WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Hipposideros armiger JXIK00000000.1 (JXIK01) 185 62 30 26 33 25 1 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Hipposideros armiger V212 trdv JXIK01000397.1 997207 THTQVVQVNDSMYGFIGTDVVLHCNFANPLPGVKITQVTWQKSTNGSKQNVAIYNPAMGVSVLAPYRERVEFLQPSFTDGTIRLSHLELEDEGVYICEF
Hipposideros armiger V232 trbv JXIK01000479.1 1402068 PLDTAVFQTPKYLVTQVGNKKSLRCEQKLNHNAMYWYKQDSKQLLKVMFLYNNKELIVNETVPSRFSPNSPDKAHLDLLINSLEPGDSAVYLCASSQ
Hipposideros armiger V233 trbv JXIK01000479.1 1415889 HTDTEVSQSPRHRVTERGQDVSLSCDPISGHTALYWYRQTLGQGPEFLMYFQNEKAVDTSGMPDDRFSAEKTQGSSFTLKIRRAEQRDSAVYLCASSL
Hipposideros armiger V234 trbv JXIK01000479.1 1418222 PVNAAITQTPRYRILQTGKKTTLECSQHMNHFAMYWYRQDPGQGPRLMYYSGGVNSTAKGDVTEGYSVSRNKNEHFTLILESASANQTSLYLCASSE
Hipposideros armiger V235 trbv JXIK01000479.1 1420359 PMDTGVTQIPKHLVMGMRSKKSLTCEQRLGHNAMYWYKQSAQKPPQLMFSYNYRELRENMTVPSRFSPECPDSSHLHLHVDALEPEDSAVYLCASSQ
Hipposideros armiger V236 trbv JXIK01000479.1 1430310 HTDVEVSQSPRHRVTEKGQNVSLSCEPISGHVGLYWYRQTLGQGLEFFIAFQNKEAVDTSGMPDDRFSAERTEGTEGSSSTLNIRHAEQRDSAVYLCASSL
Hipposideros armiger V237 trbv JXIK01000479.1 1433568 LVNAGVTQTPKFRILKTRQKVTLTCVQDMDHNCMYWYRQDPGHGLRLIYYSVSTSINKGDVPDGYSVSRSNTENFPLTLESATPSQTSVYFCASSD
Hipposideros armiger V318 trbv JXIK01001117.1 437 LTNAGVTQTPRHLVKRKGEKVLMECSQDMGHDRMYWYRQDPGLGLRLLHFSYGVDNHEKGDFPDGYSVSRKKKEGFSLTLKSASTNQTSVYLCASSL
Hipposideros armiger V319 trbv JXIK01001117.1 4499 YVFGVLVSQKPSRDICQGGTSVTIQCQVDSQVSLMLWYRQLPGQGLALIATANQGSEATYESGFTKDKFPISRPNLMFSILTVSNVSPEDSSSYFCSAE
Hipposideros armiger V330 igkv JXIK01001361.1 4519 VRCDIQMTQSPSSVSASVGDRVTINCRASQSASNYLAWYQQKPGAAPKFLIYGASNLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQSNSYP
Hipposideros armiger V331 igkv JXIK01001361.1 28104 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINSWLNWHQQKPGTAPKLLIYKATSLQTGVPSRFSGQQSGTDFTLTISNLQPEDVATYYCLQHNSYP
Hipposideros armiger V332 igkv JXIK01001361.1 37544 TSGEILMTQSPASLSLSPGERATVTCRASQSVSSYLAWYQQKPGQAPRLLIYSATTGASGIPAIFSGSGSGTDFTLTISSLEVEDAAVYYCQQGYIPK
Hipposideros armiger V333 igkv JXIK01001361.1 54550 ARTETIVTQSPALLSVALGDKVTITCKASQDIDDDMNWYQQKPGEAPLFIIREVTNFLPGVPSRFSSSGYGTDFTLTINNIEREDAAYYFCQKVIMCL
Hipposideros armiger V334 igkv JXIK01001361.1 78944 ARCDIQMTQSPSSLSVSVGDRVTINCRASQSISSWLHWYQQKPGAAPKLLIYAASNLQTGVPSRFSGQGSGTDYTLTISSLQPEDVATYYCQQGYSAP
Hipposideros armiger V335 igkv JXIK01001361.1 91620 ARCDIQMTQSQTSLSASVGDTVTITCRASQSISSWLAWHQQKPGTAPKNLIYRASNLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQYDSTP
Hipposideros armiger V336 igkv JXIK01001361.1 106651 ARCDIQMTQSQTSLSASVGDRVTITCRASQSISSWLAWYQQKPGAAPKLLIYKATNLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQYDKFP
Hipposideros armiger V337 igkv JXIK01001361.1 117363 ARCDIQVTQSPSSLSASVGDRITITCWASQSISNDIAWYQQKPGTAPKFLIYEASSLQTGISSRFSGQGSGTDFTLIISSLQPEDFATYYCQHYYSYP
Hipposideros armiger V338 igkv JXIK01001361.1 167684 ARCDIQMTQSQTSLSASVGDRVTITCRASQSIGGWLNWYQQKPGAAPKLLIYYASNLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQSSSNP
Hipposideros armiger V339 igkv JXIK01001361.1 195757 ARCDIQMTQSPTSLSVSVGDRVTINCRASQSIGSALHWYQQKPGAAPKLLIYYASSLHTGVPSRFSGQGSGTEFTLTISSLQPEDFGTYYCQQSYSAP
Hipposideros armiger V344 trav JXIK01001537.1 24351 VSRGENVNQRPPSLSVQEGSSSVMNCSYSDSASNYFPWYKQEGGKGPQLIISIRSVKDKTKDGRFTVLLNKTDKQLSLHIEATQPGDAAVYFCAAS
Hipposideros armiger V345 trav JXIK01001537.1 48301 RTHGDSVSQMEGQVTLSEGTSLNISCTFSATTYPTLFWYVQYPREGLQLLLKAVTDKDTIRNKGFEATYHKDSNSFHLEKASVHESDSAMYYCALS
Hipposideros armiger V346 trdv JXIK01001537.1 70546 SNIAQKVTQDQPAMLVQEKESVTLDCTYDTAVTTYYLFWYKQLKSGAMIFLIRQDSYNQQNATESCYYLNFQKAYNSVSLVISASQLEDSALYFCALGE
Hipposideros armiger V348 trav JXIK01001537.1 122661 GTRAQTVTQPDDHISVFEGAPVEVKCSYSYSGSPELFWYVQYPKQGLQLLLKHISRESIKGFTATLDKSGASFHLKKPSAQEEDSATYYCALR
Hipposideros armiger V349 trav JXIK01001537.1 142587 DTCGDSVNQTEGPVILPEGAFLTLSCTYQTSYSPLLYWYVQHQNKEPKLLLKSSSDNKVNIGGFQAHLVKDKSSFHLQKPSVQMSDSAVYYCALE
Hipposideros armiger V350 trav JXIK01001537.1 144710 SSMTQKVDQAQSAVSVVEKEAATLGCVYEAKSYTYYLFWYKQPPSGEMTFLIHQDSFDEQNKIEDQYSLNFQKSANSINLTITASQVGDSAVYFCALR
Hipposideros armiger V351 trav JXIK01001537.1 153652 GSSGDSVTQTEGSVILPEGASVFLNCNYQTSYSSPFLLWYVQYLNKAPQLLLKSISENQEAKHQDFEAKLVKSDSSFHLQKSSVQVSDSAVYYCALR
Hipposideros armiger V352 trav JXIK01001537.1 173624 VRGVQVEQSPPALSLQEGNSSTLQCKFSTSVNNVQWFRQNPGGALIRLFYIPSGKKVNERLTATTDPGERSSVLSISSLQTTDSAIYLCAVEAQCSP
Hipposideros armiger V353 iglv JXIK01001621.1 15278 SRTQSALTQPPSVSGSPGKSVTISCAGSSSDVGGYNEVSWYQQRPGTAPKLLIYDVTNRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYSSS
Hipposideros armiger V354 iglv JXIK01001621.1 24949 SWTQSALTQPPSVSGAPGKSVTISCAGSSSDVGGYNGVSWYQQRPGTVPKMLIYGVTNRPSGIPDRFSGSKSANTASLTISGLQPEDEADYYCCSIRSG
Hipposideros armiger V355 iglv JXIK01001621.1 26439 SWTQSALTQPPSVSGTPGKSVTISCAGSSSDVGGYNYVSWYQQRPGRAPKLLIYDVTNRPSGIPDRFSGSKSGNSASLTISGLQPEDEADYYCCSYRSG
Hipposideros armiger V356 iglv JXIK01001621.1 35625 SWTQSALTQPPSVSGDPGKSVTISCAGSSSDVGGYNRVSWYQQRPGTAPKLLIYDVTSRPSGIPDRFSGSKSGNTASLTISGFQAEGEADYYCCSYSSSVP
Hipposideros armiger V357 iglv JXIK01001621.1 49454 SWTQSALTQPASVSGAPGKSVTISCAGSSSDVGGYNSVSWYQQRPGTVPKLLIYGVTNRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYRSG
Hipposideros armiger V358 iglv JXIK01001621.1 53770 SWTQSALTQPASVSGAPGKSVTISCAGSSSDVGGYNYVSWYQQRPGTVPKLLIYDVTSRPSGIPDRFSGSKSGNRASLTISGLQAEDEANYYCCSYT
Hipposideros armiger V359 iglv JXIK01001621.1 79469 SWTQSALTQPPSVSGAPGKSVTISCAGSSSDVGGYNYVSWYQQRPGTAPKLLIYDVTNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYSSS
Hipposideros armiger V360 iglv JXIK01001621.1 93084 GSCQPVVTQQPSLTVTPGLTATLTCAMSTESSTSGNVPGWFLKKPGQASLQLIYQMNKLPASVPNRFSGSILGGRAVLTIAGAQPEDEAEYLCIVWYN
Hipposideros armiger V361 iglv JXIK01001621.1 113943 SVASSELTQSPSLSVAPGETARITCTGDFLEKRYTSWLQQKPGQAPVLVIYKDSERPSGIPDRFSGSSSGKTVTLTISGTQAEDEADYYCRSSPSDNT
Hipposideros armiger V362 iglv JXIK01001621.1 126896 SVASYVLTQQPSASVALRETARITCQGDSIEDYNVHWYQQKPGQAPVLVIYGDSNRPSEIPDRFSGSNSGNTATLVISGAQSEDEADYYCQVWDSGN
Hipposideros armiger V363 iglv JXIK01001621.1 142514 SAASYELTQPSSVSVTPGQTARITCGGNNIGSKNAYWYQQKPGQAPVLVIYGSSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQVWDSGN
Hipposideros armiger V365 trav JXIK01001668.1 5590 IMGDAKSTQPAAMESTEGQPVHLPCDHPKINAGDYIYWYRQTHNQGPEHVINSVKENKTNGMASLIIAAGRKSSTLVLPQVTLRDSAVYYCIVTD
Hipposideros armiger V366 trav JXIK01001668.1 45938 IMGDAKSTQPAAVESTEGQPVHLPCDHSTISGSDYIFWYRQIPHQGPEHVINSVKDNKTNEMASLIIATGRKSSTLILPQVTLRDSAVYYCIVTD
Hipposideros armiger V367 trav JXIK01001668.1 70284 IMGDAKSAQPDAMESTEGQPVHLPCDHSTISTNEYIYWYRQIHNQGPEYVIHGLKKNESNGIASLIITTDRKSSTLVLPQVTLRDSAVYYCIVR
Hipposideros armiger V368 trav JXIK01001668.1 77805 IMGDAKSTQPDAVESTEGQPVHLPCDHPKINTGDYIYWYRQTHNQGPEHVINSVKENKTNGMASLIIATGRKSSTLVLPQVTLRDSAVYYCIVTD
Hipposideros armiger V369 trdv JXIK01001668.1 94428 FCMAQKEAQAQRTVTVQEGGAVRMGCTYETRQTAYILYWYKQLPSGEMVFLLYQVYNKPNARKGRYSVNFQKVKKFISLTISPSQLADSAKYFCALWE
Hipposideros armiger V370 trav JXIK01001668.1 102833 IMGDAKSTQPDAMESTEGQPVHLPCDHPKISTNEFITWYRQIPHQGPEHVINGVKDNKTNEMATLVITTGRKSSTLILPQVTLRDSAVYYCIVRD
Hipposideros armiger V371 trav JXIK01001668.1 117177 SGRAKWIRPQETEVSGTEGKSENLLCDYGTSSKKYVDLYWFRQYPNQALEYILYRGWGYTAKGDASFATEKFYSKSTANATNLYIRNLEPADTALYHCALRE
Hipposideros armiger V372 trdv JXIK01001668.1 137537 SSVAQTVTQPHPEMSVWEAETVTLACTYATSDSNYYLFWYKQPPNGEMIVIIRQESYKQQNATEDCFSVNFQKASESFSLRISDCQLEDAAMYFCAFSG
Hipposideros armiger V373 iglv JXIK01001687.1 19960 TTSQATVTQEASLSTSPGGTVTLTCGSSTGTVTSSNYASWIQQNPYQVPRGLIGGTNNRVPGVPARFSGSLLEDKDALTITGAQPKDEAEYYCALWYSNH
Hipposideros armiger V374 iglv JXIK01001687.1 108640 SWTQSALTQPRSVSGSPGKSVTISCAGSSSDVGGYNLVSWYQQLPGTVPKLLTCGVTNRPSGIPDSKSGNTASVTISGLQVEDEADYYCCSITSG
Hipposideros armiger V375 iglv JXIK01001687.1 114629 SWTQSALTQPPSVSGAPGKSVTISCAGSSSDVGGYNEVSWYQQRPGTAPKLLIYGVTSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGNNK
Hipposideros armiger V376 iglv JXIK01001687.1 125896 SWTQSALTQPGSVSGAPGKSVTISCAGSSSDVGGYNDVSWYQQRPGTAPKLLIYDVTNRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSIRSG
Hipposideros armiger V378 igkv JXIK01001744.1 20046 ARCDIQMTQSPSSVSASVGDRVTINCQASQSISNNLAWYQQKPGTPPKLLIYYASSLQTGVPSRFSGQGSGTEFTLTISSLQPEDFATYYCQQRQSF
Hipposideros armiger V379 igkv JXIK01001744.1 49570 VRCDIQMTQSPSSRSASVGDSVTITCRASQSISNYLNWYQQKPGAAPKLLIYGASSLQTGVTSRFSGQGYGTGFTLTISNLQPEDVGTYYCQQYDSTP
Hipposideros armiger V380 igkv JXIK01001744.1 69940 ARCDIQMTQSPSSRSASVGESVTITCRASQSISNYLAWYQQKPGTAPKLLIYAASSLQTGIPSRFSGKGSGTDFTLTISSLQPEDVATYYCQHYYSTP
Hipposideros armiger V381 igkv JXIK01001744.1 86053 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINSWLNWHQQKPGTAPKLLIYKATSLQTGVPSRFSGQQSGTDFTLTISSLQPEDVGTYYCQQYDSTP
Hipposideros armiger V384 trbv JXIK01001844.1 604 SVDAGVTQSPTHLIKRRDGKAVLICHPMSGHDTVSWYQQAQGQGLQFLIQYYEKEERERGNIPDRFSAQQFNNYSSELTMNNLQLEDSAVYLCASSL
Hipposideros armiger V385 trbv JXIK01001844.1 7717 HTDTEVSQSPRHRVTERGQNVSLSCDPKSGHTALYWYRQTLGQGPEFLTYFRNEEALDTSGMPDDRFSAEKTQGSSFTLKIRRAEQRDSAVYLCASSL
Hipposideros armiger V386 trbv JXIK01001844.1 39909 SVDAGVTQSPTHLIKRRDGKAVLICHPMSGHDTVSWYQQAQGQGLQFLIQYYEKEERERGNIPDRFSAQQFNNYSSELTMNNLQLEDSAVYLCASSL
Hipposideros armiger V387 trbv JXIK01001844.1 44424 HTDSGITQSPRHKVTGTGKEVTLRCHQTENHSYMYWYRQDPGHGLRLIHYSITKGSTDQGDVPDGYSVSRSETENFPLTLESATPSQTSVYFCASSD
Hipposideros armiger V388 trbv JXIK01001844.1 45999 SVDVGVTQSPRHLIKRREGKAVLTCHPMSGHNTVSWYQQAQGQGPQFLIQYYEKEEREKGNIPDRFSAQQFNNYSSELTMNNLQLEDSAVYLCASSL
Hipposideros armiger V389 trbv JXIK01001844.1 52102 HMDAGITQSPRHKVTGTGKEVTLRCHQTDNHNSMYWYRQDSGHGLRLIYYSITKGSTDKGDVPDGYSVSRSETENFPLTLESATLSQTSVYFCASSD
Hipposideros armiger V390 trbv JXIK01001844.1 62717 ATDAAGVTQTPRHKVTKTGQAITLSCEPMKTHTYLYWYRQTSVQGPELLIYFSSQAPVDDSGMPKERFKAQMPNGSYSTLKIQPTEAEDSAVYLCASSL
Hipposideros armiger V391 trbv JXIK01001844.1 65385 PTDAAGVTQTPRHKVTKMGQAVTLTCEPMSGHTDLFWYRQTPVQGLELLIYFSNQVTMDDSGMPKERFKAQMHNGALSTVTIQPAEAGDSAVYLCASSL
Hipposideros armiger V392 trbv JXIK01001844.1 66817 PTDAAGVTQTPRHKVTKMGQAVTLTCEPMSGHTDLFWYRQTSMQEPKFLIYFRNQSPVDDSGMPKERFKAQMPNGALSTLKIQSTEAGDSAVYLCASSL
Hipposideros armiger V393 trav JXIK01001844.1 72490 HISAGVTQSPSHRIIEKGQATTLRCDPISGHESLLWYQRAAGKEIKFLIRFLQDSIQDKSGIPNDRLLAERTEGTYSTLKFQTAQLEDSAVYFCACSV
Hipposideros armiger V394 trbv JXIK01001844.1 74660 PMGATVTQNPRYQVTRIGKPVTLNCSQHLNHDTMYWYQQKLSQAPKLLFYYYDQELTNETGTSDNFQPSRVNDSFCSLDIRSPGVGDSAVYLCASSR
Hipposideros armiger V395 trbv JXIK01001844.1 77540 ALDADVTQTPGHLITGKGQNVTMKCVPKKGHDYVYWYQQILAKEFKFLVSFQYQNVYETALPGKRFSAKCPQNSPCSLEIQDMELQDSAIYLCASSE
Hipposideros armiger V396 trbv JXIK01001844.1 84539 PTSASTTQNPRQLVMGRGQEAMLRCNPIKNHNYVYWYRQLPGEGLKFMISLRKEEIMDESEMPTKRFSAEFPKEGPSVFKIQLAELGDSAVYFCASSL
Hipposideros armiger V397 trbv JXIK01001844.1 86239 HTDPGVSQTPSHRITEMGQGVTLQCDPISGHIFLYWYRQNLTQEMEFLISFQYQNTAVKSGMPKERFSAERPTGTYSTLKIQPTELGDSALYLCASAGI
Hipposideros armiger V398 trbv JXIK01001844.1 89721 SGLTASVSQYPSRAICTSGTSVEIQCRPVDLQATTMFWYRQFPKQGLILIATSNTGSSAKYEQGFTEAKFPISHPDVTFSSLTVASVHPEDSSLYFCGAS
Hipposideros armiger V399 iglv JXIK01001845.1 43357 FAASYEVTQPPTMSVSLGQTARITCGGNNIGSKVVHWYQQKPGQAPVLVIYGDSNRPSGIPDRFSGSNSGNTATLTISGVQAEDEADYYCQAIDSSSN
Hipposideros armiger V402 ighv JXIK01001905.1 4106 VQGEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSYMSWVRQTPGKGLQWVPTIRSDGSNTYYADSVKGRFTISRDNTKNTLYLQMTSLRAEDMAVYYCAR
Hipposideros armiger V404 iglv JXIK01001931.1 26173 FAASYEVTQPPTMSVSLGQTARITCGGNNIGSKVVNWYQQKPGQAPVLVIYVDSNRPSGIPDRFSGSNSGNTATLTISGVQAEDEADYYCQAIDSSSN
Hipposideros armiger V405 iglv JXIK01001931.1 31132 FAASYEVTQPPTMSVSLAQTARITCGGNNIGDIYTQWYQQKPGQAPVLVIYGDSERPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSGN
Hipposideros armiger V406 iglv JXIK01001931.1 62130 FAASYELTQPSSMSVALGQTARITCGGNNIGSKYTHWYQQKPGQAPVQVIYENSKRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSDK
Hipposideros armiger V408 trav JXIK01001969.1 10936 VSRGENVNQHPPSLSVQEGSSCVMNCSYSDSASDYFPWYKQEAGKGPQLIISIRSHQVITKDGRFTVLLNKEAKQLSLHIEATQPGDAAVYFCAAR
Hipposideros armiger V409 trav JXIK01001986.1 8785 ASSASNVEQSPQSLPVQEGKSTNFTCRFPSSAFYALHWYRWEPAKSPKILFVITLDGDEKKEGRVRATLDTKRGYSYLYIEGSQPEDSATYLCAS
Hipposideros armiger V410 trav JXIK01001986.1 18015 VNGQQLKQIPQFLLLQEGQNFTTYCNSSTTFNSLQWYMQSPGGSPVLLMILVKSGDVVKQNRLIAQFGEARKDSSLQITGAQTTDIGTYFCAE
Hipposideros armiger V411 trav JXIK01001986.1 26483 GTRAQSVTQPAGPITVSERASLELKCNYTYGGTVYLFWYVQYPSQSLQLLLKNVAGNTLVNGIKDFKAEFKKSETSFYLRKSSAHWSDSGVYFCAVS
Hipposideros armiger V412 trav JXIK01001986.1 30873 KSTQQLEQSPRFVSIQEGEDVTVYCKSSSVFSTFQWYRQEPGKGPVLLMILTKGGDVKVQKRLTARLGEARKDSSLLITAAQPGDVGTYLCAG
Hipposideros armiger V413 trav JXIK01001986.1 48406 VRSQEVQQSPQTLISQEGRDVTITCNSSKTLYSLHWYLQKPGEGPVILIILRQGGEDKNHDKLVATFNENKKQSSLYIMASQPRHSGTYFCGAE
Hipposideros armiger V414 trav JXIK01001986.1 65097 IMGDAKSTQPDAMESTEGQPVHLPCDHPKISTNEFIHWYRQIHNQGPQYVIHGLKKNESNGMASLIITTDRKSSTLILPQVTLRDSAVYYCIVTD
Hipposideros armiger V415 ighv JXIK01002000.1 8427 VHSEVQLVQPGAEVRKPGASVKVSCNASGYTFTSYWMHWVRQAPGQGLEWMGRIYPSSGGTDYAQKFQGRVTMTADTSTSTAYMELSSLRSEDTAVYYCAK
Hipposideros armiger V416 ighv JXIK01002000.1 33390 VLAQVTLQESGSGLLRPSQTLTLTCSFSGFSLSTSGMGVGWVRQPTGKTLEWLAEIWWNDVKNYSPSLKSRLTISKDTSKNQVVLTMTSMDPADTATYYCARR
Hipposideros armiger V418 ighv JXIK01002123.1 12025 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYHVHWIRQAPGKGLQWVGAMWNDGSTNYNPALKSRLSITRETSKSQVYLTLKSLTAEDMAVYYCAR
Hipposideros armiger V421 igkv JXIK01002167.1 14547 ARCDIQMTHSQTSLSASVGDTVTITCRASQSISTNLAWYQQKPGTAPKRLIYYASSLQTGVPSRFSGKASGTEFTLTISSLQPEDVATYYCQQHYSTP
Hipposideros armiger V422 iglv JXIK01002192.1 7638 SVASYQLTQSPSLSVAPGETARITCSGDLLDKKYTHWFQQKPGQAPVRVIYNDRERPSGIPDRFSGSSSGKTATLTISGTQAEDEADYYCLSSNSDGT
Hipposideros armiger V423 ighv JXIK01002201.1 4277 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYYWNWIRQSPGKGLEWMGYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V425 ighv JXIK01002201.1 11336 VHSEVQLVQPGAEVRKSGASVKVSCKASGYTFTGYYMSWVRQAPGQGLEWMGRIDPSDSYTNYAQKFQGRVTMTADKSTSKAYMELSSLRPEDTAMYYCAR
Hipposideros armiger V426 ighv JXIK01002201.1 16733 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTGYWVNWVRQAPGQGLEWIGAINPLSGATNYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V427 ighv JXIK01002204.1 18618 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSAISGDGSSYIYYADSVKGRFTISRDNGKNTLYLQMTSLRAEDTAVYYCAR
Hipposideros armiger V428 trdv JXIK01002250.1 22153 PNIAQKVTQDQPAMLVQEKGTVTLDCTYDTSDVTYSLFWYKQLSTGAMIFLIRQDSYSQQNATEGRYSLNFQKAYKSANLVISASQLEDSALYFCALRG
Hipposideros armiger V429 trav JXIK01002250.1 27930 RTHGDSVSQMEGQVTLSEGAPLNVSCSYETTRYPVLFWYIQYPGEGPQLLLKATKASETGRNKGFEATYHKDPNSFHLEKSSVHESDSAMYYCALS
Hipposideros armiger V430 ighv JXIK01002305.1 11589 VLSAVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYDWNWIRQPPGKGLEWIGYINSAGNTGYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDMAMYYCAR
Hipposideros armiger V431 ighv JXIK01002345.1 3535 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYIMNWVRQAPGQGLEWMGRIDPEDSSTSYAQKFQGRVTMTADTSTSTAYMELSSLRAEDTAVYYCAR
Hipposideros armiger V432 ighv JXIK01002369.1 11939 VHSEVQLVQPGAEVRKPGASVKVSCKPSRYTFTDYYMSWVRQAPGQGLEWMGYINPSSGGTRYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V433 trav JXIK01002384.1 4459 VRGVQVEQSPPALSLQEGNSSMLQCKFSTSVNNVQWFRQNPGGALIRLFYIPSGKKVNERLTATTDLGERSSVLSISSLQTTDSAIYLCAVEAQCSP
Hipposideros armiger V434 iglv JXIK01002409.1 4452 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQIPGRAPRMLIYNTNSRPSGVPDHFSGSISGNKAALTITGAQAEDEADYYCALDMGRYT
Hipposideros armiger V435 ighv JXIK01002500.1 1382 VHSEIQLVQPGAEVRKPGASVKVSCKASGYTFTGYWMHWVRQAPGQGLECMGFSNTNTEKPTYAQGFSDRFVFSLDTAVSTAYLHINSLRPEDTAVYYCA
Hipposideros armiger V436 ighv JXIK01002500.1 8530 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGAIDPGDGDTRYAQKFQGRVTITADTSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V438 iglv JXIK01002572.1 8928 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSKYPSWFQQTPGRAPQMLIYNTNNRPSGVPDRFSGSISGNKAALTITGAQAEDEADYYCALYMGSGI
Hipposideros armiger V439 iglv JXIK01002572.1 12960 GGDSGALTNMSPGGTVTLTCGSSTGTVTSGHYPYWFQQKSGQVPRTLIYNTNSKHSWTPAQFSGSITGGKAALTLSGAQPEDEAEYYCWLLYSGA
Hipposideros armiger V440 ighv JXIK01002596.1 4680 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWVRQAPGKRLEWVGVVWSGGSTDYNSALKSRLSITRETSKSQVYLTLKSLTAEDTAVYYCVR
Hipposideros armiger V441 trbv JXIK01002768.1 5340 HMDAGITQSPRYKVTGTGKEVTLRCLQTENHNYMYWYRQDPGHGLRLIYYSATKGSTDKGDVPDGYSVSRSKIENFPLTLESATPYQTSVYFCASSD
Hipposideros armiger V442 iglv JXIK01002808.1 2943 SWAQSVLTQPPSVSRAPGQSVTISCAGSSSNIGGNSVQWYQQLPGKAPKLLIYGDDERPSGVSNRFSGSKSGNSASLTISGLQAEDEADYYCESYDDSLSG
Hipposideros armiger V443 iglv JXIK01002808.1 7830 SWAQSVLTQPPSVSGAPGQSVTISCTGSSSNIGSNYVSWYQQLPGAAPKLLIYDNSKRPSGISNRFSGSKSGNSASLTISGLQAEDEADYYCFSWDSSLS
Hipposideros armiger V444 iglv JXIK01002985.1 11040 FTASYEVTQPPTMSVSLGQTARITCGGNNIGSKDVNWYQQKPGQAPVLVIYYSSNRPSGIPDRFSGSNSGNTATLTISGAQPEDEADYYCQVWDSSGK
Hipposideros armiger V445 trav JXIK01003768.1 6003 VNGLQLNQIPQFLLLQEGQNFTTYCNSSTAFNSLQWYKQSPGGSPVLLMILFKPGEVVKKKRLIAWFGQTRKDSSLHIMGAQTADVGTYFCAE
Hipposideros armiger V446 trav JXIK01004701.1 226 GTRAQSVTQPAGPITVSERASLELKCNYTYGASVSLFWYVQYPSQSLQLLLKNVAGNTLVNGIKDFKAEFKKSETSFYLRKSSAHWSDSGVYFCAVS
Hipposideros armiger V447 trbv JXIK01004868.1 178 HMDAGITQSPRYKVTGTGKEVTLRCLQTENHSYMYWYRQDPGHGLRLIYYSVGTSINKGDVPNGYSVSRSNTENFLLTLESATLSQTSVYFCASSD
Hipposideros armiger V448 ighv JXIK01005194.1 32 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWIRQAPGKGLEWVAYISNGGGSSTYYPDSVKGRFTISRDNAKNTLYLQMTSLRAEDTAVYYCAR
Hipposideros armiger V695 trdv JXIK01000386.1 1736467 VSLDIILEPDTKTLTVLVGQPATFRCSITGADLKNYQMSWYKKNEDNSLTLVYRLSNSSSDNLRSNFKGKIDVLKSQYILDIPKATTKDAGTYYCGSD
Hipposideros armiger V696 trdv JXIK01000386.1 1716889 ATAALVLVPQDQAVTVSVGESATFRCSMEGGTFTNYYYNWYRKTQDSTMAFIYRDGGLYGPGFQNRFRSQIDASDNQAVLEILKASEKDEGFYYCACD
Hipposideros armiger V716 iglv JXIK01000444.1 714780 PQPALTQPDALLVFPGQVAQLSCMLSPRHATIGKYGVSWYQQRAGSAPRYLFYYRSEEDHHRPPDIPDRFSAANDEVHNACILTISPVQPEDDADYYCSVG
Hipposideros armiger V771 trav JXIK01000808.1 169633 IAGQGVQQPAELMAMAGASVQVNCTYQTSGFNGLFWYQQHDGRSPICISYNVLDGFERRGHRFSSFLSHSHAYSYLLVKDLQMKDSASYLCAVI
Hipposideros armiger V772 trav JXIK01000808.1 117688 GLRAQSVIQPDDQVTVTEGEPLTVKCTYSFSGTPYLFWYVQYPNQGLQFLLKYIPGNDPVKRGFGFVAEFNKSQTSFHLTKPSALGSDSAVYFCAGT
Hipposideros armiger V773 trav JXIK01000808.1 107274 TLSFAKTTQPIFIDSYEGQEVNIACNHTNIATNDYILWYRQFPNQGPQFIIQGYKTNTTNEVASLFILADRQFSMLSMPYASLRDTAVYYCIVS
Hipposideros armiger V774 trav JXIK01000808.1 99471 VSSQRTEQNPLHLSIQGGEKAILTCTFANYSPAFLQWYRQDLGRGLVFLLLIRENERKKQAGRLRATFDTTIKQSSFHIAASQPADSATYFCAA
Hipposideros armiger V775 trav JXIK01000808.1 87753 DTRAQTVIQPDNHITISEGALLELKCKYVYGATPTLFWYVQYPSQGPLLLLKYYAGDTLVKGIKDFEAELRTNETSFTLRKHFAHWSDSAEYFCAVS
Hipposideros armiger V776 trav JXIK01000808.1 67427 DTRAQTVTQPDSYFTVSEGDSLELRCKYSYIGVTYLFWYVQYPSQGPQLLLKYYAGDTLVKGIKDFEAEIKEDESSFNLRKSLAHLRDSAVYFCVLS
Hipposideros armiger V777 trav JXIK01000808.1 28495 RTHGDSVSQTEDEVTLSEGASLNVSCTYSAAGYPNLLWYVQYRGEGPRLLLKATKAGEKGHNKDFEATYNKVSNSFHLEKASVQESDSAMYYCALR
Hipposideros armiger V798 trbv JXIK01001117.1 52445 VRAQTIHQWPPTRVQVVGSPLSLKCTVEGTSNPSLYWYQQAAGGALQLLFYSFGAGQVNSEGTHSFTATRPEDGQFILTSEKLLLSDSGFYLCAWS
Hipposideros armiger V806 igkv JXIK01001220.1 184482 TTGEIVMTQSPTSLSLSPGERATLTCRASQSVGSNLAWYQQKPGQAPRLLIYSATTRASGIPARFSGSGSGTDFTLTISNLEPEDFAIYYCQQYNSGY
Hipposideros armiger V807 igkv JXIK01001220.1 155960 ARCDIQMTQSPSSLSASVGDRVTINCRASQSISSYLNWYQQKPGTAPKLLIYRASSLHTGVPSRFSGQGSGTDFTLTISSLQYEDVATYYCQQYQSWP
Hipposideros armiger V808 igkv JXIK01001220.1 139054 AKCDIQMTQSPSSRSASVGDRVTITCRASQSINNYLSWYQQKPGTAPKLLIYYASSLQTGVPSRFSGQGSGTDFTLTISSLQPEDAATYYCQQYQSYP
Hipposideros armiger V809 igkv JXIK01001220.1 109476 ARCDIQMTQSPSSLSASVGDRVTITCRASQSIGNNLAWHQQKPGTAPKRLIYKASTLDTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQYENWP
Hipposideros armiger V810 igkv JXIK01001220.1 47756 ASGNTVLTQSPVLLSVSLRESTSIICRASQSISDYLSWYQQRPGQAPKLLIYDADDRFSGVSDRFTGIQSGTEFILTISKVKADDVATYYCQQDYMVP
Hipposideros armiger V811 igkv JXIK01001220.1 34286 ARCDVQMTQSPSSLSASLGDRVTITCQASQSISNELNWYQQKPGTSPKLLIYRASSLHTGVPSRFSGQGSGTDYTLTISSLQPEDFATYYCQQDSSWP
Hipposideros armiger V812 igkv JXIK01001220.1 9874 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLAWYQQKSGAAPKLLIYDASNLQTGVPSRFSGQGSGTDFTLTISSLQPEDFATYYCQQRNSWP
Hipposideros armiger V825 ighv JXIK01001665.1 132459 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITTSGYCWGWIRQPPGKGLEWIGDICANDNTNYSPSQKSRTSICRDTSKNQFSLQLSSVTTEDTAMYYCVR
Hipposideros armiger V828 iglv JXIK01001764.1 3529 LVTSYEQIQPTFMSVAQGQTARFTCGGNNIGRKHVHWYQQEPGQAPIQVIYATSNRHSGIPDQFSGSNLGNTATLTISGAQAKDENDYYCQVWDSSDK
Hipposideros armiger V830 igkv JXIK01001817.1 66969 ARCDIQMTQSPSSLSASVGDRVNITCRASQSIGTELDWYQQKPGTAPKLLIYHVSNLHTGVPSRFSGQGSGTDFTLTISNLQPEDYAIYYCQQDYSTP
Hipposideros armiger V831 igkv JXIK01001817.1 48063 ARCDIQMTQSTSSLSASVGDRVTITCRASQSISSYLNWYQQKPGAAPKLLIYKATNLQTGVPSRFSGQGSGTDFTLTISNLQPEDYAIYYCQQGYSTP
Hipposideros armiger V832 igkv JXIK01001817.1 19651 ARCDIQMTQSTSSMSASVGDRVTITCRASQSISTNLAWYQQKPGTAPKLLIYGASSLQTGVPSRFSGQGSGTDFTLTISSLQPEDFATYYCKQYQSFP
Hipposideros armiger V833 igkv JXIK01001817.1 11028 ARCDIQMTQSPSSRSASVGDSVTITCRASQSINNYLNWYQQKPGTVPKLLIYAASSLHTGVPSRFSGQGSGTDFTLTISSLQPEDVGTYYCQQYKSWP
Hipposideros armiger V834 iglv JXIK01001819.1 19392 SWAEFVLTQPCSVSGSPEQKITISCTYNSGNVGNRYVYWYQQHMGSAPTTVIYADKKRLSRVPDWFSGSIDSSSNAAYLKISELQPEDEANYYCQSYDSNY
Hipposideros armiger V835 ighv JXIK01001822.1 80309 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTDYYMSWVRQAPGQGLEWMGYIYPGSSSTNYAQKFQGRVTMTADTSTSTAYMELSSLRSEDTAVYYCA
Hipposideros armiger V836 ighv JXIK01001822.1 40965 VLSQVQLQESGPGLVKPAQTLSLTCTVSGFSITSGYYWSWIRQPLGKGLEWIGSIAYEGSTAYSPSLKSRTSISRDRSKNQFSLQLSSVTSKDMTVYYCAR
Hipposideros armiger V837 ighv JXIK01001822.1 31323 ALAQVTLQESGPGLLRPSQTLTLTCSFSGFSLSTTGMGVGWVRQPPGKTLEWLAHIWWNDNKYYSPSLKSRLTISKDTSRNQVVLTMTSMDPADTATYYCAR
Hipposideros armiger V838 ighv JXIK01001822.1 27370 VQCEVQLVESGEGLVQPGGSLRLSCAASGFTFSIYWMSWVRQAPGKGLEWVSSISGDGSSYIYYADSVKGRFTISRDNAKNMLYLQMTSMRAKDTAVYYCAR
Hipposideros armiger V839 ighv JXIK01001822.1 19426 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGRIYPITGGTSYAQKFQGRVTITADTSTNTAYVELSSLRPEDTAVYYCAR
Hipposideros armiger V840 ighv JXIK01001822.1 8647 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITSGYGWNWIRQPPRKGLEWIGYINNAGSTGYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Hipposideros armiger V841 ighv JXIK01001824.1 63044 VLSQVQLQQWGPGLVTPSQTLSLTCTVSGYSVTSGHEWSWIRQPPGKGLEWIGDISCSGNTAYNPFLKSRTSISRDTSKNQFSVQLSSVTSKDMAVYYCVR
Hipposideros armiger V842 ighv JXIK01001824.1 14188 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSYISSGGGSTYYPDSVKGRFTISRDNAKNMLYLQMTSLKAEDTAVYYCAR
Hipposideros armiger V843 ighv JXIK01001824.1 7834 VQCEVQLVESGGSLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVSYISSDGSSYIYYADSVKGRFTISRDNAKNTLYLQMTSLRAEDTAVYYCAR
Hipposideros armiger V844 ighv JXIK01001824.1 4000 VLSQVQLQESGPGLVKPLQTLSLTCTVSGFSLTSYGVHWVRQAPGKALEWVGTMWGGGSTDYNPALKSRLSITRETSKSQVYLTLKSLTAEDTAVYYCAR
Hipposideros armiger V846 ighv JXIK01001905.1 90516 VLSQVQLQESGTGLVKPSQTLSLTCTVSGFSLTSYSVHWVRQAPGKRLEWVGVVWSGGSTDYNSALKSRLSITRETSKSQVYLTLKSLTAEDTAVYYCAR
Hipposideros armiger V847 ighv JXIK01001905.1 87390 VLSQVQLQESGPGLVKPSQTLSLICTVSGFSITTSGYCWYWIRQPPGKGLEWIGRTCASGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V848 ighv JXIK01001905.1 39420 LSQVQLQESGPGLVKPSQSLSLTCTVSGYSITSGYYWSWIRQPPGKGLEWIGRISYSGSTAYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDTAVYYCAR
Hipposideros armiger V849 ighv JXIK01001905.1 35358 VLSQEKLKQWGSGLVKPSQTLSLTCADYEVSITTSGYRWHWIRQPLGKRMEWIGCICNNGDTYYSPSLKSRTSISRDTSKNQFSLQLSSVTSEDTAVYYCSR
Hipposideros armiger V850 ighv JXIK01001905.1 28960 VQCEVQLVESGGGLVQPGGSLQLSCAASGFTFSSYYMDWVRQAPGKGLQWVAYINGRGNDTSYADSVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Hipposideros armiger V851 ighv JXIK01001905.1 23006 ALAQVTLQESGPGLLRLSQTLTLTCSFSGFSLSTTNMGVGWVRQPPGKPLEWLTHIWWDDEKYYSPSLKSRLTISKDTSKNQVVLTMTSMDPADTATYYCARR
Hipposideros armiger V852 ighv JXIK01001905.1 3198 VLSQVQLQESGPGLVKPLQTLSLTCTVSGYSITSGYCWYWIRQPPEKGLVWIGHISYSGSTAYSSSLKSRTSISRDTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V853 ighv JXIK01001913.1 60914 ALAQVTLQESGPGLLRPSQTLMLTCSFSGFSLSTTNMGVGWVHQLPEKTLEWLTHIWWDDEKYYSPSLNSRLTISKDTSKHQVVLTMTSMDPADTATYYCARR
Hipposideros armiger V854 ighv JXIK01001913.1 50783 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMHWVHQAPGKGLQWVSYIRSDSSYINYAESVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCA
Hipposideros armiger V855 ighv JXIK01001913.1 29731 IQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYSMNWVRQAPGKGLEWVSFISQTGKNINYADSVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCAR
Hipposideros armiger V856 ighv JXIK01001913.1 3346 VNSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYYMSWMRQAPGQGLEWMGVIYPEYSSTSYAQKFQGRVTITADTSTSTAYMELSSLRAEDTAVYYCA
Hipposideros armiger V858 ighv JXIK01001971.1 29991 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLQWVAEINTDGSNSYYADSVKGRFTISRDNAKNTLYLQMTSLRAEDTAVYYCA
Hipposideros armiger V859 ighv JXIK01001971.1 25932 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYFMSWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTGDKSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V860 ighv JXIK01001971.1 11911 VVSQVQLQESGPGLVTPSQTLSLTCTVSGFSITTSSYDWNWIRQPPGKGLEWIGIIAYEGSTAYSPSLKSRTSMSRDTSKNQFSLQLSSVTSEDTAVYYCVR
Hipposideros armiger V861 ighv JXIK01001984.1 99184 VLAQVTLQESGPGLLRPSQTLTLTCSFSGFSLSTTYMGVSWVRQPPGKPLEWLAHIWWNDDKYYSPSLKSRLSISKDTSKNQVVLAMTSMDPADTATYYCAR
Hipposideros armiger V862 ighv JXIK01001984.1 95369 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITTSYSYWSWIRQPPGKGLEWIGLIAYEGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V863 ighv JXIK01001984.1 47954 VQCEVQLTESGGNLRPPGGSLRLSCKGSGFTFSDYYINWIRQAPGKSLEWVGFIRNKANGQTAEYAASVKGRFTISRDDSQSTAYLQMESLRAEDTAVYYCA
Hipposideros armiger V864 ighv JXIK01002006.1 49497 VLSQVQLQESGTGLVKPSQTLSLTCTVSGFSLSSYGVHWIRQAPGKVLEWVGVVWGGGSTAYNPTLKSRLSITKETSKSQVYLTLKSLTAEDMAVYYCAR
Hipposideros armiger V865 ighv JXIK01002006.1 40608 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYSMNWVRQAPGKGLEWVSFISQTGKNIYYADSVKGQFTISRDNAKNMLYLQMTSLRAEDTAVYYCA
Hipposideros armiger V866 ighv JXIK01002006.1 32262 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSAISGDGSSYIYYADSVKGRFTISRDNSKNTLFLQMSSLRAEDTAVYYCAR
Hipposideros armiger V867 ighv JXIK01002006.1 10637 VLSQVQLQESGTGLVKPSQTLSLTCTVSGFSLSSYGVHWIRQAPGKVLEWVGVVWGGGSTAYNPTLKSRLSITKETSKSQVYLTLKSLTAEDMAVYYCAR
Hipposideros armiger V868 ighv JXIK01002006.1 5852 LVQPGGSLRLSCTASGFTFSSYGMNCVRQAPGKGLEWVSYISRSGSSTSYADSVKGQFTISRDNAKNMLYLQMTSLRVEDTAVYYCQATQ
Hipposideros armiger V869 ighv JXIK01002006.1 1296 VLSQVQLQESGTGLVKPSQTLSLTCTVSGFSLSSYGVHWIRQAPGKVLEWVGVVWGGGSTAYNPTLKSRLSITKETSKSQVYLTLKSLTAEDMAVYYCAR
Hipposideros armiger V870 iglv JXIK01002042.1 12871 SWAQSVLTQPSSVSRTPGQSVTISCAGSSSNIGGNSVEWFQQLPGKAPKLLIYGNSNRPSGVSNRFSGSKSGNSASLTISGLQAEDEADYYCLSWDSSLNG
Hipposideros armiger V871 ighv JXIK01002081.1 42740 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYNMQWVRQAPGQGLEWMGWINPNSGDTGYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V872 ighv JXIK01002081.1 34982 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLQWVSAIRGDGSNTYYADSVKGRFTISRDNAKNTQMSSLKAEDMAVYYCAR
Hipposideros armiger V873 ighv JXIK01002081.1 16056 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITTSGYGWNWIRQPPGKGLEWIGRTCASGNTYYSPSHKSRTSISRDMSKNQLSKQLSSVTSEDTAVYYCAW
Hipposideros armiger V874 ighv JXIK01002081.1 8017 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLQWVAQINSDGNSTYYADSMKSRFTISRDNAKNTLYLQMTSLRAEDMAVYYCMR
Hipposideros armiger V875 trdv JXIK01002107.1 20453 FSMAQQVTQAQTTVTVQEGGAVTMDCTYETRQTAYTLYWYRQLPSGERVFLMYQDYSKSNARQDCYSINFQNVKKFISLTISPLHLADSAKYFCAFWD
Hipposideros armiger V876 ighv JXIK01002138.1 24212 VQCEVQLVESGGGLVQPGGSLQLSCAASGFTFSSYYMDWVRQAPGKGLEWVSDISSGGGSSTSYADSVKGRFTISRDNAKNTLYLQMTSLRAEETAVYYCAR
Hipposideros armiger V877 ighv JXIK01002138.1 15471 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYYWSWIRQPPGKGLEWIGYIHSGGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V878 ighv JXIK01002138.1 11066 VLSQVQLQKSGPGLVQPSQNLSLTCTVSGYSITTSGYSWNWIRQPPGKGLEWIGYICHGGSTGYSPSHKSCTSISRDTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V879 ighv JXIK01002138.1 4664 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGAIDPGDGDTRYAQKFQGRVTITADTSTSTAYMELSSLRPEDTAVYYCA
Hipposideros armiger V880 ighv JXIK01002164.1 30496 VLSQLQLQESGPGLVKPSQTLSLTCTVSGGSVTSSNYWHWIRQCPEKGLEWMGYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTSEDTAVYYCAR
Hipposideros armiger V881 ighv JXIK01002164.1 8953 VHCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVAVIWYDGSQKYYADSMKGRFTISRDNAKNTLYLQMTSLRAEDTAVYYCVK
Hipposideros armiger V884 ighv JXIK01002288.1 20301 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYDWSWIRQPPGKGLEWIGYISSGGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTSKDTAVYYCAR
Hipposideros armiger V885 ighv JXIK01002288.1 1791 VLSQVQLQESGPGLVKPSQSLSLTCTVSGYSITSGYSWNWIRQLPGKGLEWIGYICSGGGTYYSPSLKSRTSITRDTSKNQFSLQLNTVTSEDTAVYYCA
Hipposideros armiger V886 trgv JXIK01002442.1 15053 TQISSNLEGRMMSITKQPGSYVAITCDIVNQNINYVHWYQFREGMAPRRLLYYQFSSSKFVVDEGISSEKYHVYEGPGRSCKFVLRNLEESDSGVYYCAAWV
Hipposideros armiger V887 ighv JXIK01002626.1 10825 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLQWVSAISSGGGSNTYYPDSVKGLFTISRDNAKNTLYLQMTSLKAEDMAVYYCVR
Hipposideros armiger V890 trav JXIK01002951.1 4455 VSGQSAVEQSPQYLSAQEGEFLTINCNYSIGINTLHWFRQNPGGGLVSLFMLSAEMKEKGRLSATINTRERHSSLHITACQPGDSAIYFCAIE