WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Notamacropus eugenii ABQO000000000.2 (ABQO02) 209 18 41 57 57 17 9 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Notamacropus eugenii V12 trav ABQO020030336.1 1376 GSCQQKVEQNPAFLSVQEGDDITINCTYSDKNSQGLRWYRQDPGKGLTLLFYLASGTKQEGRFKAIWSRTDRHSSLHIPASQPGDSATYLCAVE
Notamacropus eugenii V14 iglv ABQO020036571.1 565 SFSQAMLTQSPSMSASLGATTRLTCTLSSQHSTNPIVWVQQSPGKSPRSIVAIASTGDATRNDGIPERFSGSSSGADRYLSISNIQSEDEADYYCLTAY
Notamacropus eugenii V22 trbv ABQO020056196.1 651 VHLDSRVVQHPRYLLSRTAHLVTLECDPISGHRGAYWYRQIPDQGPEMLFYFYGNRESEKGNVSAKFKANQENNLHFTLNISSLEKGDSALYLCASSK
Notamacropus eugenii V27 iglv ABQO020069912.1 6539 SGASYVLTQPPSVSKSLRETASITCVGDRIGRKSVDWYQQKPGQAPKLVIYSDNSRPSGIPERFSGSNSGNTATLRISGLQAEDEADYYCQVWDSSAD
Notamacropus eugenii V33 trav ABQO020079032.1 2972 WSTAQTVTQSPPTVSVQEMEAVTLECVYTTSDTYYDLYWYRQSPNGKLIYILRQDSEYSNAETGRYSVNFIKEAKSISLKISHSLLEYSGTYFCGI
Notamacropus eugenii V35 igkv ABQO020082506.1 313 SKGDIVLTQSPTSVSVTPGERVTISCKASQSVKHSDGNTYLNWIQHKPGQSPQLLLYRVSNLESGIPSRFSGSGAEKDFTLTISSLETEDLAVYYCSQGTSSP
Notamacropus eugenii V38 iglv ABQO020091542.1 353 SGASYVLTQPPSVSKNLRETASISCAGNGISSKDVQWYQQKPGQAPKLLIYYTNSRPSGIPDRFSGSKSGNTATLSISGLQAEDEADYYCQVWDSSAT
Notamacropus eugenii V41 igkv ABQO020103320.1 401 FQAAIVLTQTPASLSVAPGDRVTINCKASSSISNYMAWYQQKPGESPKLLIYAASKLQSGVPARFSGSGSGTDFTFTISVVEAEDVADYYCFHYRSAPF
Notamacropus eugenii V45 trav ABQO020115986.1 2431 GSCQQKVEQTPLFLSVDEGQDITINCTYSNQASDSLQWFRQDPGKGLTLLFYLTSGTKKEGRFKSLLNIKDRHSSLHITSSEPGDSATYLCAAE
Notamacropus eugenii V54 igkv ABQO020127696.1 1665 SSGDIVLTQSPASVSVTPGDRVTISCKASQSVKKSNGNTYLRWLQQKPGQSPRGLIYEVSNLYSGVPARFSGSGAETDFTLTISGMEAEDGAVYYCVQVSFTP
Notamacropus eugenii V57 trav ABQO020131889.1 308 GSCQQKVEQNPPFLSVQEREDITINCTYSDQTSSSVQWYRQDPGKGLTLLFYLVSGTKEEGRLKSLLNMKDRHSSLHIASSEPGDSATYLCAAD
Notamacropus eugenii V62 trbv ABQO020154462.1 1023 PMDAGITQNLRYLVIGIGRKVTLKCDQNMKHNYMCWYRKDPGLGLRLIYYSNNVNHRDKGEVSDGYSASRTEQPFFLLILESTNKNETSEYYCASSL
Notamacropus eugenii V64 igkv ABQO020159758.1 2644 SQAAIVLTQTPSSLSVTPGDRVTINCKASSSVSSYMEWYQQKPGQSPKLLIYDASTLQSGVPARFSGSGSGTDFTLTISAMEAEDAATYFCFQWDSSPF
Notamacropus eugenii V65 igkv ABQO020161713.1 586 ASGQIAVTQSPTSLSVTPGDTVTISCKASQDISKYLEWHQQKPGQSPKFLIYYTSNLHSGIPSRFRGSGSGTDYTLTISPVEADDAGVYYCLQYKNWL
Notamacropus eugenii V66 trdv ABQO020162993.1 68 KIIRCNQVIQSSPYQEVVSGSKVTLSCRYETQYTNPYLHWFRTRSDSSIKSILNGHGSSDRSFTTGKFSVQRNSAQKIFNLVISEVGPEDSASYYCAL
Notamacropus eugenii V75 igkv ABQO020183245.1 1729 SKGDIVLTQSPTSVSVTPGERVTISCKASQSVKHSNGYTYLYWIQHKPGQSPRRLIYGASSLESGVPARFSGSGAEKDFTLTISSLETEDLAVYYCSQ
Notamacropus eugenii V76 igkv ABQO020183245.1 5487 SRGEIVLTQSPASVSVAPGQRVTITCKASQSVKDSYGNTYLSWLQQKPGQSPRLLIYQVSNLYSGVPARFSGSGAEKDFTLTISSLETEDGAVYYCSQVTSSP
Notamacropus eugenii V81 iglv ABQO020188169.1 1276 SFSQDVLTQSSSMSASLGATAKLTCTLSNQYRSNYVSWIQQNPGKAPGHLMYISSSGSVSKSEGIPDRFSGSGSGADRYLTISNLQPEDEADYYCDTYYGSGNN
Notamacropus eugenii V83 trav ABQO020190393.1 2683 VRGQVKVDQTPRVLNLQEGENFMVSCNYSSFTTALQWFKQKPEEGLISLFFLTGQTQEKGNLRATLNSKERQSSLFITPSQLGDSGTYLCAVQ
Notamacropus eugenii V89 trav ABQO020206587.1 8683 VRGQLKQSPASLSLQEGERTTLNCTYTSSINNLQWYRHSPGTGPTILFIMIFDGDEKQQGRFKATLSTKSCHSFLSISATQPRDSATYFCALE
Notamacropus eugenii V100 iglv ABQO020236559.1 3673 SGASYVLTQPPSFSKSLGETASISCNGDGISSYCIHWYQQKPSQASKLVIYYDNSRPSGIPDRFSGSKSGNTATLSISGLQAEDEADYYCHVGDDDTD
Notamacropus eugenii V102 igkv ABQO020238794.1 2525 SRGEIVLTQSPASVSVAPGQRVTITCKASQSVKDSYGNTYLSWLQQKPGQSPRLLIYKVSNLYSGVPARFSGSGAEKDFTLTISSLEPEDGAHYYCAQGSFDP
Notamacropus eugenii V105 iglv ABQO020241456.1 1828 SGASNVLTQPPSVSKSLGETASISCAGVGTSGNYVYWYQQKPGQAPKLVIYYDNRRPSGVPDRFSGAKSGNVATLSISGLQAEDEADYYCEQWSSSGV
Notamacropus eugenii V109 igkv ABQO020249153.1 1120 SRGEIVLTQSPASVSVAPGERVTITCKASQSLKDSDGNTYLYWLQHKPGQSPRRLIYKVSNLGTGVPARFSGSGAEKDFTLTISSLEPEDGAVYYCSQLTSFP
Notamacropus eugenii V115 igkv ABQO020261872.1 744 ASGQIVMTQSPTSLSVTPGDTVTISCKASQDISKYLAWHQQKPGQSPKFLIYYTSNLHSGIPSRFRGSGAGTDYTLTISPVEADDAGVYYCMQCSNWP
Notamacropus eugenii V122 trav ABQO020277087.1 152 VSCLQKVEQSPQSLRIQEGENTSINCNFTEYSQGLQWFRQDAGKGLTLLFYLASGMKEEGRFQAVFNSKELHSSLHITASQPGDSATYHCGVR
