WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mus caroli FMAL00000000.1 (FMAL01) 116 44 1 22 19 20 6 4
Mus caroli FMAL00000000.2 (FMAL02) 190 64 4 69 23 20 7 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mus caroli V92 ighv FMAL01009170.1 1224 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSHFMAWVRQTPDKRLEWAANIYPDGGTAYYPNTVKGRFTISRDNARNTMYLQMNNLRSEDTALYYCVRQ
Mus caroli V93 ighv FMAL01009170.1 15062 VLSQFQLKQSGPALVPPSQSLSITCTVSGFSLTSCGISWLQWSPGNGLEWMGAIWSNGITNYNAALVFRLSISRDTSKSQVFLKINSLQTDDTAMYYCAR
Mus caroli V94 ighv FMAL01009178.1 1402 TQAEIQLVQSGPELKKPGETVKISCKASGYTFTDRGMNWVKQAPGKGFKWMGRINTKTGVPTYAEDFKGRFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus caroli V95 ighv FMAL01009178.1 15754 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSGFCWHWIRQPPGKGLEWMGCICYEGSIYYSPSFQSRSTISRDTSLNKFFIQLSSVTDEDTAMYYCSRE
Mus caroli V96 ighv FMAL01009181.1 8157 IQAQIQLVQSGPELKKPGETVKISCKASGYTFTTAGMQWMQQTPGKGFKWIGWINTYSGEPKYAEDFKGRFAFSLETSASTAYLQISNLKNEDSAMYFCA
Mus caroli V97 ighv FMAL01009181.1 18120 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWSWIRHFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAR
Mus caroli V98 ighv FMAL01009181.1 35566 ILSDVQLQESGPGLVKPSQTVSLTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSGSITYNPSLKSRTTITRDTSKNQFFLELNSLTTEDTATYYCAR
Mus caroli V99 ighv FMAL01009181.1 44589 ILSDVLLQESGPGLVKPSQTVSLTCTVTGYSITSGNHWWNWIRQVSGNKLKWMGYISSSGTTDSNPSLKSRISITRDTSKNQLFLQLNSVTTEDIATYYCAR
Mus caroli V100 ighv FMAL01009181.1 70655 IQCEVNLVESGGGLVQPGASLRLSCAASGFTFTDYYMNWVRQPTGKAPEWLGLIRNKANGYTTEYSASVKGRFTISRDNSQNILYLQMNTLRAEDSATYYCAKD
Mus caroli V101 ighv FMAL01009181.1 95416 ILSDVQLQESGPGLVRPSQTLSLTCTVTGFSINSDCYWIWIRQFPGNKLEYIGYIFYSGITYYNPSLESRTYITRDTSKNQFFLKLSSVTTEDTATYYCAR
Mus caroli V102 ighv FMAL01009184.1 12055 VNSQVQLQQSGAELVRPGASVKMSCKASGYTFTSYWMNWVKQRPGQGLEWIGVIDPSDSYTSYNQKFKDKATLTVDESSSTAYMQLNSLTSEDSAVYYCA
Mus caroli V103 ighv FMAL01009184.1 52463 VHSQLELQQSGAELVRPGSSVKLSCKDSDFAFMASTMHWVKQRSGQGLELIGSFTMYSDATEYSEKFKGKATLTANTSSSTAYMELSSLTSEDSAVYYCA
Mus caroli V104 ighv FMAL01009184.1 76431 VLSQITLKESGPGIVQPSQPARLTCTFSGFSLSTSGIGVSWMRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNSQAFLNIITVETADTAIYYCAQS
Mus caroli V105 ighv FMAL01009184.1 106939 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYNDDTKYNEKFKGKATLTVEKSSSTVYLELSRLTSDDSAVYYCA
Mus caroli V106 ighv FMAL01009184.1 135873 VLSEVQLQQSGPELVKPGSSVKISCKASGYSFTGYFMNWVKQRHGKSLDWIGRINPYNGDTFYNQKFKGKATLTVDKFSSTAYMELLSLTSEDSAVYYCA
Mus caroli V107 ighv FMAL01009184.1 151514 VHSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMDWVKQSHGKSLEWIGDINPYNGGTSYNQKFNGKATLTVDKSSSTAYMELHSLTSEDSAVYYCA
Mus caroli V108 ighv FMAL01009184.1 162785 VQSQIQLQQSGAELVRPGASVKLSCMASGYTFTDYGMDWVKQTPVHGLEWIGAIDPGTGGTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCT
Mus caroli V109 ighv FMAL01009184.1 173210 VHSQVQLQQSGPELVKPGASVKMSCKASGYTFTDYATHWVKQKPGQGLEWIGYIIPYNDGTKYNEKFKGKATLTSDKSSSTAYMQLSSLTSQDSAVYYCA
Mus caroli V110 ighv FMAL01009184.1 203747 VHSQAYLQQSGFELVRPGASVKMSCKASGYTFTSYNMHWVKQRPGQGLEWIGYIYPGNGGTVYNQKFKGKAILTADTSSSTAYMQLSSLNSEDSAVYFCA
Mus caroli V111 ighv FMAL01009184.1 207291 AYSQVQLQQSGAALASPGASVTLSCKASGYTFTDHIMNWVKKRPGHGLEWIGRIYPVSGETNYNQKFVGKATFSVDRSSSTVYMVLKSLTSEDPADYYCG
Mus caroli V112 ighv FMAL01009184.1 227477 VYSQGQLQQSGAELVKPGASVKLSCKTSGFTFSSNYISWLKQKPGQSLEWIAWIHAGTGATNYNQKFKGKAQLTADTSSSTAYMQLSSLTSEDSAIYYCAR
Mus caroli V113 ighv FMAL01009184.1 247144 IQSQVHLQQSGSELRSPGSSVKLSCKDFDSEVFPIAYMSWVRQKPRHGFEWIGDILPSIGRRIYGEKFEDKATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus caroli V114 ighv FMAL01009184.1 268957 VDSQVQLQQSGAELARPGASVKMSCKASGYTFTSYSMHWVKQRPGQGLEWIGYINPSNGYTAYNQKFKEKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus caroli V115 ighv FMAL01009184.1 278988 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYVMSWVRQATGKGLEWVAQIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus caroli V116 ighv FMAL01009184.1 289081 VYSQVQLQQSGAELARPGASVKMSCKASGYTFTTYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTADTSASTAYMELSSLINEDSAVYYCT
Mus caroli V117 ighv FMAL01009184.1 302864 VLSQVTLKESGPGILQPSQTLSLACTFSGISLSTSGMGLSWLRKPSGKALEWLASIWNNDNYYNPSLRSRLTISKEISNNQVFLKLTSVDTADSATYYCAWR
Mus caroli V118 ighv FMAL01009184.1 309419 VECEVKLDESGGGLVQPGRSMKLSCVASGFTFSDSWMNWVRQSPEKGLEWVAQIRSKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus caroli V119 ighv FMAL01009184.1 320048 LVQPGRSIKLSCAALAFTFRDYWMHWVCQSPEKGLEWVSAIGIKTSNYATHYAESVKDKCIISRDDSKSSVYLQMNSLRAEDTGIYYCVSPSEKPSF
Mus caroli V120 ighv FMAL01009184.1 332288 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSNAWMEWVRQSPEKGLEWIAEIRNKASNHATYYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGTYYCT
Mus caroli V166 trav FMAL01012726.1 60423 MRRTHGDSVTQKQGQVTLSEDDFLFINCTYSSTTYPTLFWYVQYPGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQKSDSAVYFCALG
Mus caroli V167 trav FMAL01012726.1 67502 VRSQQKVQQSPESLSVPEGATASLNCSSSDRNFQYFWWYRQHSGEGPMALMSIFSDGDKKEGRFTVHLNKASLHVSLHIRDSQPSDSALYFCAAS
Mus caroli V168 trav FMAL01012726.1 74664 VNSQLAEENPWALSVHEGESVMVNCSYKTSILALQWYRQKSGEGPAQLILIRSNEREKRNGRLRATLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus caroli V173 trav FMAL01012844.1 360478 AAGQGVEQPANLMSVEGTFARVNCTYSTSGFNGLSWYQQREGQAPIFLSYVVLDGLKDSGHFSTFLSRSNGYSYLLLTELQIKDSASYLCAVR
Mus caroli V174 trav FMAL01012847.1 2224 SWSLAKTTQPPSMEAYEGQEVNVSCSHTNIATSEYIYWYRQVPPQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPWVSLRDAAVYYCIVT
Mus caroli V175 trav FMAL01012847.1 13854 VSRGEQVEQRPPHLSVREGDSAVIICTYTDPNSYYFFWYKQEPGAGLQLLISVLSNVGRKEEQGLTLILNKTDKHLSLNITAARPEDSAVYFCAAS
Mus caroli V176 trav FMAL01012849.1 1096 RTHGDSVTQMQGQMTLSEDDFLFINCTYSTTWYSPLFWYVQYPGEGPQLLLKVTKANNKGSSRGFEATYDKETTSFHLQKASVQESDSAVYYCALS
Mus caroli V177 trav FMAL01012849.1 15083 VNSQQNVQQSPESLIVPEGGMASLNCTFSDRNSQYFWWYRQHSGEGPKALMSIFSNGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYLCAV
Mus caroli V178 trav FMAL01012849.1 24765 RTHGNSVTQMKGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQKSDSAVYYCVLG
Mus caroli V179 trav FMAL01012851.1 4271 TKSQWGEENLQALSIQEGEDVTMNCSYKTYTTVVQWYRQKSGEGPAQLILIRSNEREKSSGRLRATLDTSSQSSTLSITGALATDTAVYFCATD
Mus caroli V180 trav FMAL01012851.1 9106 TSMAQEVTQTQSSISVMEKTTVTMDCVYETRDSSYFLFWYKQTASGEMVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAIRE
Mus caroli V181 trav FMAL01012851.1 18296 VKGQQVQQSPLSLVLQEGEKAELQCNFSSTATQLQWFYQHPGGRLVSLLYNPSGTKHTGRLTSTTVTNKRRSSLHISSSQTTDSGTYLCAMEPQCS
Mus caroli V182 trav FMAL01012853.1 9160 VSSQEKVQQSPESLIVPEGAMNSLNCTFSDSASQSIWWYQQHPGKGPKALISIFSNGNKKEGRLAVYLNRASLHVSLHIRDSQPSDSAVYLCAV
Mus caroli V183 trav FMAL01012860.1 3887 VSRGEQMEQRPLHLSVREGDSAVITCTYTDSATAYFYWYKQEAGAGLQLLMSVFSNVDRKEEQGFTVLLNKKDKRLSLNLTAAHPGDSAVYFCAAS
Mus caroli V184 trdv FMAL01012867.1 34767 TSLDVYLEPVAKTFTVVAGDPASFYCTVTGGDMKNYHMSWYKKNGNNALFLVYKLNSNSTDDVMGNFKGKINISKNQFILDIQKATVKDAGTYYCGSD
Mus caroli V331 trbv FMAL01023140.1 5828 PVDPKIIQKPKYLVAVTGSEKTLICEQYLGHNAMYWYRQSAKKSLEFMFSYSYQKLMDNQTASSRFQPQSSEKNHLDLQITALKPDDAATYFCASSQ
Mus caroli V332 trbv FMAL01023140.1 7280 HTGPKVLQIPSHQVVDMGQMVTLNCDPVSNHQYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDDSYFTLKIQPTTLEDSAMYFCASSL
Mus caroli V333 trbv FMAL01023140.1 16037 PLETSVFQTPNYRVTQVGNEVSFNCEQTLGHDTMYWYKQDSKKLLKILFSYNNKQLIVNETVPRRFSPQSSDKAHLNLQIKSVELEDSAVYLCASS
Mus caroli V334 trbv FMAL01023140.1 21102 LMNTKITQSPRYLIMGRANKSLECEQHLGHNAMYWYKQSAEKPPELMFLYSVKQLIRNETVPSRFIPECPDSSKLLLHVSAVDPEDSAVYFCASSQ
Mus caroli V335 trbv FMAL01023140.1 52377 GDGGITQTPRYWITQTSRKIILKCSQDMNHYRMFWYRQDAGQGLKLIHYSVGTDRTTKGDVPEGYSAFRNEIQSFPLTLESTSSNQTSMYFCASSEQ
Mus caroli V336 trbv FMAL01023140.1 76838 SANSGVVQSPRHIIKEKGGRSVLKCIPISGHSNVVWYQQTLGKELKFLIQHYEKEERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Mus caroli V337 trbv FMAL01023140.1 79232 HVEAAVTQSPRNKVTVTGGNVTLSCHQTNSHNYMYWYRQDTGHGLRLILYSYGVDNLEKGDVPDGYKATRKTQEDFFLMLELASPSQTSLYFCASSD
Mus caroli V338 trbv FMAL01023140.1 82346 SANSGVVQFPRYIIKEKGERSILKCIPIPGHLSVAWYQQTLGQELTFFIQHYDKIERDKGNLPSRFSVQQFDDYHSEMNMSALKLEDSAVYFCASS
Mus caroli V339 trbv FMAL01023140.1 84797 HMEATVTQSPRNKVAVTGGKVTLSCDQTNNHNNMYWYRQDMGLGLRLIHYSYGADNTEKGDIPDGYKASRPSQKEFSLILELASPSQTSVYFCASSD
Mus caroli V340 trbv FMAL01023140.1 93548 HMEAAVTQSPRKKVAVTGGKVTLNCHQTNNHDYMYWYRQDMGHGLRLLHYSYVANSTEKGDVPDGYKASRPSQEDFSLILELASLSQTAVYFCASSD
Mus caroli V341 trbv FMAL01023143.1 6495 LVDMKVTQMPRYLIKRMGENVLLECGQDMSHERMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSL
Mus caroli V342 trbv FMAL01023144.1 2447 SVFSVLLYQKPNRDICQSGTSLKIQCVADSQVVSMFWYQQFQGQSLMLMATANEGSEATYESGFTKDKFPISRPNLTFSTLTVNNARPGDSSIYFCSSG
Mus caroli V348 igkv FMAL01023487.1 6508 IMSRGENVLTQTPAIMAASLGEKVTMTCSASSSVSSSYLHWYQQKSGASPKLLIYRTSNLASGVPARFSGSGSGTSYSLTISSVEAEDDATYFCQQWSGYP
Mus caroli V349 igkv FMAL01023489.1 36427 SRGDIVLTQSPATMSVTPGERVSLSCRASQSISNNLHWYQQKSHDSPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDIGIYFCLQRNSW
Mus caroli V350 igkv FMAL01023489.1 47747 ARCDIQVTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYTATNLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHHYSTP
Mus caroli V351 igkv FMAL01023489.1 88496 SRGDILLTQSPAILSVTPGERVSISCRGSQSIGTSIHWYQQKTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNSWP
Mus caroli V352 igkv FMAL01023490.1 12961 SAVTGETTQSPASLSFSLGETATLTCRSSESVGSYLAWYQQKAEQVPRLLIHSASTRAGGVPDRFSGTGSGTDFTLTVSSLEPEDAAVYYCQPFKSWS
Mus caroli V353 igkv FMAL01023490.1 41069 STGDILMTQSPATLSVTPGETVSLSCRASQSINKNLHWYQQKSHGSPRLFIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGIYYCHQCY
Mus caroli V354 igkv FMAL01023490.1 54518 AGCDIQMTQSPASLAASVGETITCRASENIYYSLAWYQQKQGKSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINSMQPEDTATYFCKQAYDFP
Mus caroli V355 igkv FMAL01023490.1 91843 SRCDIVMTQSPATLSVTPGDRVSLSCRASQSISNHLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVEPEDVGVYFCQQSNSW
Mus caroli V356 igkv FMAL01023492.1 3354 STGDIVLTQSPASLAVSLGQRVTISCRASQSVDSYGSSYMNWYQQKPGQPPKLLIYYASNLESGVPARFSGSGSGTDFSLNIHPMEEDDTATYFCQQSNEYP
Mus caroli V387 trgv FMAL01026443.1 59598 RQTSSNLEERITSVTKLEGSSAIMTCDIHGTGTYIHWYRFQKGRAPEHLLYYNFVSSTTVVDSRFNSEKYHVYEGPDKRYKFVLRNVEESDSALYYCATWA
Mus caroli V388 trgv FMAL01026443.1 66857 GHGKLEQPEISISRARDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHVSLGKEYKKMEASKNSSASTSTLTIYSLEEEDEAIYYCSYG
Mus caroli V389 trgv FMAL01026443.1 72005 SEGSSLTSPLGSYIIKRKGNTAFLKCQIKTGVQKPDAYIHWYQEKPGQRLQRMLCSSSKENIVYEKDFSDERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus caroli V390 trgv FMAL01026443.1 73820 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLKEGEPLRRIFYGSVKTYKQDKSHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Mus caroli V496 iglv FMAL01007553.1 63956 FQPTLTQPDAFSVFPGQDAHLSCTINSQHATAGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISPVLPEDDADYFCSI
Mus caroli V518 ighv FMAL01009174.1 39331 VQCEVHLVESGGGLVQPGSSMKLSCTASGFTFSDYGMAWIRQVPEKSLEWVAAINYDGSNTYYLDSLKGRFIISRDNAKNILYLQMSNLKSEDTDMYYCAR
Mus caroli V519 ighv FMAL01009174.1 13507 VLSQVQMKESGPDLVQPSQTLSLTCTVSGFSLSSYGVHWFRKPPRKGLEWLGGIWSDGSIYYNPVLSSRLSVSWDISKSQVFFKMSSLQSEDTAVYHCAR
Mus caroli V520 ighv FMAL01009175.1 1088 VQCEVKLVESGGGLVQPGGSLKLSCAASGFTFSSYDMSWVRQTPEKRLEWVAAISNSGRNTYYPDTVKGRFTVSRDNAKNVLYLQMSSLRSEDTAMYYCAR
Mus caroli V521 ighv FMAL01009176.1 34245 IQCEVKLVESGGGLVQPGASLRLSCAASGFTFSDFYMEWVRQAPGKGLEWIAASRNKANDYTTEYSASVKGRFTVSRDTSQSILYLQMNTLRAEDTAMYYCARD
Mus caroli V522 ighv FMAL01009176.1 25720 VLSQVQLKESGPGLVAPSQTLSITCTVSGFSLTSYGVHWVRQPPGKGLEWVGAMGWDDKKYYNSALKSRLSISRDTSKSQVFLKLSNLQTEDTATYYCAR
Mus caroli V523 ighv FMAL01009176.1 15052 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWMGTIWYDGSTYYNAALKSRLSISRDTSKSQVFLKMNSLKTDDTAIYYCAR
Mus caroli V524 ighv FMAL01009176.1 3668 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYGMSWVRQTPEKRLEWIAYISSGSSTIYYADTVKGRFTISRDNAKNTLFLQMTSLRSEDTAMYYCA
Mus caroli V525 ighv FMAL01009177.1 33316 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTDYGMNWVKQAPGKGFKWMGWIDTNTGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCA
Mus caroli V526 ighv FMAL01009179.1 551 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSGFCWHWIRQPPGKGLEWMGRICYEGSIYYSPSFQSRSTISRDTSLNKFFIQLSSVTDEDTAMYYCSRE
Mus caroli V527 ighv FMAL01009182.1 103194 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSDYRMDWVHHSPENGLEWVAEIRNKASNYATYYAESVKGRFTISRDDSKSIVYLHMNSLRAEDTGIYYCT
Mus caroli V528 ighv FMAL01009182.1 83391 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSDYWMHWVRQSPEKGLEWVAEIRNKANNYATHYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus caroli V529 ighv FMAL01009182.1 74019 VHSQVQLQQSGAELLRTGASVKVSCRASGYTFTSYYVDWVKQRTGYSLEWIGRIIPGIGATDYAQKFKGKATLTADTSSTVYMELSSLTSEDSAVYYCA
Mus caroli V530 ighv FMAL01009182.1 47338 SLSQMQLQESGPGLVKPSQSLFLTCSITGFPITSGYYWIWIRQSPGKTLEWMGYITHSGETFYNPSLQSPISITRETSKNQFFLQLNSVTTEDTAMYYCAGD
Mus caroli V531 ighv FMAL01009182.1 13529 ILSEVQLQESGPGLVKPSQTLSLTCSVTGYSITSAYWSWIRKFPGNKLEHMGHISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCAR
Mus caroli V590 trav FMAL01012848.1 10400 ESQGEQVEQLPSSLIVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLHITATQPGDSAIYFCSAS
Mus caroli V591 trav FMAL01012855.1 5158 VSRGEQVEQRPSHLSVREGDSAVIICTYIDPNSYYFFWYKQEPGAGLQLLMKIFSSTEINEGQGFTVLLNKKDKQLSLNLTAAHPGDSAAYFCAVS
Mus caroli V592 trav FMAL01012861.1 4165 GNSAQSVDQPDTHVTVSEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDAVVKGTKGFEAEFRKSSTSFNLKKSPAHWSDSAKYFCALE
Mus caroli V593 trav FMAL01012862.1 116478 VATQQLEQSPQFLSIQEGQDFTAHCSSSTTFPQFYWYRQVPREGPVILVTLVKSGEVKEHKRMTAKFGEARKNSSLFITRAQPGDAGTYFCAG
Mus caroli V594 trav FMAL01012862.1 72250 IAGDAKTTQPDLMESTEGEMVRLPCSHATISGNEYIYWYRQVPLRGPEYVTHGLQQNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRV
Mus caroli V597 trdv FMAL01012862.1 16362 ASMAQTVSQPQKEKSVQVAESATVDCTYDTSDTNYLLFWYKQQGGQVTLVVRQEAYKQYNATLNRFSVNFQKAAKTFSLEISDSQLGDAATYFCALRG
Mus caroli V598 trdv FMAL01012862.1 5481 ASMAQTVSQPQKEKSVQVAESATVDCTYDTSDTNYLLFWYKQQGGQVTLVILQEAYKQYNATLNRFSVNFQKAAKTFSLEISDSQLGDTATYFCALM
Mus caroli V599 trdv FMAL01012867.1 102003 KDVLCITVTQSSPHQTVASGTEVTLHCKYDVDSPNPDLFWYRKRPDRSFQFILYRDDTSSHDADFVQGRFSVKHSKANRTFHLVISPVSFEDSATYYCASG
Mus caroli V761 trbv FMAL01023141.1 67745 LSEAGVTQSPRYAVLQEGQAVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFRNEAVIDNSQLPTDRFSAVRPKGTNSTLKIRSAKQGDTATYLCASSL
Mus caroli V762 trbv FMAL01023141.1 61826 HTDAGVTQTPRHEVAEKGQTITLKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGTLKDRFKAEMPNSSFSTLKIQPTEPQDSAVYLCASSL
Mus caroli V763 trbv FMAL01023141.1 51279 PTNAGVIQTPRHKVSGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQTHSTLKIQSTQPQDSAVYLCASSL
Mus caroli V764 trbv FMAL01023141.1 36930 FVDTTVKQNPRYKLARVGKAVNLICSQTMNHETMLWYQKKPNQAPKLLLYYYDENLNREADTSENFQSSRPNNSFCSLDIGSPGLEDSAMYLCASSR
Mus caroli V765 trbv FMAL01023141.1 20449 TTHGDGGIITQTPKFLIGQEGQKLTLKCQQNFNHDSMYWYRQDSGKELRSIYYSITENDLQKGDLSEGYDASRENKSSFSLTVTSAQKNEMAVYLCASSI
Mus caroli V767 trbv FMAL01023141.1 1198 SMDSGVVQNPRHLVKRKEQKAKMDCTPINGHSYVYWYYKKLGEELKFLVYFQNEDIIDKTDMIGKNISAKCPAKKPCTIEIQSSKLTDSAVYFCASSQ
Mus caroli V768 trbv FMAL01023142.1 38386 SFDAAVTQKPRYLIKMKGQEAEMKCIPEKGHTAVFWYQQKQSKELKFLIYFQNQQPLDQIDMVKERFSAVCPSSSLCSLGIKTSEAEDSALYLCSSSQ
Mus caroli V769 trbv FMAL01023147.1 55194 VSAQTIHQWPVAEIKAVGSPLSLECTIKGKSNPNLYWYWQATGGTLQQLFYSINVGQVESVVPLNLSASRPRDNQFILSTEKLLLSHSGFYLCAWS
Mus caroli V771 igkv FMAL01023483.1 5323 AIGDIVMTQVAPSVPVTPGETVSISCRSSKSLLNSNGKHLLYWFLQRPGQSPQRLIYYMSNLASGVPEWFSGSGSGTDFTLRISRVEAEDVGAYYCMQSLEYP
Mus caroli V772 igkv FMAL01023484.1 148114 ARCDIQMTQSPSSMSAFLGETVSITCHASQSISSDLSWLQQKPGKSPKTLISYATNLEDGVPSRFSGSGSGADYSLTISSLESEDYADYYCVQ
Mus caroli V773 igkv FMAL01023484.1 109445 ARCDIKMTQSPSSMYASLGERVTITCTASQDVKSYLSWYQQKPGKSPKALIYYAINLADGVPSRFSGSGSGQDYSLTISSLESDDTAIYYCLQHGESP
Mus caroli V774 igkv FMAL01023484.1 91021 ARCDVQMIQSPSSLSASLGERVTMTCQASQGTSINLNWFQQKPGKSPKLLIYGASNLEDGVPSRFSGSGYGTDFTLTISSLEDEDMATYFCLQHSYLP
Mus caroli V775 igkv FMAL01023484.1 51557 SSSDAVMTQTLFSLPVSLGDQASISCRSSQSLVDSNGNTYLNWYLQKPGQSPQLLIYRVSKLFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCLQV
Mus caroli V776 igkv FMAL01023485.1 75235 SRGEIVLTQSPAIIAASPGQKVTITCSASSSVTYTHWYQQKSGTSPKPWIYEISKLASGVPARFSGSGSGTTYSLTISSVEAEDAATYFCEQWNY
Mus caroli V777 igkv FMAL01023485.1 50925 VLCDIQMTQSSSFLSASLGDHLTINCRASKDINKYFAWVQQKPGKAPRMLIHFASTLLPGVPEKFSGSGSGTDFSLTIRNIESEDIAAYYCLQYSEHP
Mus caroli V778 igkv FMAL01023485.1 22477 VVIRCDIQMTQSPASLSASVGESVSITCGASENIYSALNWYQRKQGKSPQPLIYGATNLADGVSSRFSGSGSGRQYTLKISSLHPDDVATYYCQNVLSTP
Mus caroli V779 igkv FMAL01023491.1 75222 TCGDIVMSQSPSSLAVSAGEKVTLSCKSSQSLLSSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQSEDLADYFCQQGYSYP
Mus caroli V780 igkv FMAL01023491.1 38390 AHGSIVMTQSPKSLPVSAGDRVTMTCKASQSVSNEVNWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYFCQQDY
Mus caroli V781 igkv FMAL01023491.1 24648 ACADIVMTQSPTFLAVTASKKVTISCTASESLYSSKHKVNYLAWYQKKPEQSPKLLIYGASNRYTGVPDRFTGSGSGTDFILTISSVQAEDLTHYYCAQFYSYP
Mus caroli V782 igkv FMAL01023491.1 14174 TCGDILMTQSPSSLTVSAGEKVTMSCKSSQSFLASGNQNNYLAWHQQKLGQSPKLLIIWASTRVSGVPDRFIGSGSGTDFTLTINSVQAEDLAVYYCQQSY
Mus caroli V783 igkv FMAL01023491.1 2155 INGDVVMTQTPLTLSANIGQSASISCRSSQSLLHSNGNTYLNWFLQRPGQSPQLLIYGVFERESEVPDRFSGSGSGTDFTFKISKVEAEDLGVYYCMQTTYEP
Mus caroli V820 trgv FMAL01026446.1 29112 GLGQLEQTEVSVTRATDERAQISCTIYLPYFSNTAIHWYRQKTNQQFEYLIYVETNYNQRPLGGKNKKIEASKDFKSSTSTLEINYLKKEDEATYYCAVWI
Mus caroli V821 trgv FMAL01026448.1 13153 GLGQLEQTEVSVTRATDESAQIPCIVSLPDFSNTEIHWYRQKAKQFEYLIYVVTNYNQRPLGRKNKKIEASKDFQTSTSTLKINYLKKEDEATYYCAVWI
Mus caroli V850 ighv FMAL01027751.1 21123 FNSQVQLQQSGAELVRPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIDRSDSETIYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSVVYYCA
Mus caroli V92 ighv FMAL02009170.1 1224 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSHFMAWVRQTPDKRLEWAANIYPDGGTAYYPNTVKGRFTISRDNARNTMYLQMNNLRSEDTALYYCVRQ
Mus caroli V93 ighv FMAL02009170.1 15062 VLSQFQLKQSGPALVPPSQSLSITCTVSGFSLTSCGISWLQWSPGNGLEWMGAIWSNGITNYNAALVFRLSISRDTSKSQVFLKINSLQTDDTAMYYCAR
Mus caroli V94 ighv FMAL02009178.1 1402 TQAEIQLVQSGPELKKPGETVKISCKASGYTFTDRGMNWVKQAPGKGFKWMGRINTKTGVPTYAEDFKGRFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus caroli V95 ighv FMAL02009178.1 15754 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSGFCWHWIRQPPGKGLEWMGCICYEGSIYYSPSFQSRSTISRDTSLNKFFIQLSSVTDEDTAMYYCSRE
Mus caroli V96 ighv FMAL02009181.1 8157 IQAQIQLVQSGPELKKPGETVKISCKASGYTFTTAGMQWMQQTPGKGFKWIGWINTYSGEPKYAEDFKGRFAFSLETSASTAYLQISNLKNEDSAMYFCA
Mus caroli V97 ighv FMAL02009181.1 18120 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWSWIRHFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAR
Mus caroli V98 ighv FMAL02009181.1 35566 ILSDVQLQESGPGLVKPSQTVSLTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSGSITYNPSLKSRTTITRDTSKNQFFLELNSLTTEDTATYYCAR
Mus caroli V99 ighv FMAL02009181.1 44589 ILSDVLLQESGPGLVKPSQTVSLTCTVTGYSITSGNHWWNWIRQVSGNKLKWMGYISSSGTTDSNPSLKSRISITRDTSKNQLFLQLNSVTTEDIATYYCAR
Mus caroli V100 ighv FMAL02009181.1 70655 IQCEVNLVESGGGLVQPGASLRLSCAASGFTFTDYYMNWVRQPTGKAPEWLGLIRNKANGYTTEYSASVKGRFTISRDNSQNILYLQMNTLRAEDSATYYCAKD
Mus caroli V101 ighv FMAL02009181.1 95416 ILSDVQLQESGPGLVRPSQTLSLTCTVTGFSINSDCYWIWIRQFPGNKLEYIGYIFYSGITYYNPSLESRTYITRDTSKNQFFLKLSSVTTEDTATYYCAR
Mus caroli V102 ighv FMAL02009184.1 12055 VNSQVQLQQSGAELVRPGASVKMSCKASGYTFTSYWMNWVKQRPGQGLEWIGVIDPSDSYTSYNQKFKDKATLTVDESSSTAYMQLNSLTSEDSAVYYCA
Mus caroli V103 ighv FMAL02009184.1 52463 VHSQLELQQSGAELVRPGSSVKLSCKDSDFAFMASTMHWVKQRSGQGLELIGSFTMYSDATEYSEKFKGKATLTANTSSSTAYMELSSLTSEDSAVYYCA
Mus caroli V104 ighv FMAL02009184.1 76431 VLSQITLKESGPGIVQPSQPARLTCTFSGFSLSTSGIGVSWMRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNSQAFLNIITVETADTAIYYCAQS
Mus caroli V105 ighv FMAL02009184.1 106939 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYNDDTKYNEKFKGKATLTVEKSSSTVYLELSRLTSDDSAVYYCA
Mus caroli V106 ighv FMAL02009184.1 135873 VLSEVQLQQSGPELVKPGSSVKISCKASGYSFTGYFMNWVKQRHGKSLDWIGRINPYNGDTFYNQKFKGKATLTVDKFSSTAYMELLSLTSEDSAVYYCA
Mus caroli V107 ighv FMAL02009184.1 151514 VHSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMDWVKQSHGKSLEWIGDINPYNGGTSYNQKFNGKATLTVDKSSSTAYMELHSLTSEDSAVYYCA
Mus caroli V108 ighv FMAL02009184.1 162785 VQSQIQLQQSGAELVRPGASVKLSCMASGYTFTDYGMDWVKQTPVHGLEWIGAIDPGTGGTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCT
Mus caroli V109 ighv FMAL02009184.1 173210 VHSQVQLQQSGPELVKPGASVKMSCKASGYTFTDYATHWVKQKPGQGLEWIGYIIPYNDGTKYNEKFKGKATLTSDKSSSTAYMQLSSLTSQDSAVYYCA
Mus caroli V110 ighv FMAL02009184.1 203747 VHSQAYLQQSGFELVRPGASVKMSCKASGYTFTSYNMHWVKQRPGQGLEWIGYIYPGNGGTVYNQKFKGKAILTADTSSSTAYMQLSSLNSEDSAVYFCA
Mus caroli V111 ighv FMAL02009184.1 207291 AYSQVQLQQSGAALASPGASVTLSCKASGYTFTDHIMNWVKKRPGHGLEWIGRIYPVSGETNYNQKFVGKATFSVDRSSSTVYMVLKSLTSEDPADYYCG
Mus caroli V112 ighv FMAL02009184.1 227477 VYSQGQLQQSGAELVKPGASVKLSCKTSGFTFSSNYISWLKQKPGQSLEWIAWIHAGTGATNYNQKFKGKAQLTADTSSSTAYMQLSSLTSEDSAIYYCAR
Mus caroli V113 ighv FMAL02009184.1 247144 IQSQVHLQQSGSELRSPGSSVKLSCKDFDSEVFPIAYMSWVRQKPRHGFEWIGDILPSIGRRIYGEKFEDKATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus caroli V114 ighv FMAL02009184.1 268957 VDSQVQLQQSGAELARPGASVKMSCKASGYTFTSYSMHWVKQRPGQGLEWIGYINPSNGYTAYNQKFKEKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus caroli V115 ighv FMAL02009184.1 278988 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYVMSWVRQATGKGLEWVAQIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus caroli V116 ighv FMAL02009184.1 289081 VYSQVQLQQSGAELARPGASVKMSCKASGYTFTTYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTADTSASTAYMELSSLINEDSAVYYCT
Mus caroli V117 ighv FMAL02009184.1 302864 VLSQVTLKESGPGILQPSQTLSLACTFSGISLSTSGMGLSWLRKPSGKALEWLASIWNNDNYYNPSLRSRLTISKEISNNQVFLKLTSVDTADSATYYCAWR
Mus caroli V118 ighv FMAL02009184.1 309419 VECEVKLDESGGGLVQPGRSMKLSCVASGFTFSDSWMNWVRQSPEKGLEWVAQIRSKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus caroli V120 ighv FMAL02009184.1 332288 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSNAWMEWVRQSPEKGLEWIAEIRNKASNHATYYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGTYYCT
Mus caroli V166 trav FMAL02012726.1 60423 MRRTHGDSVTQKQGQVTLSEDDFLFINCTYSSTTYPTLFWYVQYPGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQKSDSAVYFCALG
Mus caroli V167 trav FMAL02012726.1 67502 VRSQQKVQQSPESLSVPEGATASLNCSSSDRNFQYFWWYRQHSGEGPMALMSIFSDGDKKEGRFTVHLNKASLHVSLHIRDSQPSDSALYFCAAS
Mus caroli V168 trav FMAL02012726.1 74664 VNSQLAEENPWALSVHEGESVMVNCSYKTSILALQWYRQKSGEGPAQLILIRSNEREKRNGRLRATLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus caroli V173 trav FMAL02012844.1 360478 AAGQGVEQPANLMSVEGTFARVNCTYSTSGFNGLSWYQQREGQAPIFLSYVVLDGLKDSGHFSTFLSRSNGYSYLLLTELQIKDSASYLCAVR
Mus caroli V174 trav FMAL02012847.1 2224 SWSLAKTTQPPSMEAYEGQEVNVSCSHTNIATSEYIYWYRQVPPQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPWVSLRDAAVYYCIVT
Mus caroli V175 trav FMAL02012847.1 13854 VSRGEQVEQRPPHLSVREGDSAVIICTYTDPNSYYFFWYKQEPGAGLQLLISVLSNVGRKEEQGLTLILNKTDKHLSLNITAARPEDSAVYFCAAS
Mus caroli V176 trav FMAL02012849.1 1096 RTHGDSVTQMQGQMTLSEDDFLFINCTYSTTWYSPLFWYVQYPGEGPQLLLKVTKANNKGSSRGFEATYDKETTSFHLQKASVQESDSAVYYCALS
Mus caroli V177 trav FMAL02012849.1 15083 VNSQQNVQQSPESLIVPEGGMASLNCTFSDRNSQYFWWYRQHSGEGPKALMSIFSNGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYLCAV
Mus caroli V178 trav FMAL02012849.1 24765 RTHGNSVTQMKGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQKSDSAVYYCVLG
Mus caroli V179 trav FMAL02012851.1 4271 TKSQWGEENLQALSIQEGEDVTMNCSYKTYTTVVQWYRQKSGEGPAQLILIRSNEREKSSGRLRATLDTSSQSSTLSITGALATDTAVYFCATD
Mus caroli V180 trav FMAL02012851.1 9106 TSMAQEVTQTQSSISVMEKTTVTMDCVYETRDSSYFLFWYKQTASGEMVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAIRE
Mus caroli V181 trav FMAL02012851.1 18296 VKGQQVQQSPLSLVLQEGEKAELQCNFSSTATQLQWFYQHPGGRLVSLLYNPSGTKHTGRLTSTTVTNKRRSSLHISSSQTTDSGTYLCAMEPQCS
Mus caroli V182 trav FMAL02012853.1 9160 VSSQEKVQQSPESLIVPEGAMNSLNCTFSDSASQSIWWYQQHPGKGPKALISIFSNGNKKEGRLAVYLNRASLHVSLHIRDSQPSDSAVYLCAV
Mus caroli V183 trav FMAL02012860.1 3887 VSRGEQMEQRPLHLSVREGDSAVITCTYTDSATAYFYWYKQEAGAGLQLLMSVFSNVDRKEEQGFTVLLNKKDKRLSLNLTAAHPGDSAVYFCAAS
Mus caroli V184 trdv FMAL02012867.1 34767 TSLDVYLEPVAKTFTVVAGDPASFYCTVTGGDMKNYHMSWYKKNGNNALFLVYKLNSNSTDDVMGNFKGKINISKNQFILDIQKATVKDAGTYYCGSD
Mus caroli V331 trbv FMAL02023140.1 5828 PVDPKIIQKPKYLVAVTGSEKTLICEQYLGHNAMYWYRQSAKKSLEFMFSYSYQKLMDNQTASSRFQPQSSEKNHLDLQITALKPDDAATYFCASSQ
Mus caroli V332 trbv FMAL02023140.1 7280 HTGPKVLQIPSHQVVDMGQMVTLNCDPVSNHQYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDDSYFTLKIQPTTLEDSAMYFCASSL
Mus caroli V333 trbv FMAL02023140.1 16037 PLETSVFQTPNYRVTQVGNEVSFNCEQTLGHDTMYWYKQDSKKLLKILFSYNNKQLIVNETVPRRFSPQSSDKAHLNLQIKSVELEDSAVYLCASS
Mus caroli V334 trbv FMAL02023140.1 21102 LMNTKITQSPRYLIMGRANKSLECEQHLGHNAMYWYKQSAEKPPELMFLYSVKQLIRNETVPSRFIPECPDSSKLLLHVSAVDPEDSAVYFCASSQ
Mus caroli V335 trbv FMAL02023140.1 52377 GDGGITQTPRYWITQTSRKIILKCSQDMNHYRMFWYRQDAGQGLKLIHYSVGTDRTTKGDVPEGYSAFRNEIQSFPLTLESTSSNQTSMYFCASSEQ
Mus caroli V336 trbv FMAL02023140.1 76838 SANSGVVQSPRHIIKEKGGRSVLKCIPISGHSNVVWYQQTLGKELKFLIQHYEKEERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Mus caroli V337 trbv FMAL02023140.1 79232 HVEAAVTQSPRNKVTVTGGNVTLSCHQTNSHNYMYWYRQDTGHGLRLILYSYGVDNLEKGDVPDGYKATRKTQEDFFLMLELASPSQTSLYFCASSD
Mus caroli V338 trbv FMAL02023140.1 82346 SANSGVVQFPRYIIKEKGERSILKCIPIPGHLSVAWYQQTLGQELTFFIQHYDKIERDKGNLPSRFSVQQFDDYHSEMNMSALKLEDSAVYFCASS
Mus caroli V339 trbv FMAL02023140.1 84797 HMEATVTQSPRNKVAVTGGKVTLSCDQTNNHNNMYWYRQDMGLGLRLIHYSYGADNTEKGDIPDGYKASRPSQKEFSLILELASPSQTSVYFCASSD
Mus caroli V340 trbv FMAL02023140.1 93548 HMEAAVTQSPRKKVAVTGGKVTLNCHQTNNHDYMYWYRQDMGHGLRLLHYSYVANSTEKGDVPDGYKASRPSQEDFSLILELASLSQTAVYFCASSD
Mus caroli V341 trbv FMAL02023143.1 6495 LVDMKVTQMPRYLIKRMGENVLLECGQDMSHERMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSL
Mus caroli V342 trbv FMAL02023144.1 2447 SVFSVLLYQKPNRDICQSGTSLKIQCVADSQVVSMFWYQQFQGQSLMLMATANEGSEATYESGFTKDKFPISRPNLTFSTLTVNNARPGDSSIYFCSSG
Mus caroli V348 igkv FMAL02023487.1 6508 IMSRGENVLTQTPAIMAASLGEKVTMTCSASSSVSSSYLHWYQQKSGASPKLLIYRTSNLASGVPARFSGSGSGTSYSLTISSVEAEDDATYFCQQWSGYP
Mus caroli V349 igkv FMAL02023489.1 36427 SRGDIVLTQSPATMSVTPGERVSLSCRASQSISNNLHWYQQKSHDSPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDIGIYFCLQRNSW
Mus caroli V350 igkv FMAL02023489.1 47747 ARCDIQVTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYTATNLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHHYSTP
Mus caroli V351 igkv FMAL02023489.1 88496 SRGDILLTQSPAILSVTPGERVSISCRGSQSIGTSIHWYQQKTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNSWP
Mus caroli V352 igkv FMAL02023490.1 12961 SAVTGETTQSPASLSFSLGETATLTCRSSESVGSYLAWYQQKAEQVPRLLIHSASTRAGGVPDRFSGTGSGTDFTLTVSSLEPEDAAVYYCQPFKSWS
Mus caroli V353 igkv FMAL02023490.1 41069 STGDILMTQSPATLSVTPGETVSLSCRASQSINKNLHWYQQKSHGSPRLFIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGIYYCHQCY
Mus caroli V354 igkv FMAL02023490.1 54518 AGCDIQMTQSPASLAASVGETITCRASENIYYSLAWYQQKQGKSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINSMQPEDTATYFCKQAYDFP
Mus caroli V355 igkv FMAL02023490.1 91843 SRCDIVMTQSPATLSVTPGDRVSLSCRASQSISNHLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVEPEDVGVYFCQQSNSW
Mus caroli V356 igkv FMAL02023492.1 3354 STGDIVLTQSPASLAVSLGQRVTISCRASQSVDSYGSSYMNWYQQKPGQPPKLLIYYASNLESGVPARFSGSGSGTDFSLNIHPMEEDDTATYFCQQSNEYP
Mus caroli V387 trgv FMAL02026443.1 59598 RQTSSNLEERITSVTKLEGSSAIMTCDIHGTGTYIHWYRFQKGRAPEHLLYYNFVSSTTVVDSRFNSEKYHVYEGPDKRYKFVLRNVEESDSALYYCATWA
Mus caroli V388 trgv FMAL02026443.1 66857 GHGKLEQPEISISRARDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHVSLGKEYKKMEASKNSSASTSTLTIYSLEEEDEAIYYCSYG
Mus caroli V389 trgv FMAL02026443.1 72005 SEGSSLTSPLGSYIIKRKGNTAFLKCQIKTGVQKPDAYIHWYQEKPGQRLQRMLCSSSKENIVYEKDFSDERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus caroli V390 trgv FMAL02026443.1 73820 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLKEGEPLRRIFYGSVKTYKQDKSHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Mus caroli V424 igkv FMAL02028039.1 2205 IRCDIKMTQSPSSMYASLGERVTITCKASQNINSYLSWYQQNPGKSPKTLIYGANSLVDGVPSRFSGSGSGQDYSLTISSLKYEDTGIYYCLQYDEFP
Mus caroli V425 igkv FMAL02028121.1 4962 ARCDILMTQSPSSISASLGERVSLTCRASQDIRGYLNWFQQKPDGTIKQLIYGTSNLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQSASYP
Mus caroli V428 igkv FMAL02028286.1 9563 SRGDILLTQSPATLSVTPGDRVSLSCRASQSISNNLHWYQQKSHDSPRLLIRHASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSW
Mus caroli V429 igkv FMAL02028286.1 21442 ARCDIQMTQSPASLSASVGEIVTITCRASEDIYSYLAWYQHKQGKSPQLLVYAATLLADGVPSRFSGSRSGTQYSLKINSLQPEDYGSYYCQHSYGTP
Mus caroli V430 trgv FMAL02028290.1 3543 GLGQLEQTEVSVTRATDESAQISCIVSLPYFSNTVIYWYRQKTNQKFEYLINIWTKYNERHFGGKKKKIEASKDFQSSTSTLKINYLKKEDEATYYCAVWI
Mus caroli V431 igkv FMAL02028722.1 7502 ARYDIQMTQSPSSLYASLGERVSLTCRASQDIRGYLNWFQQKPDGTIKRLIYNTSNLDSGVPKRFSGSRSGSDYSLTISNLESKDFADYYCLQLNEFP
Mus caroli V432 igkv FMAL02028853.1 19977 SRGDVVMTQTPVSLTVSLGDQASISCRSSQSLVHKNGNTYLKWFMQKPGQSPQLLIYEISNRFSGVPDRFSDSGSGTDFTLKISRVEAEHLGVYYCSQT
Mus caroli V433 ighv FMAL02028865.1 8803 ILSDVQLQESGPGMVKPSQSLSLTCTVTGYSITSGYRWNWIRQFPGNKLEWMGYISYSGSTNYNPSLQSRNSITRDTSKNQFFLQLNYVTTEDTATYYCA
Mus caroli V434 trav FMAL02028910.1 8950 RSNGDSVTQTEGLVTLTEGLPVMLNCTYQTTYSPFLFWYVQHLNEAPKLLLWSSTDIKRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mus caroli V435 igkv FMAL02029032.1 11331 STGDIVLTQSPASLAMSLGQTVTISCIASESVDNYGYSLMNWYQQKQGQPPKLLIYDASTLQSGVPARFSGRGSGKDFTLSIHPVEEEDIADYYCQQSKEVP
Mus caroli V436 igkv FMAL02029032.1 19956 STGDIVLTQSPASLPVSQGQRATISCKASQSVDYNGISYMDWFQQKPEQPPKLLINRASNLESGVPARFSGSGSGTDFTLNIHPLKEDDAATYYCQQSNKDP
Mus caroli V438 ighv FMAL02029259.1 4840 VHCQVQLQQSGPELVKPGASVKISCKASGYTFTSYDLNWVKQRPGQGLEWIGYIYPGSGGTAYNQKFKGKATLTADNPSSTAYMQLSSLTSEESAVYFCA
Mus caroli V439 ighv FMAL02029259.1 18105 VHSQVQLQQSGAELVKTGASVKISCKASGYTFTDHVINWVKQRPGHDLEWIGYIYPRDSSTKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCA
Mus caroli V440 igkv FMAL02029474.1 7844 IMSRGQIVLTQSPAIMSASSGEKVTITCSASSSVSYMHWYQQKPESSPKLWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWSSN
Mus caroli V442 trav FMAL02029558.1 5674 VNSQQKVQQSPESLIVAEGATASLNCTFSDSASQYFAWYRQHSGEGPKALMSIFSSGEKEEGRFTIHLSKASLHFSLHIRDSQPSDSALYLCAV
Mus caroli V443 igkv FMAL02029690.1 12482 ANGDVVMTQTPLSLSLTIGQPASISCKSSQSLLHSDGKTYLYWLQQRPGQSPKRLMYQVSKLDPGIPDRFSGSGSGTDFTLRISRVEAEDLGVYYCLQR
Mus caroli V444 igkv FMAL02029810.1 857 VSGDIVITQDELSNPVTSGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLIYLMFTRASGVSDRFSGSGSGTDFTLNISTVKAEDVGVYYCQQIVEYP
Mus caroli V445 igkv FMAL02029931.1 9223 AIGDIVMTQASPSVPVTPGESVSISCRSSESLLHSSGKHRLYWFLQRPGQSPQRLIYYMSNLASGVPDRFSGSGSGTDFTLRISRVQAEDVGAYYCMQSLEYP
Mus caroli V446 ighv FMAL02029971.1 2322 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSSAMTWVRQTPEKRLEWVATIRADGSYTYYPDTVKGRFTISRDNAKNTLFLQMSSLRSEDMAMYYCAR
Mus caroli V448 ighv FMAL02030225.1 11752 VQCEVQLLETGGGLVLPGGSRGLSCEGSGFTFSGFWMSWVRQTPGKALEWIGDINSDGSAINYAPSIKDRFTIFRDNAKSTLYLQMSNMRSEDTATYFCMR
Mus caroli V449 ighv FMAL02030225.1 27998 ILSDVQLQESGPGLVKPSQSLSLTCTVTGYSITSGYDWNWIRQFPGNKLEWMGYINYRGSTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCA
Mus caroli V451 igkv FMAL02030371.1 29822 VDGDIVMTQSQKFLSTSVGERVSIPCKASQNVGTVVNWYQQKPGKSPKALIYWASNRYTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYP
Mus caroli V452 igkv FMAL02030371.1 55254 VDGDIVMTQSHKFMSTSVGERVSIPCKASQNVGTAVAWYQQKPGKSPKALIYWTSNRYIGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQGNSYP
Mus caroli V453 ighv FMAL02030483.1 5240 AQAQIQLVQSGPELKKTGETVKISCKASGYTFKRYAMNWVKQAPGKGFKWMGWITTNTSVPTYADDFKGRFTFSLETSASTAYLQINNLKNEDMATYFCA
Mus caroli V454 ighv FMAL02030575.1 711 VHSEVQLQQSGAELVRPGSSVKLSCKTSGYTFTSYGINWVKQRPGQGLECIGYIYLGNGYTEYNEKFKGKATLTSDSSSSTAYMQLNSLTSEDSAVYYCA
Mus caroli V455 igkv FMAL02030651.1 16981 VDGDIVMTQSQKFMSTSVGERVSITCKASQNVCNALAWYQQKPGKSPKPLIYLASNWHTGVPDRFTGSGSGIYFTLTISSVQAEDLADYFCQQYY
Mus caroli V456 ighv FMAL02030664.1 6283 VNSQVQLQQSGAELVRPGTSVKMSCKASGYTFTSYWMDWVKKSPGQGFEWIGNINPNSGGTYYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus caroli V457 igkv FMAL02030870.1 5974 IMSKGQIVLTQSPAIMSASPGEKVSITCSASSSVSYMHWYQQKPGSSPKLWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWSSN
Mus caroli V532 iglv FMAL02007553.1 63956 FQPTLTQPDAFSVFPGQDAHLSCTINSQHATAGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISPVLPEDDADYFCSI
Mus caroli V554 ighv FMAL02009174.1 39331 VQCEVHLVESGGGLVQPGSSMKLSCTASGFTFSDYGMAWIRQVPEKSLEWVAAINYDGSNTYYLDSLKGRFIISRDNAKNILYLQMSNLKSEDTDMYYCAR
Mus caroli V555 ighv FMAL02009174.1 13507 VLSQVQMKESGPDLVQPSQTLSLTCTVSGFSLSSYGVHWFRKPPRKGLEWLGGIWSDGSIYYNPVLSSRLSVSWDISKSQVFFKMSSLQSEDTAVYHCAR
Mus caroli V556 ighv FMAL02009175.1 1088 VQCEVKLVESGGGLVQPGGSLKLSCAASGFTFSSYDMSWVRQTPEKRLEWVAAISNSGRNTYYPDTVKGRFTVSRDNAKNVLYLQMSSLRSEDTAMYYCAR
Mus caroli V557 ighv FMAL02009176.1 34245 IQCEVKLVESGGGLVQPGASLRLSCAASGFTFSDFYMEWVRQAPGKGLEWIAASRNKANDYTTEYSASVKGRFTVSRDTSQSILYLQMNTLRAEDTAMYYCARD
Mus caroli V558 ighv FMAL02009176.1 25720 VLSQVQLKESGPGLVAPSQTLSITCTVSGFSLTSYGVHWVRQPPGKGLEWVGAMGWDDKKYYNSALKSRLSISRDTSKSQVFLKLSNLQTEDTATYYCAR
Mus caroli V559 ighv FMAL02009176.1 15052 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWMGTIWYDGSTYYNAALKSRLSISRDTSKSQVFLKMNSLKTDDTAIYYCAR
Mus caroli V560 ighv FMAL02009176.1 3668 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYGMSWVRQTPEKRLEWIAYISSGSSTIYYADTVKGRFTISRDNAKNTLFLQMTSLRSEDTAMYYCA
Mus caroli V561 ighv FMAL02009177.1 33316 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTDYGMNWVKQAPGKGFKWMGWIDTNTGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCA
Mus caroli V562 ighv FMAL02009179.1 551 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSGFCWHWIRQPPGKGLEWMGRICYEGSIYYSPSFQSRSTISRDTSLNKFFIQLSSVTDEDTAMYYCSRE
Mus caroli V563 ighv FMAL02009182.1 103194 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSDYRMDWVHHSPENGLEWVAEIRNKASNYATYYAESVKGRFTISRDDSKSIVYLHMNSLRAEDTGIYYCT
Mus caroli V564 ighv FMAL02009182.1 83391 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSDYWMHWVRQSPEKGLEWVAEIRNKANNYATHYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus caroli V565 ighv FMAL02009182.1 74019 VHSQVQLQQSGAELLRTGASVKVSCRASGYTFTSYYVDWVKQRTGYSLEWIGRIIPGIGATDYAQKFKGKATLTADTSSTVYMELSSLTSEDSAVYYCA
Mus caroli V566 ighv FMAL02009182.1 47338 SLSQMQLQESGPGLVKPSQSLFLTCSITGFPITSGYYWIWIRQSPGKTLEWMGYITHSGETFYNPSLQSPISITRETSKNQFFLQLNSVTTEDTAMYYCAGD
Mus caroli V567 ighv FMAL02009182.1 13529 ILSEVQLQESGPGLVKPSQTLSLTCSVTGYSITSAYWSWIRKFPGNKLEHMGHISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCAR
Mus caroli V626 trav FMAL02012848.1 10400 ESQGEQVEQLPSSLIVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLHITATQPGDSAIYFCSAS
Mus caroli V627 trav FMAL02012855.1 5158 VSRGEQVEQRPSHLSVREGDSAVIICTYIDPNSYYFFWYKQEPGAGLQLLMKIFSSTEINEGQGFTVLLNKKDKQLSLNLTAAHPGDSAAYFCAVS
Mus caroli V628 trav FMAL02012861.1 4165 GNSAQSVDQPDTHVTVSEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDAVVKGTKGFEAEFRKSSTSFNLKKSPAHWSDSAKYFCALE
Mus caroli V629 trav FMAL02012862.1 116478 VATQQLEQSPQFLSIQEGQDFTAHCSSSTTFPQFYWYRQVPREGPVILVTLVKSGEVKEHKRMTAKFGEARKNSSLFITRAQPGDAGTYFCAG
Mus caroli V630 trav FMAL02012862.1 72250 IAGDAKTTQPDLMESTEGEMVRLPCSHATISGNEYIYWYRQVPLRGPEYVTHGLQQNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRV
Mus caroli V633 trav FMAL02012862.1 16362 ASMAQTVSQPQKEKSVQVAESATVDCTYDTSDTNYLLFWYKQQGGQVTLVVRQEAYKQYNATLNRFSVNFQKAAKTFSLEISDSQLGDAATYFCALRG
Mus caroli V634 trdv FMAL02012862.1 5481 ASMAQTVSQPQKEKSVQVAESATVDCTYDTSDTNYLLFWYKQQGGQVTLVILQEAYKQYNATLNRFSVNFQKAAKTFSLEISDSQLGDTATYFCALM
Mus caroli V635 trdv FMAL02012867.1 102003 KDVLCITVTQSSPHQTVASGTEVTLHCKYDVDSPNPDLFWYRKRPDRSFQFILYRDDTSSHDADFVQGRFSVKHSKANRTFHLVISPVSFEDSATYYCASG
Mus caroli V797 trbv FMAL02023141.1 67745 LSEAGVTQSPRYAVLQEGQAVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFRNEAVIDNSQLPTDRFSAVRPKGTNSTLKIRSAKQGDTATYLCASSL
Mus caroli V798 trbv FMAL02023141.1 61826 HTDAGVTQTPRHEVAEKGQTITLKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGTLKDRFKAEMPNSSFSTLKIQPTEPQDSAVYLCASSL
Mus caroli V799 trbv FMAL02023141.1 51279 PTNAGVIQTPRHKVSGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQTHSTLKIQSTQPQDSAVYLCASSL
Mus caroli V800 trbv FMAL02023141.1 36930 FVDTTVKQNPRYKLARVGKAVNLICSQTMNHETMLWYQKKPNQAPKLLLYYYDENLNREADTSENFQSSRPNNSFCSLDIGSPGLEDSAMYLCASSR
Mus caroli V801 trbv FMAL02023141.1 20449 TTHGDGGIITQTPKFLIGQEGQKLTLKCQQNFNHDSMYWYRQDSGKELRSIYYSITENDLQKGDLSEGYDASRENKSSFSLTVTSAQKNEMAVYLCASSI
Mus caroli V803 trbv FMAL02023141.1 1198 SMDSGVVQNPRHLVKRKEQKAKMDCTPINGHSYVYWYYKKLGEELKFLVYFQNEDIIDKTDMIGKNISAKCPAKKPCTIEIQSSKLTDSAVYFCASSQ
Mus caroli V804 trbv FMAL02023142.1 38386 SFDAAVTQKPRYLIKMKGQEAEMKCIPEKGHTAVFWYQQKQSKELKFLIYFQNQQPLDQIDMVKERFSAVCPSSSLCSLGIKTSEAEDSALYLCSSSQ
Mus caroli V805 trbv FMAL02023147.1 55194 VSAQTIHQWPVAEIKAVGSPLSLECTIKGKSNPNLYWYWQATGGTLQQLFYSINVGQVESVVPLNLSASRPRDNQFILSTEKLLLSHSGFYLCAWS
Mus caroli V807 igkv FMAL02023483.1 5323 AIGDIVMTQVAPSVPVTPGETVSISCRSSKSLLNSNGKHLLYWFLQRPGQSPQRLIYYMSNLASGVPEWFSGSGSGTDFTLRISRVEAEDVGAYYCMQSLEYP
Mus caroli V808 igkv FMAL02023484.1 148114 ARCDIQMTQSPSSMSAFLGETVSITCHASQSISSDLSWLQQKPGKSPKTLISYATNLEDGVPSRFSGSGSGADYSLTISSLESEDYADYYCVQ
Mus caroli V809 igkv FMAL02023484.1 109445 ARCDIKMTQSPSSMYASLGERVTITCTASQDVKSYLSWYQQKPGKSPKALIYYAINLADGVPSRFSGSGSGQDYSLTISSLESDDTAIYYCLQHGESP
Mus caroli V810 igkv FMAL02023484.1 91021 ARCDVQMIQSPSSLSASLGERVTMTCQASQGTSINLNWFQQKPGKSPKLLIYGASNLEDGVPSRFSGSGYGTDFTLTISSLEDEDMATYFCLQHSYLP
Mus caroli V811 igkv FMAL02023484.1 51557 SSSDAVMTQTLFSLPVSLGDQASISCRSSQSLVDSNGNTYLNWYLQKPGQSPQLLIYRVSKLFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCLQV
Mus caroli V812 igkv FMAL02023485.1 75235 SRGEIVLTQSPAIIAASPGQKVTITCSASSSVTYTHWYQQKSGTSPKPWIYEISKLASGVPARFSGSGSGTTYSLTISSVEAEDAATYFCEQWNY
Mus caroli V813 igkv FMAL02023485.1 50925 VLCDIQMTQSSSFLSASLGDHLTINCRASKDINKYFAWVQQKPGKAPRMLIHFASTLLPGVPEKFSGSGSGTDFSLTIRNIESEDIAAYYCLQYSEHP
Mus caroli V814 igkv FMAL02023485.1 22477 VVIRCDIQMTQSPASLSASVGESVSITCGASENIYSALNWYQRKQGKSPQPLIYGATNLADGVSSRFSGSGSGRQYTLKISSLHPDDVATYYCQNVLSTP
Mus caroli V815 igkv FMAL02023491.1 75222 TCGDIVMSQSPSSLAVSAGEKVTLSCKSSQSLLSSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQSEDLADYFCQQGYSYP
Mus caroli V816 igkv FMAL02023491.1 38390 AHGSIVMTQSPKSLPVSAGDRVTMTCKASQSVSNEVNWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYFCQQDY
Mus caroli V817 igkv FMAL02023491.1 24648 ACADIVMTQSPTFLAVTASKKVTISCTASESLYSSKHKVNYLAWYQKKPEQSPKLLIYGASNRYTGVPDRFTGSGSGTDFILTISSVQAEDLTHYYCAQFYSYP
Mus caroli V818 igkv FMAL02023491.1 14174 TCGDILMTQSPSSLTVSAGEKVTMSCKSSQSFLASGNQNNYLAWHQQKLGQSPKLLIIWASTRVSGVPDRFIGSGSGTDFTLTINSVQAEDLAVYYCQQSY
Mus caroli V819 igkv FMAL02023491.1 2155 INGDVVMTQTPLTLSANIGQSASISCRSSQSLLHSNGNTYLNWFLQRPGQSPQLLIYGVFERESEVPDRFSGSGSGTDFTFKISKVEAEDLGVYYCMQTTYEP
Mus caroli V856 trgv FMAL02026446.1 29112 GLGQLEQTEVSVTRATDERAQISCTIYLPYFSNTAIHWYRQKTNQQFEYLIYVETNYNQRPLGGKNKKIEASKDFKSSTSTLEINYLKKEDEATYYCAVWI
Mus caroli V857 trgv FMAL02026448.1 13153 GLGQLEQTEVSVTRATDESAQIPCIVSLPDFSNTEIHWYRQKAKQFEYLIYVVTNYNQRPLGRKNKKIEASKDFQTSTSTLKINYLKKEDEATYYCAVWI
Mus caroli V886 ighv FMAL02027751.1 21123 FNSQVQLQQSGAELVRPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIDRSDSETIYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSVVYYCA
Mus caroli V887 ighv FMAL02027789.1 1130 VHSQVQLQQSGTELVKPGASVKISCKASGYTFTDHVIHWVKQRHEQGLEWIGYISPGNGDTKYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus caroli V889 ighv FMAL02027858.1 20895 TLKESGPGKLQPSQTFSLTCSFSGFSLSTYGMMVSWMCQPSGKGLEWLAHIWWNDDKGYNPSLMSWLTISKDTPSNQIFLRIASVDTADTATYYCARRAY
Mus caroli V890 ighv FMAL02027858.1 9506 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTSYSMDWVKQRPGQGLEWIGRIYPFDSDTRYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCA
Mus caroli V892 igkv FMAL02027904.1 6862 VDGDIVMTQSQKFMSTSVGERVSIPCKASQNVGNGIAWYQQKAGQSLELLIYGASNRHTGVPDRFTGSGSGTDFTLTISSVQSEDMADYFCQQGYSSP
Mus caroli V893 igkv FMAL02027968.1 45029 IRCDIKMTQSPSSMYASLGERVTITCKASQNIDRYLSWYQKKPGKSPKTLIYGANSLVDGVPSRFSGSGSGQDYSLTISSLKYEDTGIYYCLQYDEFP
Mus caroli V894 igkv FMAL02027968.1 14638 STADIVMTQAAFSNPVILGTSASISCRSSKSLLHSNGITYLYWYLLRPGQSPQLLIYRMSNLASGFPDRFSGSGSGTDFTLRISRVEAEDVGVYYCGQLLEFP
Mus caroli V895 igkv FMAL02027968.1 6287 SSSDVLLTQTPLFLPVSLGDQASISCTSSQSLVHSNGNTYLGWHLQKPGQSLQLLIYEVSKRHSGVPDRFSGSGSGTDFTLKISRVETEDLGVYYCFQG
Mus caroli V896 igkv FMAL02028019.1 33098 IMSRGQIILTQSPAIMSASPGEKVTMTCSASSSVSSGYLHWYQQKPGTSPKLWIYGTSNLASGVPGRFSGSGSGTSYSLTISSMEAEDAAIYYCQQWSSNL
Mus caroli V897 igkv FMAL02028019.1 18239 ILSRGQIVLTQSPAIMSASPGEKVTMTCSASSSVNYMHWYQQKPGSSPKLWIYDTSKLVSGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQRGSY
Mus caroli V898 igkv FMAL02028019.1 5413 IISRGQIVLTQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPSRFSGSGSGTPYSLTISSMEDEDAATYYCHQWSSY
Mus caroli V899 igkv FMAL02028086.1 8346 AIGDIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGITYLYWFLQRPGQSPQLLIYYMSNLASGVPEWFSVSGSGTDFTLRISRVEAEDVGVYYCMQGLEYP
Mus caroli V900 igkv FMAL02028123.1 1944 IMSRGQIVLTQSPAIMSASPGAKVTMTCSASSSVIYMYWYQQKPGSSPKLLIYHTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQFTSSH
Mus caroli V901 igkv FMAL02028136.1 2253 ARCDIQMTQSPSSLSASLGERVSLTCQASQGISNNLNWYQQTPGKAPKLLIYDASNLHDGVPSRFSGTGYGADFTSTISSLEEGDEATYFCLQYRYLP
Mus caroli V902 igkv FMAL02028146.1 12771 TCGNIMMTQSPSSLAVSAGEKVTMNCKASQSVLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCHQYLS
Mus caroli V904 ighv FMAL02028276.1 3707 VYSQVQLQQSGAELVRPGTSVKMSCKASGYTFTNYLIEWVKQRPGQGLEWIGWIYPGDGDTNYNEKFKGKATLTADKSSSTAYMQLSSLTSEDTAIYFCA
Mus caroli V905 igkv FMAL02028565.1 2140 TNGDVVMTQTPLTLSVTIGQPASISCKSSQSLLHSNGNTYLNWLLQRPGQSPKLLIYLVSKLDSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCLQH
Mus caroli V906 igkv FMAL02028814.1 21788 IMSRGENVLTQSPAIMAASPGEKVTMTCSASSSVSSGYFHWYQQKSGTSPKLWIYSTSNRASGVPACFSGSGSGTSYSLTISSVEAEDDATYYCQQWSGY
Mus caroli V908 trav FMAL02028861.1 4194 GVRGMPVEQNPPALRLYEGADSGLRCNFSTTMKSVQWFQQNHRGRLINLFYLAQGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYFCAAE
Mus caroli V910 ighv FMAL02028979.1 1962 VQSEVKLEESGGGLAQPGGSMKLSCAASGFTFSAYWMEWVRQSPEKGLEWVAEIRNKANNYATYYEESVKGRFTVSRDDSKSSVYLQMNNLRAEDTGTYYCT
Mus caroli V911 igkv FMAL02029020.1 14262 ARCDIQMTQSPASLSASVGETVTITCRASENIANHLAWYLQKQGKSPQLLVYAATSLADGVPSRFRGSGSGTQYSLKINSLQPEDFGSYYCHHYYSTP
Mus caroli V912 igkv FMAL02029047.1 23687 ARCDIQMTQSPSSLSASLGERVSLTCRASQDISGYLNWFQQKPDGTIKRLIYGTSNLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYASYP
Mus caroli V913 igkv FMAL02029139.1 40014 VDGDIVMTQSQKFMSTSVGERVSIPCKASQNVGTAVAWYQQKAGQSLELLIYGASNRYTGVPDRFTGSGSGTDFTLIISNVQSEDMTDYFCEQRYSYP
Mus caroli V914 igkv FMAL02029139.1 19082 ACGEIVLTQSIPSLTVSAGERVTISCKSSQNLLWSGNQRYCLVWHQWKPGQTPTPLITWTSDRYFGVPDRFIGSGSVTDFTLTISSVQAEDVAVYFCQQH
Mus caroli V916 iglv FMAL02029209.1 14515 AISQAVVTQESALTTSPGGTVILTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTSNRAPGVPVRFSGSLIGDKAALTITGAQTEDDGMYFCALWYSNH
Mus caroli V917 ighv FMAL02029260.1 11935 VPSQVQLQQSGPELVKPGASVKMSCKASGYTFSSYWMNWVKQRPGQGLEWIGQIYPGDGDTNYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus caroli V918 igkv FMAL02029622.1 26166 VDGDIVMTQSQKFMSTSVGDRVSIPCKASQNVGNGIAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYP
Mus caroli V920 igkv FMAL02029742.1 6547 TMSRGQIVLTQSPAIMSASSGEKVTMTCSASSSVSYMYWYQQKPGSSPKLWIYDTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWR
Mus caroli V921 iglv FMAL02029859.1 18720 AISQAVVTQESALTTSPGGTVTLTCRSSTGAVTTSNYANWVQEKTDHLFTGLIGGTNNRAPGAPARFSGSLIGDKAALTITGAQTEDDAMYFCALWYSNH
Mus caroli V922 iglv FMAL02029859.1 2107 SCAQFVLTQPSSVSTSLGSTVKLTCKRSTGNIESSYVHWYQQHMGRSPTNMIYKDDQRPSGVSDRFSGSIDSSSNSAFLTINNVQADDEADYYCQSSSSSV
Mus caroli V923 ighv FMAL02029948.1 1828 VNSEVQLQQSGAELVKPGASVKLSCTASGFNIINTYMHWVKQRPEQGLEWIGRIDPANGDTKYTPKFQGKATITADTSSNTAYMQLSSLTSEDTAIYYCA
Mus caroli V924 ighv FMAL02029962.1 20841 VHCQVQLQQSGPELVKPGASLKIFCKASGYTFTGYTIHWVKQRPGQGLEWIGWIYPGDGSTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus caroli V925 ighv FMAL02029962.1 5171 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLANIWWNDDKYYNPSLKSRLTISKDTSRNQVFLKIASVDTADTATYYCART
Mus caroli V926 igkv FMAL02029966.1 11903 TNGDAVMIQTPLSLSVTIGQPASISCNSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDPGIPDRFSGSGSETDFTLNISRVEAEDLGVYYCLQA
Mus caroli V927 igkv FMAL02030012.1 1081 ARCDVQMTQSPSSLSASLGERVSLTCQASQGISNNLNWYQQTPGKAPRLLIYGASILEDGVPSRFSGTGYGTDFTFTISSLEGEDVATYFCLQHSYLP
Mus caroli V928 igkv FMAL02030078.1 7757 ARCDIQMTQSPSSMSASLGERVSLTCRASQGINGNLHWFQQKSDGTIKRLIYSTSNLDSGVPSRFSGSGSGSDYSLTISSLESEDFAVYHCLQYDEYP
Mus caroli V930 igkv FMAL02030327.1 4894 IMSRGKVVLTQSPAIMSASPGEKVTITCSASSSVTYLHWYQQKPGSSPKHWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSGYP
Mus caroli V931 igkv FMAL02030418.1 10902 VTGDIVMTQAAPSVPVNPGESVSISCRSTKSLLHSSGNTYLYWFLQRPGQSPQLLMIYYMSNLASGVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCLQSLEYP
Mus caroli V932 igkv FMAL02030599.1 31342 TNGDVVMTQTPLSLSLTIGQPASISCKSSQSLLHSDGKTYLYWLQQRPGQSPKRLMYQVSKLDPGIPDRFSGSGSGTDFTLRISRVEAEDLGVYYCLQR
Mus caroli V933 igkv FMAL02030599.1 522 STHFVTIVTTHFVTIGQPASISCKTSQSLLHSNGNTYLNWLLQRPGQSPKLLIYLVSKLDSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCLQH
Mus caroli V934 igkv FMAL02030640.1 1473 ISKVIVMTQGALSNPVTSVESATISCRSSKSLLQKDGKAYLNWFLQKPGQPTWLLIHLMPTCASGVSDKFSDSGSGTDFTLKISKVEAEDVGVYYCQQVVEYI
Mus caroli V936 igkv FMAL02030651.1 18535 ACADIVMTQSPSSLAMSVGQKVTMSCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHY
Mus caroli V937 ighv FMAL02030687.1 5479 VQSEVKLEESGGGLAQPGGSMKLSCAASGFTFSNAWMEWVRQSPEKGLEWIAEIRNKANNHPTYYAESVKGRFTISRDDSKSTVYLQMNNLRAEDTGIYYCT
Mus caroli V938 ighv FMAL02030892.1 38469 ILSDVQLQESGPGLVKPSQSLSLTCTVTGYSITSGYGWNWIRQFPGNKLEWMGYIHYSGSTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Mus caroli V939 ighv FMAL02030892.1 22566 VQCEVKLLESGGGLVQPGGSLKLSCAASGFDFSSYWMSWVRQAPGKGLEWIGEINPDSSTINYAPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCAR
Mus caroli V940 igkv FMAL02030919.1 55899 IMTRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSSSYLHWYQQKSGTSPKLLIYSTSSLASGVPAHFSGSGSGTSYSLTISSMEAEDAATYYCQQVASFP
Mus caroli V941 igkv FMAL02030919.1 39730 IMSRGQIVLTQSPEIMSASPGEKVTITCSASSSVSYMHWFQQKPGSSPKLWIYSTSNLASGVPSRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNP
Mus caroli V942 igkv FMAL02030919.1 18711 IMSRGQIVLTQSPAIMSASPGAKVTITCSASSSVIYMYWYQQKPGSSPKILIYHTSYLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSN