWVAEINSDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYYCARQTMTL
Malaclemys terrapin terrapin V134 igkv MDXI01003663.1 8876 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVTSGSYHYLAWHQQKSGQAPKLLIYAGSSLQTGVPARFSGSGSGTDFTLTISRVEAEDAGDYYCQQ
Malaclemys terrapin terrapin V133 trav MDXI01020573.1 24106 ANGESVTQPDDRVTVSQGEPVLLKCTYDTSYRTPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V132 trav MDXI01020573.1 21733 NGEPVTQPDARVTVSQGEPVLLKCTYDPSQSPRLWWYEQHPNEAPRLLLGDYEAFSDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMSDTVI
Malaclemys terrapin terrapin V131 trav MDXI01020573.1 17879 TFGDSVTTEGTVIVKEGAPLVIECTYESILFHYLLWYIQHTHKAPKLWLRDKTSGGGRDEGDKQGFFADHVQDKKSFDLKKSSSEVNHSAVYYCAFR
Malaclemys terrapin terrapin V130 trav MDXI01020491.1 47908 ANGESVTQPDDRVTVSQGEPVLLKCTYDTSYGTPTLWWYEQHPNEAPRLLLTQYEAFSDEERRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Malaclemys terrapin terrapin V129 trav MDXI01020491.1 44339 NGEPVTQPDARVTISQGEPVLLKCTYDTSQSPRLWWYEQYPNEAPRLLLGDYEAFSDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMSDTVI
Malaclemys terrapin terrapin V128 trav MDXI01020491.1 10663 AVLSDSVRSNEPEVSGSEGGSVTLSCSYETSYTAGVSLYWYRQYPNRAPQYILRRGAKGITFSDTADFAQDRFSSQADDSSTVLSITSLELADTAVYYCALQRAQ
Malaclemys terrapin terrapin V127 trdv MDXI01020491.1 9282 LSQGQGSVTQTQGQLAKLGVQTVTLECTFSTGYQNYYLFWYRQHGSGAMDFLFRISQSNAQKNGAGRRFSAEFRKSFKFFSLTIKELEPTDSALYFCALWE
Malaclemys terrapin terrapin V126 trav MDXI01020491.1 968 FVQGDSVFQSPLEGTVSEGHDVLLQCNFTTDFTSPNLFWYRQYPNQPPQHILTAYKSPAEKNTFTSGKFSTVLFDANKTVLLKIEAVSLQDKAVYHCALR
Malaclemys terrapin terrapin V125 trav MDXI01020486.1 159617 LAQSDSVDQSPPEVSVSEGQSVTLHCNFTTADSSPYLFWYRQFPNRPLQHILTKAEFDAPDQTLFQGKFSASLYMANETVPFQTEAVSHQESAVYYCALR
Malaclemys terrapin terrapin V124 trav MDXI01020486.1 156468 AALGDSVQSREPEVSRSEGNTVSLSCSYDTSSSDVYLYWYRQYPHQAPQYILWRGAKSYRDLSDTAAFSQKRFSSQADDSSTVLNITALELADTAVYYCALRL
Malaclemys terrapin terrapin V123 trav MDXI01020486.1 152496 AALGDSVQSREPHLSGREGDAVTLTCSYDTSSTGYVYLFWYRQFPNQAPQYILFRGVKQARDESNTADFAQKRFSSQADDSSTILSIKALELADTAVYLCALSV
Malaclemys terrapin terrapin V122 trav MDXI01020486.1 150674 VVLGDSVQSKEPEMSGIEGGSVTLSCSYTTSYTGSLSLYWYRQYPNQAPQYILQRGAKGNTYDHTADFAQERFSSQATDSSTVLNITVLELTDTTMYYCALQRAQ
Malaclemys terrapin terrapin V121 trdv MDXI01020486.1 144863 SSQGQSSVTQTQGQLEKLGGQTVTLDCTFSTGYQNYYLFWYRQQRSGAMDFLFRIDESNVEKNGAGRRFSAQFSKSVKLFSLTIKELEPTDSAVYFCALWE
Malaclemys terrapin terrapin V120 trav MDXI01020486.1 142863 LSTGKNSVTQKQGQLTGLQSDSVTLGCTFSTEDAVYDIYWYKQDSSGEVKYLFRRSAGSEHNGARSWFSLDFRRAEKYVGLRIAELERNDSAMYFCAIAERALG
Malaclemys terrapin terrapin V119 trav MDXI01020486.1 108890 AALGDSVQSKEPHVSGVEGGSVTLSCYYNTTDFSGVSLYWYRQSPNRAPQYILRRGTKVYATYSENADFAQERFSSQADDSSTVLTITALELTDTAVYLCALQR
Malaclemys terrapin terrapin V118 trav MDXI01020486.1 103440 LAQSDSVDQSPPEVRVSEGQSVTLHCNFTTADSSPYLFWYRQFPNRPPQHILTKWKFDAPDQTLVQGKFSASLYMANKTVPFKIEAVSHQESAVYYCALR
Malaclemys terrapin terrapin V117 trav MDXI01020486.1 88637 TFGDSVTQTEGTVLVKEGAPLVIECTYETILFPYLLWYIQYPNEAPKLWLRDKTSGGGQDEGDKQGFFADHVQDKKSFDLKKSSSEVNDSAVYYCAFR
Malaclemys terrapin terrapin V174 igkv MDXI01007052.1 6966 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSNYLAWYQQKSGQAPKLLIYGATTRPTGIPDRFTGSGSGTDFTLAISRVEAEDAGDYYCQQGYIP
Malaclemys terrapin terrapin V173 trav MDXI01006867.1 8456 DSVTQTQGSVTISQGEPVRLNCTYQFSVTPYPLWYVQFPSQALTLFLRDVGRDESDEGIIKGFDATHDKKHKSFHLWKPSSDVSDSGTYYCAAS
Malaclemys terrapin terrapin V172 trav MDXI01006867.1 12515 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPPGESLNFLSRQHSGGTKRNEAGERFSVNLEKSKSSVTLRITALELGDAAMYFCAF
Malaclemys terrapin terrapin V171 iglv MDXI01006437.1 290452 SSSQPVLTQPPSVSVSTGNTMKLSCTMSSGTSISGYYVNWYQQKPGNSPRYLLRYKSDSDKGQGSGVPARFSGSKDTASNTGYLTISWTLVEDEADYYCAV
Malaclemys terrapin terrapin V170 iglv MDXI01006437.1 296563 SLAQYVLTQPPSVSVSLGQKAQLTCSGNNIGGKYVSWYQQKPGSAPVLVIYNDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVEDSST
Malaclemys terrapin terrapin V169 iglv MDXI01006437.1 301821 SSSQPVLTQPPSVSVSPGNTVKLSCTMSSGTSIGSYTVHWYQQKPGNSPLYLLYYYSDSSKGQGSGIPARFSGSKDTASNAGYLTISGVLAEDDADYYCAV
Malaclemys terrapin terrapin V168 iglv MDXI01006437.1 306739 SLAQYMLTQPPSVSVSPGQNAQITCSGNNIGSKSVHWYQQKPGSAPLLVIYDDSDRPSGIPDRFSGTNSGNTATLTITGVQAQDEADYYCQVWDINA
Malaclemys terrapin terrapin V167 iglv MDXI01006437.1 321117 SSSQPVVTLPLPVSVSPGNTMRLSCTMSSGTSISGYGVSWYQQKPGNSPRYLLYYYSESSKGQGSGVPAGFSGSKDTSSITGYLTISGALAEDEGDYYCAV
Malaclemys terrapin terrapin V166 ighv MDXI01005501.1 5975 AGAQARLVESGGDIKKPGQSLRLTCKGSGFDFSQAGMHWVRQAPGKGLEWVSVIFFYGNKEYYAASVKGRFTTSRDNSPNLAYLDMSSLKPEDMTRYYCAA
Malaclemys terrapin terrapin V165 ighv MDXI01005501.1 8944 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSAMSWVRQAPGKGLEWVAIIYTGGSSTYYLDSVKGRFTISRDDSKNELYLQMTSLRSEDTARYYCAR
Malaclemys terrapin terrapin V164 trav MDXI01005146.1 5065 LAQSDSVDQSPPEVSVSEGQSVTLHCNFTTLGTNPYLFWYRQYPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMANKTVPFKIEAVSHQESAVYYCALR
Malaclemys terrapin terrapin V163 ighv MDXI01005021.1 5987 VWSQIQLIQSGAEVKRPGDSAKLSCKVSGYTYTSYGMHWARRAPGEGLEWVSSITHRAGDTTHYTDSVKGRFTISRDNTQNLLFLQMAGLKPEDTAVYYCASNGV
Malaclemys terrapin terrapin V162 ighv MDXI01005021.1 24383 PADPVRAEIKKPGESVRVTCKTSGYTFTSYYINWVRQAPGKGPEWIGYISAYSGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Malaclemys terrapin terrapin V161 ighv MDXI01005021.1 31809 AWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYEMSWVRQAPGKGLEWIAYIYSTSIYYSDSVKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Malaclemys terrapin terrapin V160 igkv MDXI01004447.1 11584 SSGQIVMTQTPESLSVSVGETVTIKCKASTSISYYIAWYQQKSGQAPKLLIYYASNRPTGIPDWFGGSGSGTDYTFTISRVEADDAGDYYCQQYNFP
Malaclemys terrapin terrapin V159 ighv MDXI01004229.1 1966 VKAQIQLVQSGAEVKKLGESVKMSCKGSGYTFTSYAISWVRQAPGKGLVYIGWTNTNTGVPTYADSFKGKVTMTLDTSLSTAFLQVSSLKAEDTAVYYCAR
Malaclemys terrapin terrapin V158 igkv MDXI01004217.1 17112 SSGQTVMTQSPESLAVPVGGRVSINCKASTSISNYLHWYQQKPGQAPKLLIAYASNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQGNNFP
Malaclemys terrapin terrapin V157 igkv MDXI01004217.1 27910 SGGQTVITQTPESLSVSPGDRVTINCKASSSVSGYMAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDYTFTISRVEAEDAGDYYCQKHNSAP
Malaclemys terrapin terrapin V156 igkv MDXI01004217.1 37077 SSGDIVLTQTPESLTVSPGASVTISCKSSSSIGNAVAWYQQKSGQVPKLLVYGPSTRPAGIPDRFSGTGNGNTDYSLTIRSVEVDDTGDYYCQQYTSYP
Malaclemys terrapin terrapin V155 igkv MDXI01004217.1 43398 SSGQMVMTQTPEFLAVSPGDRVAINCKASSSTSNHVAWYQQKAGQAPKLLIYAAFTRYTGVPARFSGSSAVSGTDYTLTISSVEAEDAGDYYCQ
Malaclemys terrapin terrapin V154 igkv MDXI01004217.1 55462 SSGQIVMTQTPESLAVSPGDRVTINCKASSSVSSWMAWYQQKSGQAPKQLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVETDDAGDYYCQQHSSSL
Malaclemys terrapin terrapin V153 igkv MDXI01004217.1 61762 SSGQLVLTQTPESLEVSPGDTVTMYCKASSSVTSNFMAWYQQKSGQVPKLLIYGASTRASGIPDRFSGSGSGKDFTFTISRAEADDAGDYYCQQHSSSL
Malaclemys terrapin terrapin V152 igkv MDXI01004217.1 71054 SYGQVTMTQSPEFLSVSPGEKVTIRCTASSSLDRDYVSWYQQKSGQAPKLLIYRASTLASGVPARFSGSGSGTAYTLSISSVEANDAADYYCFQRDSSP
Malaclemys terrapin terrapin V151 igkv MDXI01004217.1 78787 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQALKLLIYRASTRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Malaclemys terrapin terrapin V150 igkv MDXI01004217.1 93567 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQALKLLIYRASTRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Malaclemys terrapin terrapin V149 igkv MDXI01004217.1 100946 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQALKLLIYRLLPVPLGSQTVQWQWVWQGLHFTISRVEADDAGDYYCQQYTS
Malaclemys terrapin terrapin V147 igkv MDXI01004217.1 127723 SSGQIVLTQTPESLAVSPGDRVTINCKASSSASTGMAWYQQKSGQAPKLLIYAATSRYTGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYY
Malaclemys terrapin terrapin V146 igkv MDXI01004217.1 142263 SSGQIVLTQTPESLAVSPGDRVTINCKASSSTGNNLAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGSGYTDYTLTISSVEAEDAGDYYCQQGNSFP
Malaclemys terrapin terrapin V145 igkv MDXI01004217.1 162591 SSGQIVMTQTPESLSASVGETVTMKCQASSSISTYAHWYQQKSEQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTISGVEADDAGDYYCQQGGYSAP
Malaclemys terrapin terrapin V144 igkv MDXI01004217.1 209483 ASGQIVLTQSPESLLVSPGDRVTINCKASANAYSFMAWYQQKSGQAPKLLIRSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYASSP
Malaclemys terrapin terrapin V143 igkv MDXI01004217.1 212811 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSSYLAWYQQKSGQAPKLLIYGATTRPSGIPDRFTGSGSGTDFTLAISRVEAEDAGHYYCQQG
Malaclemys terrapin terrapin V142 igkv MDXI01004217.1 217461 SSGQIVMTQTPESLSASVGETVTIKCQASSTIGTYAHWYQQKSGQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTINGVEADDAGDYYCQQ
Malaclemys terrapin terrapin V141 igkv MDXI01004217.1 227371 SSGQTVMTQTPESLAVSPGDRVTINCKASTSISGAIGWYQQKSGQAPKILIYGPSTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCMQAASFP
Malaclemys terrapin terrapin V140 igkv MDXI01004217.1 230086 SSGQIVMTQSPESLAVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKPLIYGASTLQSGVPVRFSGSGSGTDFTFTISSVEAEDAGDYYCQQCSSFP
Malaclemys terrapin terrapin V139 igkv MDXI01004217.1 235157 SSGQIVMTQTPESLSASVGETVTIKCQASSSIGTYAHWYQQKSGQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTINGVEADDAGDYYCQQ
Malaclemys terrapin terrapin V211 ighv MDXI01008498.1 8506 VRSDVQLVESGGDVKKPRDSLRLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTTIYYSQAVKGRFTISRDNSSNLLNLQMSELKAEAMGLYYCARQ
Malaclemys terrapin terrapin V209 iglv MDXI01008422.1 5568 ASSQPTLTQPPADSVSLGNTVKLSCTLSSQHSSYNVGWYQQRDGQAPRFLWYGSSIKGDGVPDRFTVSSSGAIRYLTITKVQPEDEATYYCGTGDSNG
Malaclemys terrapin terrapin V208 iglv MDXI01008422.1 13465 ASSQPVLTQPSSESVSPGQTAKLSCAMSSGYSLSSYNLYWYQQRSGQAPRFVLSGTSSRGDGIPDRFTGSSSGNDGYLTITNIQAEDEADYYCAIWHGSGGV
Malaclemys terrapin terrapin V207 igkv MDXI01008416.1 5884 FSSQQLQSLKASELVSPGGTVTLSCSLSSGAIADGNYPFWIQQRLGNVPRLIMHTTSTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWTGSA
Malaclemys terrapin terrapin V206 iglv MDXI01008416.1 15237 FSSQQLQSLKVSEFVSPGGTVTLSCSLSSGALTDHNHPFWVQQRLGNVPRLIMHSTSTRPSGIPERFTGSRSGNTMSLTITGALAEDDADYYCSVWAVS
Malaclemys terrapin terrapin V205 iglv MDXI01008416.1 21808 SSYQFTLTQPLSMSVTPGETVQLACVLSSGDSISSRYIHWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCADWD
Malaclemys terrapin terrapin V204 ighv MDXI01008106.1 12947 VQAQVRFVESGGDMRKPGDSLQLSCRGSGFSFGDHWLSCLRLSPGKGLEWVATISFWAGDTKRYAASVTGRFSISRSNGQNMLYLQMNNLKPEDTGIYFCSQ
Malaclemys terrapin terrapin V203 ighv MDXI01008106.1 12947 VQAQVRFVESGGDMRKPGDSLQLSCRGSGFSFGDHWLSCLRLSPGKGLEWVATISFWAGDTKRYAASVTGRFSISRSNGQNMLYLQMNNLKPEDTGIYFCSQ
Malaclemys terrapin terrapin V202 trav MDXI01007782.1 9789 AALGDSVQSREPHLSRREGDAVTLTCSYDTSSTGYVYLYWYRQFPGQAPQYILYRGAKSARELSNTAGFAQERFSSQADDSSTVLNITALELADTAVYLCALDV
Malaclemys terrapin terrapin V201 ighv MDXI01007782.1 21437 VRSQVQLVESGGDVKKPGDSLHLSCKASGFSFSSYTMYWVRQAPGKRLEWVSHIYGDGSQQFYADSVKGRFTISRDNPNSLLYLQMTGLKPEDTARYHCA
Malaclemys terrapin terrapin V200 ighv MDXI01007782.1 24802 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYQMHWVRQAPGKGLEWVSLIYTDGSKSYYSDAVKDRFTISRDNSNNLLYLQMTGLRLEDTARYYCAR
Malaclemys terrapin terrapin V199 trdv MDXI01007782.1 28380 VGSDVVLEQGAQAFSVREGEEVTFQCSVKGGKMSSYWMYWYRKGQRGPLTWIYREGDHYGEGFQGRFVGKVDSSNNRFTLRILSAELRDRAVYYCASS
Malaclemys terrapin terrapin V198 trav MDXI01007782.1 31587 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRQEDLEERFRNRFKAKINKTSRVFPLNISSVQLSDSATYYCAIE
Malaclemys terrapin terrapin V197 igkv MDXI01007782.1 34447 GICLSEVTQSPDQSGAELADAKIQCTHDTPDGNYDSIYWYYRKANTELTYIIHSYSEERNSGRFGVSVDRANSSSILTIRALQPGDGAVYYCALQ
Malaclemys terrapin terrapin V196 trav MDXI01007782.1 45275 AALGDSVQSREPHLSGREGDTVTLTCSYDTSSTGYVYLYWYRQFPNQAPQYILRRGVKQARGQSHSADFAKGKFSSQADDSSTVLNITALELADTAVYLCALRL
Malaclemys terrapin terrapin V195 trav MDXI01007782.1 47964 AALGDSVQTREPHLSGREGDSVTLTCSYDTSSTGYVYLFWYRQFPGRAPQYILFRGVKQARGQSNTAEFAQQRFSSQADDSSTVLNITALELADTAVYLCALQR
Malaclemys terrapin terrapin V194 trav MDXI01007782.1 50643 AALGDSVQSNDPQVSGIEGGSVTLSCSYTTSHTGSLSLYWYRQYPNQALQYILQKGAKGSRYQHTANFAQQRFSSQADDSSTVLTIRALELADTAVYLCALQRAQ
Malaclemys terrapin terrapin V193 trav MDXI01007782.1 53500 AVLSDSVQSEETQVSGAEGDAVTLRCSYTTSYTGSVYLHWYRQDPNQGLQYILWRGAQDARAFSDTADFAQERFSSQVDDSSTGLNITALEVADGAVYYCALGL
Malaclemys terrapin terrapin V192 trav MDXI01007782.1 69914 AALGDSVQSKEPHVSGVEGGSVTFSCSYNTTDSRGVYLYWYRQSPNQAPQYILWRGTKLYAANRDTADFAQQRFSSQADETSTILNITALELADTAMYLCALQR
Malaclemys terrapin terrapin V191 trav MDXI01007782.1 76633 FAQSDSVDQFPPEVRVSEGQSVTLHCNFTTLGTNPYLFWYRQYPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMPNDTVPFKIEAVSHQESAVYYCALR
Malaclemys terrapin terrapin V190 trav MDXI01007782.1 77641 RTCANTIMQPERITTIHEGKPVLLHCTYNSSVVQSLFWYEQCPQEAPRLLLTQYEASDEEEKRRRRGFSATLEKDSKSFHLEKNSSEVSDSVVYYCAMR
Malaclemys terrapin terrapin V189 trav MDXI01007782.1 80327 ANGNSVTQTEGSVTICEGEPVLLNCTYETTGYPTLFWYVRYGSQAPRLFLREGSADPEEGNRKDFSAHHKDRTYHLSKLSSRLSDSGVYYCAMN
Malaclemys terrapin terrapin V188 trav MDXI01007782.1 90933 TYGDSVSQTEGSIVISQGNPVLLNCSYETSFTAFPFWYVQYPSDSPTPRLFLRDTEREKGDLGIVKGFNATHDEQKKSFHLWKPSSELSDSGTYYCAASDTV
Malaclemys terrapin terrapin V187 trav MDXI01007782.1 100647 GAVDAKVSQSAALSFLAGGMADLPCNHSVAGYDRVIWYYQSPGVAPRAVISGYNSAETSGRFELSIDSPSRSAPLRITEVAVEDSGVYYCVVR
Malaclemys terrapin terrapin V186 trav MDXI01007782.1 102074 SCCEAQVVQSPEWLVTGEGKVSIMSCAFTSGFKVFQWYQQLPGQGPTHLLTASSNENVTVGRFIGERLESGKRSSLHITDSQLGDSGSYLCAVDAQ
Malaclemys terrapin terrapin V185 trav MDXI01007782.1 107091 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPPGESLNFLSWQHSGGAKKNEAGERFSVNLEKSKSSVSLRITALELGDAAMYFCAFSR
Malaclemys terrapin terrapin V184 ighv MDXI01007074.1 5124 ILSQVQLVPSGPGAVKPGETLALTCVVSGVSITESSYAWDWVRQPPRKGLEWVASIYPPDGGKWFAASLQSRTTISSDTSKNQFSLQLASLTAADTAMYYCVRDT
Malaclemys terrapin terrapin V183 ighv MDXI01007074.1 10315 PILGFTMMQSGLGEVTVSGSLSLTCAVSDSVLSTGGDWWHWLRQPPGKGLVWLALIDRYGNTHYLPDIQNRTTITVDPSKDEFYLRVDSLSPQDTATYYCAR
Malaclemys terrapin terrapin V182 ighv MDXI01007074.1 20935 VSSQIQLTQSGAENKKLGESVRVTCKTSGYTFTDYTINWLRQTPGKGLEWIGLIYPSTGGTVYTQAFQGRFTITRDNSISTTYLQLGSLRTDDTATYYCA
Malaclemys terrapin terrapin V181 ighv MDXI01007074.1 31564 LVESGGDVKKPGDSLRLSCKASGFTFSSYWMNWVRQAPGKGLEWVAAINTGGSSTYYLDSVKGRFTISRDNSKSELYLQMTGLRSEDTARYYCAR
Malaclemys terrapin terrapin V180 ighv MDXI01007074.1 38072 TRSQVVLTQSGPALKKPGESHKLQCATSGFTLSSTTMGWFRQESGKGLEWLVSYYDPSINNYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCA
Malaclemys terrapin terrapin V179 ighv MDXI01007074.1 41271 VSSQVTLVQSGQGLLKPSESLKLTCTVSGVSITDGCCWWHWIRQSPGRAWEWLGLIKNDGSVVYSQSFQSRLTVSRDTAKNAYYLQISSMTNEDTATYYCMR
Malaclemys terrapin terrapin V178 ighv MDXI01007074.1 52743 VRSQIQFVQSGAEIKKPGESMKLTCKASGYTFNEYRMNWVRQAPGKGLEWVAPIRTDTFETFYPQNLKGRVTISVDVPLSTAYFQMNGLKSEDTAVYYCAR
Malaclemys terrapin terrapin V177 trav MDXI01007074.1 55793 IQSQVSLIQPIAEVRRPGESLKLTCKFSGFNFTKYWMQWVRQAGEIGLTWIGEVSTSGVSTNMLQSLRPRFSITRDNTNNMVHLEMRNLQADDSATYYCA
Malaclemys terrapin terrapin V176 igkv MDXI01007052.1 3624 ASGQIVMTQTPESLLVSPGDRVTINCKASTSISSNIAWYQQKSGQAPKLLFYGTSSHPSGVPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQYNSWP
Malaclemys terrapin terrapin V247 trbv MDXI01015831.1 98522 IHSATIVQSPQSVVEELGRQISLECSLEGTSNPYIYWYRQLPGGQIYMLAYSVSIGQVDNTGPSHFSTSRTKDKEFLLSINGLLANDTGVYYCAW
Malaclemys terrapin terrapin V246 trbv MDXI01015831.1 146539 TRSATIVQSPQSVVEQLGRQASLECSLEGTSNPNIYWYRQLPAGQIHMLTYSVSTGEVDNTGLSSHFNASRPKDEEFLLSINGLLANDTGVYYCAWS
Malaclemys terrapin terrapin V245 trbv MDXI01015831.1 163348 HTDAKITQTPSLVLKRGQTAQLTCRQTDSHSYMYWYQQQQGKGLQLIYYSVTVANKEEGDIKDGFTASRPQINVFDLNITSVKMEHSAEYFCASSL
Malaclemys terrapin terrapin V244 ighv MDXI01013820.1 34877 RLVESGGDVKKPRQSLRLTCKGSGFDFSQAGLHWFRQAPGKGLEWVSVIFFHGSKEYYTASVKGRFPTSRDNSPNLAYLDMSSLEPEDTARYYCAA
Malaclemys terrapin terrapin V243 iglv MDXI01013657.1 2492 SCAQHVVTQPPSMSASPGQTVKLSCSVSGGYDISSYGVRWYQQTPGNPPRYLLYYYSDSSTGRGSGVPDRFSGSASGSVGYLTISGLQAEDDADYYCATWDDNAEM
Malaclemys terrapin terrapin V242 iglv MDXI01013657.1 6303 SSSQPVLTQTPSVSVSPRENVRLACTMSSGYSIASYRVGWLQQKPGSAPWFVYHYYTSSDQGRGTGIPARFTVSPDTSNNLWNLVISGVQAEDEADYYC
Malaclemys terrapin terrapin V241 iglv MDXI01012791.1 16968 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAVTTSNYPAWYQQKPGSAPRQLIYSTNTRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCAVWYVS
Malaclemys terrapin terrapin V240 iglv MDXI01012791.1 47641 SSYQFTLTQPLSISVTPGESVQLACVPSSGESISSRYIRWYQQKQGEKPRYLLYYKDDSTQYKASGVPDRFTASKDTSRNTCFLTISRAQVEDEADYYCSDWD
Malaclemys terrapin terrapin V239 trgv MDXI01012791.1 67499 WSSQSALTQTSSMAVKLGETAELHCTLQGVEYISNNSPSWYQQRSGTAPRLLIYNSRSRASGIPERFSGEMNGNRASLTITGALAEDEGDYYCAVWYSSSHHS
Malaclemys terrapin terrapin V238 iglv MDXI01012791.1 82004 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGAIADGNYPLWVQQRLGNVPRLIMYSTSTRPSGIPARFTGSRSGNTMSLTITGALAEDDGDYYCSVWAVS
Malaclemys terrapin terrapin V237 iglv MDXI01012791.1 88284 SSYQFTLTQPLSMSVTPGETARLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Malaclemys terrapin terrapin V236 iglv MDXI01012791.1 93735 TSSQYVVTQEPSLLVSPEGTVKLSCSVSIVSDITSIYPYWFQQRGGGVPRLLIYNANVKVSGTPERFSGSSSGDTAYLTIKGALAEDEADYYC
Malaclemys terrapin terrapin V235 iglv MDXI01012791.1 107460 AGGLFTQPASETVSPGATVRLSCAMSHGTSISGYYISWLQQRAGNPPRYLLYYKDESAKGLGSGVSDRFSASKDASTNTCHLILTGAQAEDEADYYC
Malaclemys terrapin terrapin V234 ighv MDXI01008987.1 7563 VLSEVRLVQSGPGVAKPGETLTLTCAVSGISITDSTYYWQWIRQAVGKGLEWMGLLHPNSGGTSYAPSLKGRVTLSADSSKNQVSLQLRSLTAADTATYYCAR
Malaclemys terrapin terrapin V233 ighv MDXI01008867.1 310 ARSQVVLTQSGPALKKPGESHTLQCATSGFTLSSYWMGWFRQEPGKGLEWLAWYYDEGNKHYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Malaclemys terrapin terrapin V232 ighv MDXI01008867.1 6561 VRSQVQLVESGGGIQTPGGSLRLACKASGFTFSSHWMNWVRQAPGKGLEWVAEILEPVNNLAAYYSDAVKGRFTISRDESTSSVYLQMNSLRAEDTARYYCVR
Malaclemys terrapin terrapin V231 ighv MDXI01008867.1 9122 ARSQVLVESGGDVKKPGDSLRLSCKASGFTFSSSDMSWVRQAPGKGLEWVSRIYTDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYHCA
Malaclemys terrapin terrapin V230 ighv MDXI01008867.1 21583 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYINWVRQAPGKALEWIGYIAPSTGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Malaclemys terrapin terrapin V229 ighv MDXI01008867.1 35648 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYDISWVRQAPGKALEWIGYINPSSGGTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Malaclemys terrapin terrapin V228 ighv MDXI01008867.1 42357 VRSQIQLVQSGAEMKKPGESVKLTCKASGYTFTDYSMSWVRQAPGKGLEWVATIWTNNFNTFYPEALKGRTTVSVDTSISTTYLQMNSLKSEDSAVYYCAR
Malaclemys terrapin terrapin V227 ighv MDXI01008867.1 61270 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYNINWLRQAPGKGLEWIGYITPSTGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Malaclemys terrapin terrapin V226 ighv MDXI01008867.1 64755 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYMHWVRQAPGKALEWIGYINPNSGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Malaclemys terrapin terrapin V225 iglv MDXI01008848.1 11889 VSSQPVVNQEPSVFITPGGAITLSCSLSTGAITTSNYPSWYQQKPGSAPRMLIYETSKRPSGIPARFSGSISSNDAALTITGVQVEDDADYYCAVYTGSSG
Malaclemys terrapin terrapin V224 ighv MDXI01008804.1 3200 VLSQVQLVQSGPGMVKPGETLALTCAVSGVSITDRSYDWNWIRQPPGKGLEWMGYVYPYNSGETGYAPSLQARITISADTAKNQFSLQLRSLTAADTATYYCA
Malaclemys terrapin terrapin V223 ighv MDXI01008804.1 9480 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSGYTMYWVRQAPGKGLEWVSRIYDDGSAVYYADTVKGRFTISRDNPKNLLYLQMSNLKPEDTGRYYCAR
Malaclemys terrapin terrapin V222 iglv MDXI01008607.1 4119 SSSQTVVTQPPSVSVSPGNTVKLSCTLSSGTSIGDHVVSWYQQKPGNSPRYLLYYYTDSSKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAVRKS
Malaclemys terrapin terrapin V221 iglv MDXI01008607.1 6039 SLAQYVLTQPPSVSVSPGQNAQFTCSGNNIGSKNVQWFQQKPVSAPLLVIYASSSRPSGIPDRFSGAKSSNTATLTITGVQAQDAADYYCQVWDSNA
Malaclemys terrapin terrapin V220 iglv MDXI01008607.1 12107 SLAQYVLTQPPSVSVSLGQNAQLTCSGNNIGSKDVQWYQQKPGSAPLCVIYGSSSGPSGIPDRFSGANSSSTATLTITGVQAQDEADYYCQVWDSSAQ
Malaclemys terrapin terrapin V219 ighv MDXI01008533.1 955 VLSQVQLVQSGPGAVKPGETLTLTCAVSGVSISAQNSVWHWNRQPPRKGMEWMGYVYPYNGVTGYASSLQGRATISGDTSKNQVSLQLRSLTAADTATYYCARE
Malaclemys terrapin terrapin V218 ighv MDXI01008533.1 955 VLSQVQLVQSGPGAVKPGETLTLTCAVSGVSISAQNSVWHWNRQPPRKGMEWMGYVYPYNGVTGYASSLQGRATISGDTSKNQVSLQLRSLTAADTATYYCARE
Malaclemys terrapin terrapin V217 ighv MDXI01008533.1 6945 VLSQVQLVQSGLGTVKPGETLTLTCAVSGVSITDSSYVWNWIRQPPGKGLEWMGYVYMYSGGGTNYAPSLQGRITISGDTAKNQFSLQLRSLTAADTATYYCARNTQ
Malaclemys terrapin terrapin V216 ighv MDXI01008533.1 11570 VLSQVRLVQSGPGIVNPGETFTLTCAVSGVPINDFSYSWNWIRQPPGKGLEWMGYVYPCNSRETGSAPSLQGRVTISADTAKNQVSLQLRSLTAADTAAYYCA
Malaclemys terrapin terrapin V215 ighv MDXI01008533.1 22905 VLCQVQLVQSGPGAAKPGETLTLTCAVSRFSITTQYYVWHWIRQPPGKELEWMGYVYPYNSGETGYAPSLQARITISADTAKNQFSLQLRSLTAADTATYYCAR
Malaclemys terrapin terrapin V214 ighv MDXI01008533.1 29826 VISQVQLVQSGPGAVKPGETLALTCIVSGVSITSSSYAWNWVRQPPGKGLEWVARIYPHDGRKWFAASLQSRTTISSDTSKNQFSLQLASLTAADTATYYCAR
Malaclemys terrapin terrapin V213 ighv MDXI01008533.1 38049 AWSQSLAESGGDVKKPGDSLRLSCKASGFTIRSYGMSWVRQAPGKGLEWVAYIYSSSIHYSDSVKGRFTVSRDNPNSLLYLQMNSLKPEDTARYYCTG
Malaclemys terrapin terrapin V284 trav MDXI01020600.1 46689 AVLGDSVQPREPQMSGVEGGSVTLSCSYESSYTAGVYLYWYRQYPNRAPQYILRRGTKGSRSGSDTADFAPERFSSQADGNSTALSIAALELADTAVYYCALQR
Malaclemys terrapin terrapin V283 trav MDXI01020600.1 54969 AALGDSVQSREPEVSRSEGDAVTLSCSYDTSSTDVYLYWYRQYPDQAPQYILWRGAKSSRELSDTAGFAQKRFSSQADDSSTVLNITALELADTAVYYCALRL
Malaclemys terrapin terrapin V282 trav MDXI01020588.1 9451 RTHADSVTQPKGTVPIQEGKHVLLHCTYDYSGSTPILFWYEQYPHEAPRLLLTQYEASDEEEKRRSRGFSAKLEKDSKSFHLEKNSSEVSDSAVYYCAMR
Malaclemys terrapin terrapin V280 trav MDXI01020586.1 2724 AVLSDSVRSNEPEVSGSEGGSVTLSCSYETSYTTGVYLYWYHQYPNRAPQYILRRGAKGITFSDTADFAQQRFSSQADDSSTVLNITSLELADTAVYYCALQRAQ
Malaclemys terrapin terrapin V279 trdv MDXI01020586.1 4129 LSQGQGSVTQTQGQLAKLGGQTVTLKCTLSTGYQNYYLFWYRQHGSGAMDFLFRISQSNAQKNGAGRRFSAEFRKSFKFFSLTIKELEPTDSALYFCALWE
Malaclemys terrapin terrapin V278 trav MDXI01020054.1 1634 QSNGELVTQTKGSVLISQGESVLVNCTYEAASPSLFWYVQFPSQPLRLFLRDVGWEASDEGTRKGFDATYEKKDKSFHLWKPASELSDSATYYCAAR
Malaclemys terrapin terrapin V277 ighv MDXI01019410.1 7603 AQSQGLVESGGDVKKPRDFLRLSCKTSGFPFSSYLMDWIRLAPGRGLEWLAGAAAQGSTYYADSVQGRFAISRDNANSLVHLQISSLRAEDTALYYCVR
Malaclemys terrapin terrapin V276 ighv MDXI01019410.1 9417 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQQPGKGLEWLVHYHKSSVTNYYSPSIKGRFTASKDSSNFYLQMTGLKPEDTAVYYCA
Malaclemys terrapin terrapin V275 ighv MDXI01019410.1 46165 AQSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYWMDWVRQAPGKGLEWVAAISSGGDSAYYPDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Malaclemys terrapin terrapin V274 ighv MDXI01019410.1 53268 AFSQLNLVQSGSAMVKPSEPLKLTCAVSGNSISSSNWWSWFRRTHGQGLEWMGLITSNGNTIYAPSLQTRIAITRDAARNEYYVQVHSAVPEDTGTYYCARDIYLF
Malaclemys terrapin terrapin V273 trav MDXI01019192.1 34574 KCFLCHKISQSPSVLTVKMGNKTTLYCNYDTPQMDPGLYWYRLVSKKALQLILYRDNSRSFDAHFVKERFSVRHDHARKAFHLLISAVLSEDSTSYYCAMR
Malaclemys terrapin terrapin V272 iglv MDXI01018612.1 777 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITTSNYPGWYQQKPGSAPRQLIYQTNNRPSGIPARFSGSISGNNAALTITRVQAEDEADYYCVVHTGSA
Malaclemys terrapin terrapin V271 iglv MDXI01018612.1 14116 SNSQPTLTQPSSASVSPGNTVKLSCTVSSSMNTIAWFQQKPGQAPRFVLYGTTDRGDGIPDRFTGSTSGNVGYLTITNAQAEDDADYYCSMWYSSGSV
Malaclemys terrapin terrapin V270 iglv MDXI01018612.1 19793 SLSQYTLTQLPSVSMSIGNTVKLSCAIDSGYTFGDVAWYQQKDGKSPRYLLRYNKETNKQQGSGVPSRFAGSKDASNRNCYLTITSVQAEDEADYYC
Malaclemys terrapin terrapin V269 iglv MDXI01018612.1 23244 VSSQPVVTQEPSMSVTPGGAVTLSCSLSSGAITTSNAPGWFQQKPGSAPRQLIYNTNNRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCIVWTGSV
Malaclemys terrapin terrapin V268 iglv MDXI01018612.1 26760 SLSQFTLTQPPSVSVSIGNTVKLSCAIDNRYTLGGVPWYQQKDGNSPRYLLRYNKESDKHQGSGVPSRFSGSKDASNTTCYLTITSDQAEDEADYYCTVWSGSA
Malaclemys terrapin terrapin V267 iglv MDXI01018612.1 31401 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITTSNYPGWFQQKPGSAPRTLIYNTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCAVWASSV
Malaclemys terrapin terrapin V266 iglv MDXI01018612.1 56105 ASSQPVLTQPSSESVSPGQTAKLSCAMSSGYSLSSYNLYWYQQRSGQAPRFVLSGTSSRGDGIPDRFTGSSSGNDGYLTITNIQAEDEADYYCAIWHGSGGV
Malaclemys terrapin terrapin V265 iglv MDXI01018612.1 60487 ASSQPTLTQLPSESVSPGNTVKLSCTPSSQHSGYVISWYQQRDGQVPPFLWYNASTKGDRVPDRFTVSSSEAVRYLTITKVQPEDEATYYCGV
Malaclemys terrapin terrapin V264 iglv MDXI01018612.1 74107 SLAQFVLTQPPSVSASPGQTVTISCTRSSGSISDSWNSWYQQSPGRAPVLIIYEDSKRPSGIPSRFSGAIDSSANAATLTISGVQADDEADYYCSAG
Malaclemys terrapin terrapin V263 iglv MDXI01018612.1 77344 SDAQFVLTQPPSVSASPGQTVTISCARSSGSITASWNSWYQQSPGRAPVLIIYEDSKRPSGIPSRFSGAIDSSAKTITLTISGVQADDEADYYCASYAGSGN
Malaclemys terrapin terrapin V262 trgv MDXI01018612.1 88164 WSSQSALTQTSSVAVKPGETAELHCTLQGVEYISNNNPSWYQQRSGTAPRLLIYKSRSRASGIPERFSGETNGNRASLTITGAQAEDNADYYCAVWTGSA
Malaclemys terrapin terrapin V261 igkv MDXI01018612.1 93407 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGAIADNNYPSWVQQRLGNVPRLIMHTTSTRPSGIPARFTGSRSGNTMSLTIKGALAEDDADYYCGVWTGSA
Malaclemys terrapin terrapin V260 trgv MDXI01018612.1 96198 PSSQQLLALKPSESVSPGGTVTLSCSLSSGAITENSFPHWVQQRPGNVPRRLIQGTSARAAGVPERFTASMSGNTMSLTIAGALAEDDAGYYCAAWSGGA
Malaclemys terrapin terrapin V259 iglv MDXI01018612.1 99264 SLAQFVLTQPPSASASPGQTVTISCARSSGSIGSYYVSWYQQKPGSAPKLIIYEWNKRPSGISDRFSGSTDTSANAASLTISGVQADDEADYYCHSYDSNSN
Malaclemys terrapin terrapin V258 iglv MDXI01018611.1 13336 SDAQFVLTQPPSVSASPGQTVTISCARSSGSITASWNSWYQQSPGRAPVLIIYEDSKRPSGIPSRFSGAIDSSAKTITLTISGVQADDEADYYCASYAGSNN
Malaclemys terrapin terrapin V257 trav MDXI01018611.1 15186 VSSQAVVNQEPSVFITPGGAITLSCSLSTGAITTSNYPSWYQQKPGSAPRMLIYETSKRPSGIPARFSGSISSNDAALTITGVQVEDDADYYCAVYTGSSGA
Malaclemys terrapin terrapin V256 iglv MDXI01018610.1 2160 SLAQFVLTQPPSASASPGQTVTISCARSSGSIGSYYVSWYQQKPGSAPKLIIYEWNKRPSGISDRFSGSTDTSANAASLTISGVQADDEADYYCHSYDSNSN
Malaclemys terrapin terrapin V255 trav MDXI01015875.1 10306 GAVDTKVSQPAALSFLAGGGADLPCNHSVAGYDKIIWYYQSPGSAPRAVISGYNSAETSGRFELSIDSPSRSAPLRITEVAVQDSGVYYCAVR
Malaclemys terrapin terrapin V254 trav MDXI01015875.1 11772 SCCEAQVDQSPESLVTGEGKVSTMSCSFTSAFQAFQWYQQLPGQGPTHLLTASSNENVTLGRFIGERLENGKRSSLHITDSQLGDSGSYLCAVSAQ
Malaclemys terrapin terrapin V253 trav MDXI01015875.1 26094 SSMEDAVTQTQPAVSGVERESVSLDCTYETVASSYIFYWYKRPPGESLIFLSWQHSGGEKRNEAGERFFFSLEKSKSSISLRITALELGDAAMYFCAFSRD
Malaclemys terrapin terrapin V252 trav MDXI01015875.1 44890 VSCQIKVDQSPPSLTRSEGEISILTCSYSGTVSNVHWYRQFPGESPALLLSLYEDGNVTQGPNFIAELLKRERRSHLHIDGSQLADSAGYFCAVETQ
Malaclemys terrapin terrapin V251 trav MDXI01015874.1 30007 APGRAEIQQPGSAEALEGAELNLTCSQPSTEAGDSTVWYRQIPNPGPQFAVTGYKETVNSPEPAGALHISAERDFSPLALSPVRRGDAAVYFCARR
Malaclemys terrapin terrapin V250 trav MDXI01015874.1 31444 ATGVSVTQTKGPVSVSEGEGLRLNCSYDAAVYAVFWYVHLPSQPPRLLLRDLGRDDSDEGIRKGFDATHDKKNKSFQLWKPSSELSDSATYYCAASDTV
Malaclemys terrapin terrapin V249 trbv MDXI01015831.1 32424 HTDAEITQTPSLVLKRGETAQLTCRQTDNHNSMYWYHQQQGKGLQLIYYSLGKDSKQDGDSDIKNDFTAYRPQIEVFHLNTSSVKIEHSAVYFCASSL
Malaclemys terrapin terrapin V320 trgv MDXI01020996.1 4742 GCAQIHLRQAQLSVTRAKDKTARIICEASGIQNFRSAVIHWYRHRPGEAPERILYISAEKLEFDKDSDENKFNCEKKPDLPISTLTVNEIDPNDGATYYCAYW
Malaclemys terrapin terrapin V319 trgv MDXI01020996.1 13027 ALWAIHLEQEQISVTKQPLQGSSAKFTCKVFDGSDSTYIHWYRARAGEATQRVLYLTLSGSDLKREAAFPLEKFSAYGTKSISNLLVHKLEKTDSGRYYCATWDF
Malaclemys terrapin terrapin V318 trgv MDXI01020996.1 16948 VLRAIHLEQVPISITKEPHRSSTAEFTCKLSGISASTYIHWYRAPTGGAPQRLLYLSYSEPDPSWDTGFSSEKLTAHFQGRSICKLLVHKLEKADSGHYYCAAWDY
Malaclemys terrapin terrapin V317 trgv MDXI01020972.1 35438 GYTQITLIQTPLSVTRAVTKSASMQCTVSGSGFNFNNNYIHWYRQSPGAAPERILYIQSGSAIMDEGFNNKKFEAQNFASTSTSNLRVHQLTQEDAGVYYCAAWD
Malaclemys terrapin terrapin V316 trgv MDXI01020972.1 47383 REAQVLVQSQLSITRPEDMTVNSCSSVTGINFNSAYIHWYRQRPDAALERILYFSSGKLVFDQDSEKGKFEAEKQLSESISVLTIKKITKSDAATYYCAAW
Malaclemys terrapin terrapin V315 trgv MDXI01020972.1 54780 GYSQITLIQTPLSVTRAVSKSAYMWCRISGENFNFNNDYIHWYRQSPGAAPKRILYIRSESATMDPGFDRKKFIAENYVSASTCKFTVHQLTQEDAATYYCATWD
Malaclemys terrapin terrapin V314 trgv MDXI01020972.1 62807 GCAQIHLRQAQLSVTRAIDKTARIDCEASGIQNFGSAFIHWYRHRPGEAPEWILYFKTQADKSSFDEKKFRVEKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Malaclemys terrapin terrapin V313 trgv MDXI01020972.1 68936 REAQVLVQSQLSITRPEDMTVNSCSSVTGINFNSTYIHWYRQRPDAALERILYFSSGKLVFDQDSEKGKFEAEKQLSESISVLTVKKITKSDAATYYCAAW
Malaclemys terrapin terrapin V312 trgv MDXI01020972.1 78536 GYSQITLIQTPLSVTRAVSKSAYMWCRISGENFNFNNDYIHWYRQSPGAAPKRILYIRSELVSTDEGFDSEKFKADNYVSASTSKLTVHRLTSEDAAIYYCATWV
Malaclemys terrapin terrapin V311 trgv MDXI01020972.1 94604 GCAQIHLRQTQLSITRANDKTARIDCEALGIQNFWSAVIHWYRHRPGEAPEWILYFKTQSDQSSIDRKKFIVEKTTEKSTCTLRVDKLTYNDMAIYYCAYWD
Malaclemys terrapin terrapin V310 trgv MDXI01020972.1 118442 GYSQITLIQTPLSVTRAVTKSASMRCKISGKSFNFNSAYIHWYRQSPGAAPKRILYIQSQSVTTDPGFDEKKFIADSYVSMSTSKLTVHQLTQEDAATYYCATWD
Malaclemys terrapin terrapin V309 trgv MDXI01020972.1 126733 GCAQIHLRQTQLSITRANDKTARIDCEASGIQNFESAVIHWYRHRPGEALEWILYFKTQADKSSFDKKFSVDKTIEKSTCILRVIKLSYNDMATYYCA
Malaclemys terrapin terrapin V308 trgv MDXI01020972.1 160221 GYSQITLTQTPLSATRAGTRSAYMWCKISGKGFNLNSAYIHWYRQRPGEAPKRILYIQSGSAIMDEGFDSKKFKASNDVSASTSNLRVDKLTQEDVAIYYCATWD
Malaclemys terrapin terrapin V307 trgv MDXI01020972.1 168897 GCAQIHLRQAQLSVTRAKDKTARIICEASGIQNFRSAVIHWYRHRPGEAPERILYISAEKLEFDKDSDENKFNCEKKPDLPISTLTVNEIDPNDGATYYCAYW
Malaclemys terrapin terrapin V306 trgv MDXI01020972.1 208550 GFTEITLIQTPLSATSAGTRSAYMWCKISGKGFNLNSAYIHWYRQRPGEALKRILYIQSGSAIMDEGFDSKKFKASNDVSESTSNLRVDKLTQEDAAIYYCATWD
Malaclemys terrapin terrapin V305 trgv MDXI01020972.1 221270 GSSQVRLTQPQLSITREGNKTLRIDCHVSLSEDFGKAPIHWYRQRPGAAPEWILSISTQSELKGKFNAEKKIGQSTCTLTINKITSSDIATYYCAYW
Malaclemys terrapin terrapin V304 trgv MDXI01020972.1 227339 VLWAIHLEQEQISVTKQPLQGSSPTFTCKVFDGSDSTYIHWYRARAGEAPQRLLYLTLSGSELNQEAGFSSEKFLAYGRQSTCSLVVYKLEETDSGHYYCATWDF
Malaclemys terrapin terrapin V303 trgv MDXI01020972.1 231612 VLWAIHLEQVPISITKEPPVGSTAEFICKVSGGSESTYIHWYRAPTGGAPQRLLYLSYSKPDPSWDAGLSSKKLSAYFQVPSICKLLVYKLEKADSGYYYCAAWDY
Malaclemys terrapin terrapin V302 trgv MDXI01020972.1 236701 GYTQITLMQTSLSITTAKNRSAYIWCKIYGENFNFNSAYIHWYRQRPGEAPKRILYIRSESAVKDEGFDSKKFEAEKIGSTSTSNLRVDQLTQEDAATYYCATWD
Malaclemys terrapin terrapin V301 trgv MDXI01020972.1 243655 QPTQDQLSITRNLMKTVRIDCKVSGINFGDAYIHWYRHRPGEAPEWILYFKTQTEKSNFDKEKFSIHKTTEKSTCTLTIDKLTYNDTATYYCAYWD
Malaclemys terrapin terrapin V300 trgv MDXI01020972.1 246780 GCAQIHLRSTQLSITRAENKTARIDCEASGIQNFRSAVIHWYRHRPGEAPERILYISSEKLEFDKDSDENKFNCEKKPDQPISTLTVHEIAPNDGATYYCAYWD
Malaclemys terrapin terrapin V299 trgv MDXI01020972.1 257887 VLWAIHLEQEQISVTKQPLQGSSAKFTCRVFGGSDSTYIHWYRARAGEAPHRLLYLTLSGSKLNREAGFSSEKFLAYGTQNISNLLVHKLEKTDNGHYYCATWDF
Malaclemys terrapin terrapin V298 trgv MDXI01020972.1 260900 VLWAIHLEQVPISITKEPRASSTAEFTCEVTGGSESTYIHWYRAPTGGALQRLLYLSYSKSQSWDAGFSIEKVTAYFQGYKICKLLVHKLEKADSGHYYCAAWDY
Malaclemys terrapin terrapin V297 trgv MDXI01020972.1 269210 GCAQIQLRQTQLSITRAETKTARIVCEASGIQNFRSAVIHWYQHRSGEAPERILYISTVKVEFDKDTDKKFDCEKKSDQPVSTLVVNTITPNDSAIYYCAFWD
Malaclemys terrapin terrapin V296 trgv MDXI01020972.1 288598 QLTQDQLSITRKEKKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYFKSHAQNEQSNFDKDKFSVDKTTEKSTCTLTVDKLIYNDTATYYCAYW
Malaclemys terrapin terrapin V294 trgv MDXI01020972.1 308387 VLWAIHLEQVPISITKEPQEDSIAEFTCKLSGMSDSTNIHWYRAPIGGAPQRLLYLSYSKPDPSWDAGFSSKKLTAHFQGRSFCKLLVHKLEKADSGHYYCAAWDY
Malaclemys terrapin terrapin V293 trgv MDXI01020972.1 325710 RLTQPQPSITREESNAIRIDCCVSVSGDFDKAYIHWYIQRPSTVPKWILFISTQSVLDRDSDKGKFNNEKTVQLTCTLTINKITSIDIATYYCAYWGV
Malaclemys terrapin terrapin V292 trgv MDXI01020972.1 329896 GEALELIQSQLSITKANDRTARIDCHVSGITLSNAYIHWYRQRPDAALERILYFSSGKPEFDQDSEKGKFEADKQLSKSTCTLTVKKTTKSDSATYYCAAW
Malaclemys terrapin terrapin V291 trgv MDXI01020972.1 338541 GCAQIHLRPAQLSITRAETKTARIVCEASGIQNFRSAVIHWYRHRPGEAPERILYISTVKVEFDKGSDDKFDCENNPDQPVSTLVVNGITTDDRAIYYCAIGI
Malaclemys terrapin terrapin V290 trgv MDXI01020972.1 354687 VLWAIHLEQEQISVTKQPLQGSSAKFTCKVFDGSDSTYIHWYRARAGEAPQRLLYLTLSGSDLKREAGFSSEKLFAYGRQSISNLLVHKLEEADSGRYYCATWDF
Malaclemys terrapin terrapin V289 trgv MDXI01020970.1 18116 VLWAIHLEQEQISVTKQPLQGSSATFTCKVFDGSDSTYIHWYRARAGEAPQRLLYLTLSGSELKREAGFSSEKFLAYARQSTSNLLVHKLEEADSGRYYCATWD
Malaclemys terrapin terrapin V288 trav MDXI01020628.1 7249 AVLSDSVRSKEPEVSGSEGGSVTLGCSYETSYTAGVYLYWYRQYPNRAPQYILRRGAKGITFSDTAGFAQQRFSSQADDSSTVLNITALELADTAVYYCALQR
Malaclemys terrapin terrapin V287 trav MDXI01020628.1 16508 AVSGNSIQSIDPDVSVIEGDAVTLSCSYSTSYSGVSLQWYRQNPSQAPQYVLQRGAKGSTISDHAEFARKRFTSETNATATVLIITGLELADGAVYYCALNE
Malaclemys terrapin terrapin V286 trgv MDXI01020618.1 11316 FVASGGEDKMLRDSLQISCKTSRFSFGDYRMTWYGNTPGKALEWVSTISYWARDTKNYAAPVKGRFTISRDNPNNFLYLHMTNLRPEDAAEYYCGWTQCAE
Malaclemys terrapin terrapin V321 trbv MDXI01021089.1 7424 QTDAKITQTPSLVLERGQTAYLRCQQTYGHNSMFWYRQDPGQGLQLLFNFYYKKESEKGTNSSHFQADQTQDDLFRLNISSVQPEHSAVYFCASSL
Malaclemys terrapin terrapin V295 trgv MDXI01020972.1 290195 GYAQIYLRQAQLSLTRAKTKTARIDCEASGIQNFRSAVIHWYRHRRGEAPERILYISSAQPVFDKVSNENKFNCEKKPDQPISTLVVNEIAPNDEATYYCAYWD
Malaclemys terrapin terrapin V285 trdv MDXI01020600.1 20525 FSQGQGSVTQTQGQLAKLGGQTVTLECTFSTGYQYFYLFWYRQHRSGAMDFLFQIDESNAQKNGAGRRFSAEFRKSSKFVSLTIKELEPTDSALYFCALWE
Malaclemys terrapin terrapin V281 trav MDXI01020586.1 577 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRQYPNQAPQYILWRGAKSYSGQSHTADFAQKRFSSQADDSSTVLSIAALELADSAVYLCALRL
Malaclemys terrapin terrapin V248 trbv MDXI01015831.1 74129 QTDAKIMQTPSLVLERGQTAYLRCQQTYGHDSMFWYRQDPGQGLQLLFNFYYKEEREKGTNSSHFQADQPQDDLFRLNISSVQPEHSAVYFCASSS
Malaclemys terrapin terrapin V212 ighv MDXI01008533.1 39940 VRSKIQPVPSAPGVVMPGESLTVTCTVSGDSIATHAWWNWVRELRGRGLQWVGRIHFSGSTNYAPDLQTRANISKDDAKNEYYLQLRSLTAADTATYYCTRWD
Malaclemys terrapin terrapin V210 ighv MDXI01008498.1 11804 VLSQVQLVQSGPGVVKPGETLTLTCSITGDSVTNRYWEWVRQAPGKGLDWVGQIDWDASKWRIYYGPSFQSRATLSADSSKNQFSLQLRSLTAADTATYYCAR
Malaclemys terrapin terrapin V175 igkv MDXI01007052.1 3624 ASGQIVMTQTPESLLVSPGDRVTINCKASTSISSNIAWYQQKSGQAPKLLFYGTSSHPSGVPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQYNSWP
Malaclemys terrapin terrapin V116 trav MDXI01020486.1 83037 ALGRAEIQQPVSAEAVEGEKLTLSCNHPNVTTEKIMWYRHVPSQAPRLLAGGFRGETPGTEAGSTLYIAQDKASSVFEFRGVRLADAAVYYCALSNTA
Malaclemys terrapin terrapin V102 iglv MDXI01019934.1 5306 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVHWYQQKPGSAPLLIIYENSNRPSGIPDRFSGVNSGNTATLTITGVQAQDEADYYCKVWDSSSDQ
Malaclemys terrapin terrapin V66 igkv MDXI01013444.1 42059 SSGQLVLTQTPESLAVSPGDKVTINCKTSSSATIGNTHYMAWYQQKSGEAPKLLIYRASNRATGIPDRFTGSGSGTDFTLTISNVQTEDAGDYYCQQGYIAEV
Malaclemys terrapin terrapin V148 igkv MDXI01004217.1 108676 SYGQVTMTQSPESLSVTPGEKVTIRCTASSSISSRYVSWYQQKSGQAPKLLLYRASTLESGVPARFSGSGSGTAYTLTISSVEADDAADYYCLQTYS
Malaclemys terrapin terrapin V10 ighv MDXI01006839.1 151811 GQSQVQLVQSGAEIKKPGDSLKISCKTSGFPLSHYYMSWLRQAPGKGLVWVGRIDPANGATIYSQSFKDRLTITTDNSISTMYLQLRNLRAEDTAVYYCA