Notamacropus eugenii V127 trgv ABQO020293411.1 2337 GQMAIVLEQKVISVTRNVGASATLTCEIFSPKFDNIHWYRYQEGRAPEHLLRYSMSKSESVLDPGVSPKNIRAYKGKDNSCRLTLSNLQLSDSGMYHCASWDG
Notamacropus eugenii V128 igkv ABQO020299174.1 559 SCAAILLTQSPASLSITPGDRVTISCRASQGVSTYLSWYQHPPGQSPKLLIYGASNLHSGVPARFSGSGSGTDFTLTISSVDAEDVGHYYCQQRNQYPN
Notamacropus eugenii V129 iglv ABQO020299267.1 2464 SFSQAVLTQSSSVSASLGATAKLTCTLSSQYRSNAIYWIQQSPGKAPRYLMYITTIGSASKGEGISDRFSGSGSGANRYLTISNLQPEDEADYYCGTYGNN
Notamacropus eugenii V140 trav ABQO020314429.1 1527 ASCQQKVEQNPPFLSVQEGEDITINCTYSVQDSQGLQWYRQDPGKGLTLLFYLASWTKEEGRFKSMLSRNDRHSSLHITASQPGDSATYLCAAD
Notamacropus eugenii V151 igkv ABQO020344072.1 3568 YQANIVSTQTPVSLSVAPRDRATINCKASSSILNYMDWYQQKPRHSTKLLIYDASSLQSGVPARFSGSGSGTDFTFTISASEAEDVADYYCFQWDSYPF
Notamacropus eugenii V152 iglv ABQO020344273.1 11396 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYKSNIINWIQQSPGKAPRYLMYIRSSGSVSKGEGIPDRFSGSGSGADRYLTISNLQPEDEANYYCAAYYGSGYN
Notamacropus eugenii V153 igkv ABQO020347388.1 346 SQAAIVLTQTPSSLSVTPGDRVTISCKASSSVSNYINWYQQKPGQPIKLLIYRASSLQSGVPTRFSGSGSGTDFTLTISAMEAEDAATYFCYQWSSSPF
Notamacropus eugenii V155 iglv ABQO020349397.1 4030 SFSQPVLTQSPSMSASLGATARITCTLSSQYNNYAIYWYQQSPGKAPRYVMYVTTSGGGGKGDGIPDRSSGSSSGANRYLSIANIQPEDEADYYCMTSYSGGI
Notamacropus eugenii V159 iglv ABQO020352554.1 5174 SGASYVVTQPPSVSKSLRETASITCVGDRIGSKAVDWYQQKPGQAPKLVIYSDNSRPSGIPERFSGSNSGNKASLSISGLQAEDEADYHCLAWDSSAD
Notamacropus eugenii V160 ighv ABQO020354643.1 1579 VHCDVQLIESGGDVKQPGGSIQLSCKGSGFTFSSYAMYWVRQAPGKGLEWVSYISSNGASTNYADSVKGRFTISRDNSNSMLKLQMNSLKPEDTALYYCTT
Notamacropus eugenii V161 iglv ABQO020354816.1 1560 SFSQAVLTQSSSMSASLGATAKLTCTLSSQHKSKGINWIQQSPGKAPRYLMYITTIGSAGKGEGIPDHFSGSGSGTNRYLTISNLQPEDEADYYCGIYYGNN
Notamacropus eugenii V167 iglv ABQO020363096.1 1319 SGASYVLTQPPSVSKNLGATASISCAGDGISSGYVSWYQQKHGQAPMLLIYLDDLKASGIPDRFSGSKSGNTATLSISGLQAEDEADYYCQVGDYSTG
Notamacropus eugenii V169 trgv ABQO020365653.1 4278 GQMAIVLEQKVISMTRNVGGSAALICEIFSPKFDNIHWYRYQEGRAPERLLRYSMTKSESVLDPGVSPEKIRAYKGKDNSCRLILSNLQLSDSGMYHCASWDG
Notamacropus eugenii V170 iglv ABQO020369647.1 2067 SFSQDVLTQSSSMSASLGATAKLTCTLSNQYRSNYVSWIQQNPGKAPRHLMYISSSGSVSKSEGIPDRFSGSSSGGDGYFSFSNLQPEDEADYYCDTYYGSGNN
Notamacropus eugenii V172 trbv ABQO020376657.1 204 QMDAGVTQNLRYLIIGSGREVTLRCDQDLGHDYMYWYRQDPGLGLQLISYSLMDDSPKIEVPYGYSASREEKSFFLLIMKSTHMNQTSEYFCASS
Notamacropus eugenii V176 iglv ABQO020381816.1 1892 AWAQYVLTQPVSVSGSLGQSVTVSCTRSSGNIGSNNVEWYQQHQGQAPNLIIHGYSNRPSGIPERFSGTKDTSTNSASLTISGLQPEDEADYYCQSAYYNSGY
Notamacropus eugenii V178 igkv ABQO020385000.1 7090 SGADIVVTQSPASLSVAPGDRVTINCKTSSSVSNYMAWYQQKLGQSPKQLIYSASTLQSGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCMKHNSAPF
Notamacropus eugenii V180 ighv ABQO020385950.1 1722 VECEVQLLETGGDVRQPGGSLRLSCKTSGFTFSNYYMSWIRQAPRKGLEWIAIIRNPANGLTTEHAESVKGRFTISRDDSSNTVFLQMNNMKNEDTAMYYCSR
Notamacropus eugenii V184 trgv ABQO020404509.1 336 HLSSAHLEQETSVVGIQGGSVILTCRFFGSDSTMVHWYRLQDGRPLERFLYFSLQLGTSTFGRVFDENKFRVHKDEFNEGSSILLIKKLEVSDTGIYYCGVWD
Notamacropus eugenii V186 igkv ABQO020406291.1 787 ARGAIGLTQSPASLPVSAGETVTMSCKATQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSRFSGSGSGTDFSLKISNVEAEDVAVYYCQQSNSRP
Notamacropus eugenii V190 trav ABQO020425527.1 2810 GSCQQKVEQNPPFLSVQEGDDITINCTYSDQASTSLEWFRQDPGKGLTLLFYLASGTKEEGRFKSLWSRNDRHSSLHITSSQPGDSATYLCATE
Notamacropus eugenii V203 trdv ABQO020446026.1 373 WSTAQRVTQSPPAVSVQEMEFVTLDCVYTTSYTRYDLYWYRQSPNGKLTYILQQYSENSNAKTGRYSVNFNKNAKSISLKISPSQLEDSGTYFCGI
Notamacropus eugenii V206 trav ABQO020449280.1 1079 GSCQQKVEQNPPFLSVQEREDITINCTYSDQASGNLQWFRQDPGKGLTLLFYLASGTKKEGRFKSVFNRNDRHSSLLISSSQLGDSATYLCAAD
Notamacropus eugenii V207 igkv ABQO020449717.1 13563 SGADIVVTQSPASLSVAPGDRVTISCKTSSSINKWMAWYQQKPGQSPKELIYSASTLQSGVPSSFSGSGSGTDFTFTISAVEAEDVAQYYCMKHNSAPF
Notamacropus eugenii V211 igkv ABQO020460392.1 163 TVMTQTPSSLSVAPGDRVTISCKAASSIGNAIFWFQHKPGQSPKILIYDASYLQSGVPARFSGSGSETDFTFIISAVEAEDLADYYCMEYDSYPF
Notamacropus eugenii V212 trav ABQO020461830.1 3703 GSCQHKVEQNPPFLSVQEGEDITINCTHSIQGSQGLQWYRQDPGKGITFLFYLASGTKQEGRFKAMLKRNDLHSSLDITASQPGDSATYLCAAD
Notamacropus eugenii V219 trav ABQO020479314.1 2364 TTKAQSVTQPEEQVSVSERSPVELKCTYSYSGAVYLYWYVWYPNQELQVLLRHTSEESNRGFQAKHNKDETSYHLRKLQVQEEDSAVYFCALS
Notamacropus eugenii V224 iglv ABQO020493796.1 6042 TFSQDVLTQSSSISASLGTTVKLTCTLSSQHRSNYISWIQQSPGKAPRYIMEVSSSGSLSKGEGIPDRFSGSSSGADRYLSISNLQPEDEANYYCGTYGNN
Notamacropus eugenii V225 iglv ABQO020494169.1 548 SFSQAVLTQSPSMSASLGATAKLTCTLSSQYRSNAIYWIQQSPGKAPRYLMYITSSGSAGKGEGIPDRFSGSSSGANRYLTISNLQPEDEADYYCGTYYSNP
Notamacropus eugenii V227 trdv ABQO020501575.1 1968 WSTAQTVTRSPPAVSVQEREAVTLDCVYTTSATYYYLYWYRQSPNGKLTYILQQYSESSNARTGRYSVNFNKNAKSISLKISPSWLEDSGMYFCA
Notamacropus eugenii V229 igkv ABQO020507726.1 535 ASGQIVMTQSPTSLSVTPGDTVTISCKASQDISKYLAWHQQKHGQSPKSLIYYTSTLHSGIPSRFKGSGSGTDYTLTISPVEVDDAGVYYCMQYKNWP
Notamacropus eugenii V235 trbv ABQO020518662.1 1470 PMDAKDARITQSPRHIVTRMGQKVILKCEQNLDHNAMYWYRQDQGQGLQLIYYSAIKGDIQDGDILEGYNVTRKEKEFFPLILNSSRTSQTSLYLCASSR
Notamacropus eugenii V237 igkv ABQO020521370.1 1436 SKGDLMLTQSPASVSVTPGEKVTITCTANQTVVYSDGYTYLSWFQQKPGQSPQLLIYQASYLESGVPARFSGSGADKDFTLTISSVEPEDGAVYYCFQDSFTP
Notamacropus eugenii V242 trav ABQO020534655.1 425 DSTAEEVIQPQPVASGWEKETVTLNCKYDVSDRDYALFWYKQSPSGQLNFLIHQESYNSQSARKDRYSVSFQKSDKFINLTISALQLGDSAMYFCALQE
Notamacropus eugenii V244 trav ABQO020536625.1 2626 VSCLQKVEQSPQTLKIQEGERATINCSYTEATNQGLQWFRQDPGKGLISLFYMTSEEKQNGRLRSMMSRKERHSSLHITDAQPEDSATYLCAVG
Notamacropus eugenii V245 trav ABQO020536625.1 6209 ASCQQKVEQNPPFLSVQEGEDITINCTYSVQVSQGLQWYRQDPGKGIILLFFLASGTKEEGRFKSMLSRNDRHSSLHITASQPGDSATYLCAAD
Notamacropus eugenii V250 trav ABQO020554832.1 1023 GSCQQKVEQNPPFLSVQQGEDITINCTYSDQSSQGLQWYRQDPGKGLTFLLYLASGTKQEGRFKSMLSRNDRHSSLYISASQPGDSATYLCAAQ
Notamacropus eugenii V254 igkv ABQO020572088.1 3104 SRGDIVLTQSPASVSVTPGERVTISCKASQSVKHSDGKTYLQWVQQKPGQSPQGLIYQVSNLHSGVPARFSGSGAEKDFTLTINGVEAEDGAVYYCAQ
Notamacropus eugenii V255 trav ABQO020572928.1 2277 GSCQQKVEQSPPFLSVQQGKDITINCTYSVQGSQNLQWYRQDPGKGITLVFYLTSGTKEEGRFKSLWNRNDRHSSLHITASQPGDSATYLCATD
Notamacropus eugenii V265 iglv ABQO020591444.1 959 SFSQPVLTQSPSMSASLGATAKLTCTLSSQHSSYTIVWFQQSPGKAPQYLMYVTSSGSVGKGEGIPDRFSGSSSGADRYLSISNLQLEDEADYYCGTYYGPSDA
Notamacropus eugenii V266 trav ABQO020592174.1 273 GSSQQKVEQNPPFLSVQEGEDITINCTYSDQASKGLWWYRQDPRKGITSVFYLTSGTKKEGRFKSTLSRNYRHSSLYINASQPGDSATYLCAAD
Notamacropus eugenii V278 igkv ABQO020617226.1 646 TQAVTVMTQTPASLTVAPGDRVTISCKASTSVYYAISWYQQKPGQSPKLLIYGASNLESGVPARFCGSGSGTDYTFTISGVEAEAVADYYCFQYGSTPF
Notamacropus eugenii V282 trav ABQO020628477.1 2577 GSCQQKVEQNPPFLSVQQGENITINCTYSVQVSEGLQWYTQDPGKGLTLLFHLVSGTKVEGRFKAMVSRNDRHSSLHISSSQPGDSATYLCAAD
Notamacropus eugenii V283 trbv ABQO020629760.1 5246 PTEAEISQTPRFLITTVKQEVTLTCHQDSNHNAMYWYQQEPQKGPKLMFSFSYQEMSLNESVPQRFNATSPEKNLLKLLIRGVESEDSSTYFCSSSA
Notamacropus eugenii V284 trbv ABQO020631864.1 661 LMDDGIIQTPKYLVTRKGAKVIFSCDPIKGHTQVYWYQQLLEREITFLISFLNNSPTDKSGMDPRFSANCSQSLPCELSIKTSEPGDSGIYFCASSE
Notamacropus eugenii V288 trdv ABQO020635711.1 477 VSTAQKVTQEQSTMSGQEGKTVTLNCKYETSEPGYALFWYKQYLSGKMILLIRQDSYSQENTWMGRYSLNFQKTKKYINLTISASQVGDSAMYFCAFG
Notamacropus eugenii V295 iglv ABQO020659561.1 1605 TIAQAVVTQEPSLTVNPGGTVTMTCSSSTGAVTSGHYPDWFQQKSGQVPRMLIYDTNNRVSGVPARFSGSLLGDKAALTINGAQAENEADYYCTLWYNDH
Notamacropus eugenii V297 igkv ABQO020666257.1 169 YQAAIVLTQTPSSLSVTPGERVTINCKASSSVSSYMEWYQQKPGQSPKLLIYYANSLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCMQSNSYPF
Notamacropus eugenii V300 trav ABQO020668222.1 527 PGMAQKVTQTPPVISVQEGKAVTLDCKYSTGDTNYYLFWYKQSSSGEMIFLIRQDSFNLQNASDGRYSVNFQKASTSIGLVISDSQLGDSSVYFCALRE
Notamacropus eugenii V301 igkv ABQO020668292.1 2844 TQAATVMTQTPASLSVAPGDRVTISCKASTSINKWISWYQQKPGQSPKLLIYYASNLESGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCMQSNSAPF
Notamacropus eugenii V305 trav ABQO020684026.1 62 GSCKQRVEQNPLLLSVQEGEDITINCTYSDKSFQSLQWYRQDPGKGLTLLFYLASATKEERRFKSLWSRNDRHSSLHMTASQPRDSATYLCATE
Notamacropus eugenii V312 trav ABQO020698832.1 369 VSCIQKVEQNPQSLSVQEGDNITINCTYTEYASSGLQWFLQDSRGSLVFLFMLTTGTKGKGRLSVSLNTKDQVSFFHITNSKAADSGTYLCAAS
Notamacropus eugenii V320 ighv ABQO020719803.1 3279 VHCDIQLVESGGDVRQPGGSLRLSCKASGFTFRDYSMDWVRQAPGKGLEWLSYIRYDGGSTNYADSVKGRFTISRDNSNNVLYLQMNSLKAEDSGTYYCAR
Notamacropus eugenii V332 trav ABQO020758821.1 1579 ASCQQKVEQNPPFLSVQQGEDITINCTYSDQASRGLQWYRQDPGKGLTLLFYLASGTKEEGRFKSFLNMKDRHSSLHIRASQPGDSATYLCAAD
Notamacropus eugenii V338 trgv ABQO020778656.1 172 HLSSAHLEQEISVVGIQGGSVILTCRLFGLVSTMVHWYRLQDGRPPKRFLYFSLQLGTSKFDRGFDENKFQVHKDEFNQNSLILLIKKLEVRDTGMYYCAVWD
Notamacropus eugenii V355 igkv ABQO020807376.1 1161 SQEAIVLTQTPVSLSVAPGDRVTINCKASSSISNYMDWYQWKPGQSPKLLIYAASYLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFQWDSYPF
Notamacropus eugenii V357 trav ABQO020808021.1 2031 VRGQQRVEQNPQFSSVQEGEDVTINCTYSDQGSRSIQWFRQDPGKGLTSLFYITTEEKQNGRLRSMINRKERHSSLHITDAQPEDSATYLCAVE
Notamacropus eugenii V359 trav ABQO020814370.1 2299 GSCQQKVEQNPPFLSVQEGDDITINCSYSDKNSQYVQWFRQDPGKGPTLLFYLTSATKEEGRFKSLWSRNDRHSSLHIRASQPGDSATYLCAAD
Notamacropus eugenii V360 trav ABQO020814370.1 8151 VSCLQKVEQSPQTLKIQEGERATINCSYTEATNQGLQWFRQDPGKGLISLFYMTSEEKQNGRLRSMMSRKERHSSLHITDAQPEDSATYLCAVG
Notamacropus eugenii V361 trav ABQO020814370.1 11734 ASCQQKVEQNPPFLSVQEGEDITINCTYSVQVSQGLQWYRQDPGKGIILLFFLASGTKEEGRFKSMLSRNDRHSSLHITASQPGDSATYLCAAD
Notamacropus eugenii V366 igkv ABQO020837365.1 388 CQAAIVLTQTPSSLSVTPGERVTINCKASSSISNNMEWYQQKPGQSPKRLIYYASSLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCMQHNSYPF
Notamacropus eugenii V369 iglv ABQO020851010.1 2513 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYRSNTISWIQQSPGKAPGYLMYITSSGGVGKGQGIPDRFSGSSSGADRYLTISNLQPEDEADYYCNTYYGSGSN
Notamacropus eugenii V372 ighv ABQO020856290.1 352 VHCDVQLVESGGDVRQPGGSLRLSCKRSGITFSNVYMSWIRQAPGKGLEWLSRIYGNGGSTYYADSVKGRFTISVDSSNSMLYLQMNSLKAEDSGTYYCAR
Notamacropus eugenii V379 trdv ABQO020864402.1 519 WSTAQTITQSPPAVSVQEMEAVTLECVYTTSYTYYFLYWYRLSPNGKLIFILHQFSEDSNEERGRYSTNFNKNAESISLKISPSLLEDSGTYFCV
Notamacropus eugenii V381 trav ABQO020869919.1 3618 VSCVQKVEQSPHSLKIQEGESTTINCSYTETTDQGLQWFRQDPGKGITSLFYITIQEKQSGRLRSMIRMNERHSSLHITDAQPEDSATYLCAVR
Notamacropus eugenii V394 igkv ABQO020896569.1 5426 SRTNTVLTQTPDLLPVSPGQTATITCKASKDIDDLQWYQKKPEQSPRLLIKDVSTLLEGVPAQFSGSGYGTDFTLTIKGVEAEDAGDYYCQQHDT
Notamacropus eugenii V414 iglv ABQO020937306.1 1116 TWAQFVLSQPASASGSLGQTVTVSCTRSSGNIGSNSVYWYQQHQGQALKLIIYDWNQRPSGIPERFSGSKDTSTNSASLTISGLQAEDEADYYCQSYVSGSN
Notamacropus eugenii V417 trbv ABQO020944076.1 1670 HMDTGVIQNPNFLVKGSGETVMLSCHPIKGHDYIYWYQQPMNKEFKFLIQRRTNQIIDDSGLLKERYSVEWSEGSPSILNIKTLKSEDSALYLCASSL
Notamacropus eugenii V418 igkv ABQO020944086.1 74 TQAATVMTQTPTSLSVAPGDRVTISCKASTSISKWISWYQQKPGLSPKLLIYAASSLESGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCSQYRSAPF
Notamacropus eugenii V426 igkv ABQO020965761.1 827 SRGENVLTQSPASVSVTPGERVTISCKASQSVKHNNGNIYLYWFQQKPRQSPRGLIYHVSTLGSEVPAWFSGSGAEKDFTLTINSVEPEDVANYYCVQASSY
Notamacropus eugenii V427 iglv ABQO020965854.1 2812 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYRSNTVSWIQQSPGKAPRYLMYITNIGSASKGEGIPDRFSGSGSGTNRYLTISNLQPEDEADYYCGIYYGNK
Notamacropus eugenii V432 trav ABQO020974668.1 644 GNCQQKVEQHPSFLSVQEGENVTINCNYSNQNSQGLQWFRQDPGKGLTLLFFLASGTKQEGRLKSTLSRTDRHSSLHIAASQPGDSATYLCADR
Notamacropus eugenii V436 iglv ABQO020980903.1 565 SFSQAMLTQSPSMSASLGATTRLTCTLSSQHSTNPIVWVQQSPGKSPRSIVAIASTGDATRNDGIPERFSGSGSGADRYLSISNIQSEDEADYYCLTAY
Notamacropus eugenii V437 trav ABQO020981017.1 1161 GSCQQKVEQNPPFLSVQEGEDIIINCTYSDKGSQNVQWYRQDPGKGPTLLFYLASGTKEEGRFKCLLNRNDRHSSLQITASQLGDSATYLCAAD
Notamacropus eugenii V440 igkv ABQO020986110.1 42 SRGDIVLTQSPASVSVAPGQRVTISCKASQSVKHSDGNTYLDWLQHKPGQSPRLLIYKVSNLGTGVPARFSGSGAEKDFTFTISSLEPEDGAVYYCSQGTSFP
Notamacropus eugenii V448 iglv ABQO020992855.1 2149 TIAQAVVSQEASLTVIPGGTVTMTCSSSTGAVTSGHYPHWFQQKSGQVPRLLIYSTNNLASGVPARFSESLTGDKASLTIKGAQAEDEADYYCML
Notamacropus eugenii V456 iglv ABQO021016882.1 13592 SGTSYVLTQPPSVSKSLGEMASISCVGDGIGGKYVKWFQQKPGQAPKLVIYTDSRRPSGIPDRFSGSNSGNMASLSISGLQAEDEADYYCLASSGIA
Notamacropus eugenii V460 ighv ABQO021020746.1 537 VHCDMRLVESGGEVRQPGGSLHLSFKACGFTFSSCHMHWVCQAPAKGLKRLSLIWSSSGTKYADSVKGRFTISRDNSSSMLHLQMNSIKAEDTVMYYCTR
Notamacropus eugenii V461 trav ABQO021023627.1 2135 TRCKSQVTQPISQEATEGQEVNLPCSHQDISTNMNIHWYRQFPNQGPQFLIQTYKTNVTSQMVSLTISPDRKSSTLNLPSVTLRDTAVYYCILQS
Notamacropus eugenii V466 igkv ABQO021041659.1 91 SRGEIVLTQSPASVSVAPGQRVTITCKASQSLKHSDGITYLYWLQQKPGQSPRPLIYLVSNLNAGVPARFSGSGAVKDFTLTISSLEPEDGAVYYCLQGISVP
Notamacropus eugenii V470 trav ABQO021045355.1 1432 AGVGAQKIHQWPATKLLKEGSQLFLECSTDVTSDPNLYWYHQPLDGNLQLLSYSINVDQAENSVPQRFLGFRSQKGHFQLSSKKLLVTDSGFYFCAWS
Notamacropus eugenii V471 ighv ABQO021047513.1 482 VHCDVQLVESGGDVRQPGGSLRLSCKGSGFTFSSNVYMHWIRQAPGKGLEWIAGISTNSGSTSYADSVKGRFTISVDSSNNMLYLQMNSLKAEDSGIYYCAR
Notamacropus eugenii V472 iglv ABQO021048779.1 1140 SGASNVLTQPPSVSKSLGQTASISCAGVGTSTYYVSWYQQKPGQAPKLVIYYDNSRPSGIPDRFSGAKSGNTATLSISGLQAEDEADYYCGQWSSSGA
Notamacropus eugenii V479 trav ABQO021075207.1 3194 GTGAQSVTQPEDQVTVSEGDLLELKCTYSYGATPSLFWYAQYPDQGLHLILKYISGSTLVKGIKGFEAEFNKSKTSFHLKKLSAQGSDSARYFCAVS
Notamacropus eugenii V484 trav ABQO021085765.1 2199 VTCLAKVEQSPQALKILEGEIAIINCTCTETINQGMQWFRQDPGKGIISLFVITVEKKQKGRLRAMINRNERHGSLYITDAKPEDSATYLCAVR
Notamacropus eugenii V489 trgv ABQO021098136.1 522 IELTQPEVSITKVLRRTARVTCQVSGSTDFASEYIHWYQQKPNQSLKHLLSVQSTRASTKMSLGDVSNKFVAGKNEDRRTSFLEINSITHEDEATYYCACWV
Notamacropus eugenii V491 trav ABQO021100779.1 1602 VSSQDEVKQSLLSLRVLAGESTTLNCSYKVGNFRGLQWYRQYPGKGPEFFFTLFSPGDEKRQGRLKASLNKKESFSSLHINDIQPEDLATYFCAVE
Notamacropus eugenii V517 ighv ABQO020041614.1 422 VHCDVQLVESGGDVRQPGGSLRLSCKASGFTFSNYYMYWIRQAPEKGLEWLSYISSSGGSTNYADSVKGRFTISRDNSNNMLYLQMNSLKVEDTAMYYCAR
Notamacropus eugenii V522 igkv ABQO020048660.1 3558 SQAAIVLTQTPSSLSVTPGDRVTINCKASSSVSSYMEWYQQKPGQSPKLLIYDASTLQSGVPARFSGSGSGTDFTLTISAMEAEDAATYFCFQWDSSPF
Notamacropus eugenii V524 iglv ABQO020055009.1 16133 SGASLVLTQPLSVSKSLGETASISCAGDGTLGNYVNWFQQKPGQAPKLVIYNVNRRPSGIPDRFSGAKSGNTATLSISGLQAEDEADYYCGQWSSSV
Notamacropus eugenii V534 igkv ABQO020066327.1 2552 SQAGVVLTQSPDSLSVAPGDRVTISCKASSSINKWMAWYQQKPGLSPKLLIYEASKMQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCYQYSSAPF
Notamacropus eugenii V535 igkv ABQO020069651.1 855 AQALIVLTQAPASLSVTLGDRGIISCKASSSVYNYLAWYQQKPGESPKLLIYAASTRASGVPDRFIGSGSGTDFTLTISAVQAEDAADYYCFQHYSAPF
Notamacropus eugenii V537 trdv ABQO020075167.1 958 ASTGEDIIQAQASTSVQEGETVTLNCKYETTQTSVTFFWYKQSPSGEMVLLIRQDSYNQKNAKMDRYSVILDKTEKSINLSISDSQLGDSAMYFCVLSD
Notamacropus eugenii V548 trav ABQO020098623.1 742 VSCQQKVEQSPQMLMVQERESITINCSYSDSAINNLQWFRQDSGKGLILLFYIASEGKQKGRLRSTINRKERHSSLHISDAQPEDSTTYLCAVE
Notamacropus eugenii V551 igkv ABQO020104407.1 1076 SRGDIVLTQSPASVSVTPGERVTINCKASQSVKKSDGNTYLRWLQQKPGQSPRGLIYEVSNLYSGVPARFNGSGAEKDFTLTISGMEAEDGAVYFCVQIPFTP
Notamacropus eugenii V553 igkv ABQO020111336.1 3726 VRGAIELTQSPASLPVSAGQTVTMSCKASQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSTFSGSGSGTDFSLKISNVETEDVAVYYCQQNSGWP
Notamacropus eugenii V558 iglv ABQO020125348.1 1682 TIAQAVVTQELSLTAIPGGTVTMTCSSSTGAVTSGHYPHWFQQKSGQVPRVLIYDTNNLVSGVPARFSGSLLGDKAALTIKGAQVEDEADYYCLLWYNNV
Notamacropus eugenii V559 iglv ABQO020125349.1 2057 TFAQAVVTQEPSLTVNPGGTVTMTCSSSTGAVTSGHYPDWLQQKSGQGPRLLMYNTNNLASGVPSRFSGSLLGDKYVLTIKGAQAEDEADYYCALWYSDA
Notamacropus eugenii V560 trbv ABQO020125762.1 2409 SGLGALISQQPNRAVWKKGSSAQIHCLQIDSELTFMYWYRQLPQESLELIATANQGGQNNYEKGFKASKFPISRPDKKSSALNVTDLDPKDNGIYFCSAS
Notamacropus eugenii V563 ighv ABQO020129493.1 723 VQCDVQLVESGGDVRQSGGSLRLSCKASGFTVSSYWMNWVRQAPGKGLEWVAAISSGSTYYADSVKGRFTISRDDGNSMLHLQMNSLNTGDTALYYCTT
Notamacropus eugenii V564 iglv ABQO020131360.1 821 SFSQPVVTQSPSMSASLGGTVKLTCTLSSQHSTYTIAWFQQSPGKSPRYIMYVGSSGGGNKGDGIPDRFSGSSSGADRYLSISNIQPEDEADYYCGYGYSNA
Notamacropus eugenii V565 trbv ABQO020131923.1 828 LLDDGITQTPKYLVTRKGAKVIFSCDPMKGHTWVYWYQQLLEQEITFLVYFQGSNPVDKSGMEKPGFSAQCPKNLPCELSIETSEPGDSGIYFCASSE
Notamacropus eugenii V570 ighv ABQO020149581.1 653 VQCDVQLVESGGDVRQPGGSLRLSCKTSGFTFSSTWMNWVRQAPGKGLEWVASINPDGSSIYYTDSVKGRFSISRDNGNSILYLQMNSLNTDDTALYYCAS
Notamacropus eugenii V576 igkv ABQO020166885.1 2557 ARGAVGLTQSPASLPVSAGETVTMSCRASQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSRFSGSGSGTDFSLKISNVEPEDAVVYYCHQSNYLP
Notamacropus eugenii V579 ighv ABQO020172271.1 7307 VHCDDQLVESGGDVRQPGGSLRLSCKVSGFTISSYYMSWIRQAPGKGLEWIAGISTNSGSTSYADSVKGRFTISRDNSNNMVYLQMNSLKAEDSGTYYCAR
Notamacropus eugenii V580 igkv ABQO020177425.1 4422 AQADIVLTQTPASLSVAPGDRVTITCKATSSIYNHMAWYKQKPGQTPKLLIYAASTLQSGVPARFSGSGSGTDYTFIIRAVETDDAADYYCFQHYSAPF
Notamacropus eugenii V586 iglv ABQO020193690.1 1423 SGASYVVTQPPSVSKSLRETASISCSGDGISDKYVNWYQQKPGQAQKLVIYSDNNRPSGIPDRFSGSNSGNTATLSISGLQAEDEADYYCLAWDSRSIA
Notamacropus eugenii V596 iglv ABQO020205313.1 3201 IIAQAVVTQEPSLTVIPGGTVTMTCSSSTGAVTSGHYPNWFQQKSGQSPRILIYSTNSLVSGVPARFSGSLLGNKAALTITGAQAEDEADYYCSLWYSGP
Notamacropus eugenii V607 trbv ABQO020226044.1 1130 PMDAKDARITQSPRHIVTRMGQKVILKCEQNLDHNAMYWYRQDQGQGRQLIYYSAVQGGIQKGDIPEGYNVTRKEKELFPLILNSCRTSQTSLYLCASSR
Notamacropus eugenii V608 trbv ABQO020236860.1 515 LGDAGVFQSPRSLVTERKKVVVLRCDPTKGHNYVYWYQQLPGQELTLSEYRDNNQVIHSSGMSKPQFSANWPSGSPYSLKIQPVELKDSALYFCASSL
Notamacropus eugenii V611 trav ABQO020246886.1 2068 AWGQIKVDQSPQVLRIQEGATATLECNWSSTVTYLQWFKQNPGEGPVSLFYIASGEKQAGRFSSKMNSKDRHSSLHITGSQRGDSASYLCAVL
Notamacropus eugenii V615 iglv ABQO020259279.1 5347 TIAQVVVTQESSLSVIPGGTISMTCRSSTGAVKSGQSAHWFQQKSGQVPRLLIYNTKSLLPGVPARFSGALTGDQAALTISGVQLEDEADYFCALQYDGS
Notamacropus eugenii V624 trgv ABQO020283202.1 5786 VELTQPQVSITKELKTTARVTCQMSGATNVASEYIRWYQQKPNESLQHLLFVQSTNVPEKISLGDVRNKFVAEKNEDRRTSFVAINSITHEDEATYYCAWWD
Notamacropus eugenii V638 trdv ABQO020320177.1 520 WSTAQTDTQSPPVVSVQEMGHVTLDCVYTTSYTTYYLYWYRQSPNGKLIYILHQYSESRNAKTGRYSVNLNKNAKSISLKISPSRLEDSGTYFCGYRT
Notamacropus eugenii V653 trdv ABQO020366462.1 747 WSTAQTVTQSPPAVSVQEMEAVNLDCVYTTSYTYYALYWYRQSPNGQLIFVLRQYSEYGNTETGRFSVNFNKNAKSISLKISPSLLEDSGTYFCGI
Notamacropus eugenii V654 igkv ABQO020367254.1 13317 ARGAILLTQSPASLSVSAGETVTMSCKATQSIGNNLHWYQQKPGQPPRLLIRDASTRPSGIPSRFGGSGSGTDFSLKISSVEAEDVAVYYCHQSYSWP
Notamacropus eugenii V655 igkv ABQO020367254.1 3626 VRGAIELTQSLVSLSVSVEQTVTMSCKVSQSVINYLHWHQQKPGQAPRLLIRYASTRPSGIPSRFSGSGSGTDFSLKISNVEAEDVALYYCQQSNSRP
Notamacropus eugenii V662 iglv ABQO020388106.1 4885 SGTSYVLTQPPSVSKSLGEMASISCVGDGIGGKYVKWFQQKPGQAPKLVIYTDSHRPSGIPDRFSGSNSGNMASLSISGRQAEDEADYYCLASSGIA
Notamacropus eugenii V666 trav ABQO020400062.1 984 VRGQDRLEQSPSTLSIQERENISLNCSYSVGTFNGLLWYRQYPGEGLALLFQLFSNGVVKNEGREKATLDKSKAHSSLFIMASQPGDSATYFCAIK
Notamacropus eugenii V668 trav ABQO020403590.1 1874 VSCQQKVTQSPPSLRVQEGESLTINCTYSESNPRSFQWYRQDPGKAPSFLFYMTSGRKQRGRFGSTTILKESHSSLYINASQLGDSAMYLCAVD
Notamacropus eugenii V687 trav ABQO020446766.1 3735 VSSQKVEQSTLPVTVQEDERCSLSCSYTSSFSNLQWYRQDPGKGLVFLILIRSNEKEKVREKFTARLDTSTRNSSLHLSACKPEDSAIYFCAVD
Notamacropus eugenii V699 iglv ABQO020470161.1 3509 SGASYVLTQPPSVSKSLGEMASISCTGDKIGSYAVQWYQQIPGQALKGVIYGTSSRPSGIPDRFSGSKSGNTATLSISGLQAEDEAEYYCKQWIGSD
Notamacropus eugenii V702 igkv ABQO020475019.1 4567 CQAAIVLTQTPDSLSVATGDRVTINCKASSSISNYMYWFQQKPGQSPTFLIYAASSRPSGVPARFSGSYSGTDFTFTISAVEAEDVADYYCMQDYSAPF
Notamacropus eugenii V704 iglv ABQO020479994.1 379 SGVSYVLTQPPSVSKSLGETASISCAGDGISSSSVQWYQQKSGQAPKLLIYWTNRRPSGIPERFSGSKSGNTATLSISGLQAEDEADYYCQVWDSNV
Notamacropus eugenii V708 trbv ABQO020487404.1 755 VHLDNRVIQHPRYLLSRTGHLVTLECDPISGQKSAYWYRQIRDQGPEMLFYFFDNTKSEEGNVSARFEANQENNLHFTLNISSLEKGDSALYLCASSK
Notamacropus eugenii V709 iglv ABQO020493749.1 2436 SLASYVLTQPPSKSVSLGQTASLTCAGDQLDKKYAYWFQQKWGQPPVLIIYKDKERPEGVSDRFSGSSSNNVATLTISRVQAEDEADYYCESEDDNTK
Notamacropus eugenii V710 ighv ABQO020498501.1 3263 SWAQVQLVESGGKVTHEGLSVTLTCRASGFNFKDFAMSWHWSPTANHRELVASISACSCNKEYSPKIQGRASINRDNVVQSVSLTLYQLQKEDSGKYYCARF
Notamacropus eugenii V711 trav ABQO020502315.1 1879 VSSQKVEQSTLPVMVQEDERCSLSCSFTSTISYLQWYRQDPGKGLVFLILIRSNEKEKVSEKFTATLDTSTRNSSLHLSVCKPEDSAIYFCAVD
Notamacropus eugenii V712 igkv ABQO020508216.1 1564 QAAIVMTQTPSSLSVAPGDRVTIKCKASSSISNYMVWFQQKPGQSPKCLIYAASTLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCLQWYNAPF
Notamacropus eugenii V713 iglv ABQO020514192.1 8215 TIAQAVVTQEPTLTVIPGGTVTMTCSSRTREVTTGHYSHWLQQKSGQVPRLLIHDTNNLASGVPARFSGSILGDKAALTIKGAQAEDEGDYYCALQYNGS
Notamacropus eugenii V715 trbv ABQO020520766.1 8841 LLDDGITQTPKYLVTRKGAKVIFSCDPIKGHTQVYWYQQLLEQGITFLVYFQGSNPVDKSGIEKRGLSAQCPQNSPCELSIETSEPGDSGIYFCASSD
Notamacropus eugenii V716 trbv ABQO020520766.1 7560 AQMDSRVIQHPSHLISRTGQSVTLGCDPISGHESTFWYRQILGQGLEMLFYFYDKRQNNKGEISDRFRAHQHDNFHFKLIINTSEEGDSALYLCASR
Notamacropus eugenii V720 igkv ABQO020529368.1 3988 ANGQIVVTQSPTSLSVTPGDTVTISCRASQDISKYLEWYQQKPGHSPKLLIYYTSNLHSGIPSRFRGSGSGTDYTLTISGVEADDVGVYYCMSYKNWH
Notamacropus eugenii V721 iglv ABQO020531951.1 1049 TFAQAVVTQEPSLTVIPGGTVTMTCSSSTGAVTSGHYPHWLQQKPGQVPRQLIYNTNNLASGVPARFSGSLLGDKAALTIKGAQAEHEADYYCMLWYNGP
Notamacropus eugenii V725 trav ABQO020538944.1 2349 VSSQEEVSQSPQSLTLQEGHHVGMNCTYKNSAFVYFLWYKQHSGKGPEFLMDICSNMNKKENGRVTILLNKGAQHLSLHITDAQSGDSGTYFCEAS
Notamacropus eugenii V729 igkv ABQO020543954.1 3131 SRGEIVLTQSPASVSVAPGQRVTITCKASQSLKDSDGITYLYWLQQKPGQSPRPLIYLVSNLNAGVPARFSGSGAAKDFTLTISSLEPEDGAVYYCLQGISVP
Notamacropus eugenii V734 igkv ABQO020566267.1 5483 YQAATVRTQTPASLSVAPGDRVTINCKASSSISNYMYWFQQKPGQSPKLLISAASSRPSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCLQWYNAPF
Notamacropus eugenii V737 igkv ABQO020578155.1 656 ANGQIVMTQSPTSLSVALGDTVTISCRASQDINKYLAWHQEKHGQSPKSLIYGTSNLHSGTPSWFSGSGSVTDYTLTISSVDAEDAGIYYCMQHKTFP
Notamacropus eugenii V743 igkv ABQO020589450.1 2520 ARGAIELTQSPASLSMTTGQKVTMSCKASQSISNSLHWYQQKPGQAPRLLIQYASTRPSGIPSKFSGSGSGTDFSLKISNVEAEDVAVYYCQHSYNLP
Notamacropus eugenii V744 trav ABQO020590412.1 3286 VRGKQTVEQSPPSLKVQEGDNVVFNCSYSDSASRGLQWFKQDLGKGLTSLFVMTSEGKERGRLRCTINRMERLSILYITASQPGDSGTYLCGA
Notamacropus eugenii V749 trgv ABQO020612009.1 6270 GQMAIVLEQKVISMTRNVGASATLTCEIFSPKFDNIHWYRYQEGRAPERLLRYSMSKSESVLDPGVSPEKIRAYKGKDNSCRLILSNLQLSDSGMYHCAIWDG
Notamacropus eugenii V751 trbv ABQO020616610.1 2347 LLDAGVTQTPTHLIREKGQNALFKCNPNKGHPYVYWYQQLLGKEFKFLIYFQNERKVDDSGMLNSRFSAACNSDLNCKIEIQPTELTDSAVYFCASSV
Notamacropus eugenii V761 trav ABQO020644207.1 1056 GTYGDSVNQTEGHIILLEGALLALNCSYQTNGAPYLFWYIQYPNEALKLFLRETSGKDQEKENNGFWTTKIKEKSSFYLEKTSVQMKDSAVYYCVLS
Notamacropus eugenii V763 igkv ABQO020646554.1 561 ARGAIGLTQSPASLSVSAGETVTMSCKATQSISNYLHWYQQKPGQAPRLLIQYASTLHSGVPARFSGSGSGTDFSLKISSVEAEDVAVYYCQHSYNLP
Notamacropus eugenii V765 igkv ABQO020650014.1 1329 SRGEIVLTQSPASVSVTPGDRVTISCKASQSVKHSNGYTYLSWLQKKPGQSPQGLIYRVANLYSGVPARFSGSGAEKDFTLTISSVEPEDGTDYYCAQLSFTS
Notamacropus eugenii V766 trav ABQO020650042.1 2262 PTETQSVTQPEDQASVSEGSPVELKCTYSYSGSPYLFWYVWYPNQELQVLLRHTSRESNKGFQANFSKAETSYHLWKPHVQEEDSAVYFCALS
Notamacropus eugenii V770 ighv ABQO020662481.1 4643 VQCDVQLVESGGDVRQPGGSLRLSCKVSGFTISSYWMSWVRQAPGKGLEWVAEIYRSGSTYYADSVKGRFTISRDNGNSMLYLQMDSLNTGDTPLYYCTR
Notamacropus eugenii V771 igkv ABQO020662745.1 3341 CQAAIVLTQTPSSLSVTPGDRVTINCKASSSVSSYMNWYQQKPGQSPKRLIYGASSLESGVPARFSGSGSGTDFTLTISAVEAEGVADYYCMQSNSYPF
Notamacropus eugenii V773 trav ABQO020666636.1 3126 GSCQQKVEQNPSFLSVQEGDDITINCTYSNQAFGNLQWFRQDPGKSLTLLFYLASGTKKEGRFKSMFNRNDRHSSLHITSSQLGDSATYLCAIL
Notamacropus eugenii V778 iglv ABQO020674941.1 3708 AWAQFVLTQPASASGSLGQSVTVSCTRSSGNIGSYYVQWYQQHQGQAPKLIIYDWNKRPSGIPERFSGTKDTSTNSASLTISDLQTEDEADYYCQSYDSSGN
Notamacropus eugenii V784 trav ABQO020691972.1 580 ATRAQSVTQPEDRVTISERESLELRCTASYTGSPRFFWYVQYPRQSLQLLLKYFSGNTLVRGSRDFEAEFNKSNKSFNLRKSSVEVSDAAVYFCAVS
Notamacropus eugenii V786 ighv ABQO020698262.1 1234 VQCDVQLVESGGDVRQPECSLCLSCKVSGFTFSNYYMHWVCHAPGKELECVPRISTSGSSTYYEDSVKDQFIISRDNGHSMLYLQMNSFNIDDTTLYYCT
Notamacropus eugenii V787 trbv ABQO020699253.1 4266 PTEAEITQTPRFLVKRVKQETTLSCHQDFNHDAMYWYQQEPQKEPKLMFYYYYQKMNLNESVPQRFNATSPGKNQLKLLIQGVETEDSATYFCSSSK
Notamacropus eugenii V791 trav ABQO020721395.1 725 GTFGDSVTQTEGPIILPEGEPLTLNCSYQTSGLNFLFWYVQYPGEALKILVHEESGKHQEKENNGFWTKKIRETSSFHLEKTSFQVGDSSVYYCVLR
Notamacropus eugenii V794 igkv ABQO020723808.1 1822 ASGQIVMTRSPTSLSVTPGDTVTISCRASQDIRKYLAWHQQKPGQSPKSLIYYTSNLFPGIPLRFRGSGSGTDYTLTIGPVEADDAEVYYCMQYKNWP
Notamacropus eugenii V800 ighv ABQO020732318.1 910 FWAQVQLVETGGQMIHEGQSLTLTCTASGLRFKDFAMSWHRSSGTGGSKEFVASITAGRGSTNEYREGMKGRAFIFRKNEANTVSLTLRQVQKEDSGIYYCAS
Notamacropus eugenii V807 ighv ABQO020753424.1 1504 VHCDVQLIESGGDVRQPGGSLRLSCKASGFTFSNYHMIWVRQAPGKGLEWISFISSNGGSTSYADSVKGRFTISRDNSNSMLHLQMNSLKTEDTAMYYCTT
Notamacropus eugenii V809 trbv ABQO020754802.1 2154 PTEAEISQIPRFLIRRVKQEVTLTCHQDLNHDAMYWYQQEPQKGPKLMFSFSYQEMSLNESVPQRFNATSPVKSLLKLLIQGVESEDSSTYFCSSSK
Notamacropus eugenii V811 trav ABQO020761140.1 844 VRSQEQVSQSPQSLTVQKGQHVSMNCTYKNSAFSYFPWYKQDSGKGPELLMDIRSNMNRKENGRVTILLNKGDQHLSLHITDAQPEDSGTYFCAAS
Notamacropus eugenii V814 trdv ABQO020771696.1 567 WSTAQTVTQSPPAVSVQEMEAVTLDCVYTTSDTYYYLYWYRQSPNGKLILILRQYSEDSNEETGRYYVNFKKEAKSISLNISPSRLEESGTYFCGYRS
Notamacropus eugenii V820 trdv ABQO020783314.1 837 WSTAQTVTQSPPAVSVQEMEAVTLDCVYTTSATYYDLYWYRQSPSAKLIYILSQDSESRNAKTGRYSVNFNKEAKSISLKISPSWLEDSGTYFCGYKL
Notamacropus eugenii V822 igkv ABQO020785471.1 1855 ASGQIVMTQSPTSLSVTPGDTVTISCKASQDISKYLAWHQQKHGQSPKSLIYYTSTLHSGIPSRFKGSGSGTDYTLTISPVEVDDAGVYYCMQYKNWP
Notamacropus eugenii V827 iglv ABQO020791935.1 1843 IIAQVVVTQEPSLSVIPGGTVTMTCSTSTEAVTSGHYPNWFQQKSGQSPRRLIYTTNNLVSGVPARFSGSLLGNKAALTITGAQAEDEADYYCTLWYNGP
Notamacropus eugenii V835 trav ABQO020805092.1 793 TVQGDWIASRQSYMSSEEGKNVILQCSYNSDSQYIYLHWYRLYVGQTLEFILLRGARSRKNIKHDADIAKKRFSSETTSDSTFLSISDLSLKDSAIYYCALEN
Notamacropus eugenii V838 trav ABQO020812608.1 466 GANGDSIAQTEGPVIISEGKSVTLNCTFKTTSIPFPFWYVQYPNKALQLLLRQSKENEEKVRNDFWDKKDREEKSFPLKMDFIQMKDTAVYYCAMN
Notamacropus eugenii V855 igkv ABQO020848468.1 394 ANGQIVMTQSPTSLSVTPGDTVTISCRASQDISKYLAWYQQKPGQSPKSLIYGTSNLYPGIPSRFKGSGSGTDYTLTISPVEADDVGVYYCIQQSNWP
Notamacropus eugenii V856 trav ABQO020853012.1 13733 GARSQNKVEQSPQLLNVKEGEDSYLKCSYKIIPFNNIRWYQQSPGKELVLLMLLTYFEAIKSNGRFKATLNATSEESFLHITSSQSEDSATYFCVAG
Notamacropus eugenii V857 trav ABQO020853012.1 5721 GTGAQSVTQPEDQVTVSEGDPLELKCTYSYELTVYLYWYVQYPDQGLQLILKYISGNTVVKGIKGFEAEFNKSKTSFHLKKFSAQGSDSARYFCAVS
Notamacropus eugenii V858 trav ABQO020853012.1 1411 GTGAQSVTQPEDQVTVSERDPLELKCTYSYGGTVYLFWYVQYPDQGLHLILKYISGSTLVKGIKGFEAEFNKSKTSFHLKKFSAQGSDSARYFCAVS
Notamacropus eugenii V862 trav ABQO020862837.1 580 ATRAQTVTQPEDRVTISERESLELRCTASYSGSPRFFWYVQYPRQSLQLLLKYFSGNTLVRGSRDFEAEFNRSNKSFNLRKSSVEVSDAAVYFCAVS
Notamacropus eugenii V873 iglv ABQO020888243.1 9520 SGASLVLTQPPSLSKSLGETASISCAGDGTLGNYVNWYQQKPGQAPKLVIYNVNRRPSGIPDRFSGAKSGNTATLSISGLQAEDEADYYCGQWSSSV
Notamacropus eugenii V879 trgv ABQO020916725.1 1770 ASMEPIVTQRIPSNTKRSGNTAFLECQVNVTLFGYAYIHWYRQKPGGRLERILYLSSNENVIHEDGVSEERYEAKKRESDFSASLRIHQVTEADGGLYYCACWD
Notamacropus eugenii V886 igkv ABQO020936379.1 607 SKGDIVLTQSPTSVSVTPGERVVITCKDSQSVKHSDGNTYLYWIQHKPGQSPRRLIYGASFLESGIPTRFSGSGAEKDFTLTISSLETEDLAVYYCSQGTSP
Notamacropus eugenii V900 ighv ABQO020964381.1 906 VHCDDQLVESGGDVRQPGGSLRLSCKASFTISYSYMSWIRQAPGKGLEWIAWIYANSGSTSYADSVKGRFTISVDSSNNMVYLQMNSLKAEDSGSYYCAR
Notamacropus eugenii V902 trgv ABQO020972274.1 3632 VQLTQPQVSISKEPGKTARVTCQVSNFTDCYSGYIYWYQQKQNQSLHHLLSVQSTSIPSKIPLGDVRNKFVAEKNENRRTSFLAINSITHEDEATYYCACWK
Notamacropus eugenii V909 ighv ABQO020990418.1 575 VHCDVQLVESGGDVRQPGGSLRLSCKGSGFTFSNAYMSWIRQAPGKGLEWIAAISANSGSTSYADSVKGRFTISRDNSNNMLYLQMNSLKAEDSGTYYCAR
Notamacropus eugenii V925 trav ABQO021037354.1 483 HLCRARFTQLSDKVAEEGADVELQCQHNIFGGDYDSVYWYLQKTNQKLIYVLHGFQDITEVGHYQINVDRKKRSSILVIRNVQISDMAVYYCAL
Notamacropus eugenii V932 ighv ABQO021062324.1 384 VHCDDQLVESGGDVRQPGGSLRLSCKASGITFSSYVYMSWIRQAPGKGLEWLSYISGNGGNANYADSVKGRFTISVDSSNNMVYLQMNSLKAEDSGPYYCAR
Notamacropus eugenii V933 igkv ABQO021064789.1 1563 ARGAILLTQSPASLSVSAGETLTMSCKATQSISNDLHWYQQKPGQAPRLLIKDASTHPSGIPSRFSGSGSGTDFSLKISSVEAEDVAVYYCHQSYNWP
Notamacropus eugenii V934 igkv ABQO021066207.1 3322 QAVTVMTQTPSSLSVAPGDRVTINCKASSSISKNIAWYQQKPGESPKLLIYYASYRQSGVPARFSGSGSGTDYTFTISAVEAEDVADYYCFHYSSTPF
Notamacropus eugenii V941 igkv ABQO021083335.1 1213 SQAAIVVMQSPSSLSVAPGDRVTINCKTSSSVSNDMDWYQQKPGESPKLLIYNANSLNSGVPARFSGSYSGTDFTFTISAVEAKDVAVYYCGQSYSYPF
Notamacropus eugenii V948 trav ABQO021101888.1 2319 ATRAQSVTQPEDRVTISERGSLELRCTASYTGSPEFFWYVQYPRQSLQLLLKYISGNTLVRGSRDFEAEFNKSNKSFNLRKSSVEVSDAAVYFCAVS
Notamacropus eugenii V950 igkv ABQO021104404.1 3193 SQAAIVVTQSPASLSVAPGDRVTINCKTSSSVSNYMNWYQQKPGESPKLLIYDANSLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCMHDYSAPL