WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ellobius talpinus LOJH00000000.1 (LOJH01) 93 15 5 23 20 23 4 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ellobius talpinus V98 trbv LOJH01012711.1 19806 VSAQIIHQRPAVSVQSVGSSLSLECTVKGQSSPNLYWYWQDKGGTLQQLFYSLSVGDVESVAAQNLSASRPQDGQFILSSEKLLLSHSGFYFCAWS
Ellobius talpinus V100 trbv LOJH01012897.1 6849 PVDPRITQTPKHLVAVTGNERTLKCEQHLGHNAMYWYRQNAKKSLELMFSYNYQGLVENQTIQSRFQPHNPEKSYLDLQISALEPDDSATYFCASSQ
Ellobius talpinus V101 trbv LOJH01012897.1 8274 HTGPNVLQIPSHQVIHEGQVVILSCDPVSNHLYFYWYKLILGQKIEFLVSFYNGKPMDKSKLFKEDRFSVERQDGSHFTLKIQPTTLEDSAVYFCASSL
Ellobius talpinus V102 trbv LOJH01012897.1 17728 PLETAVFQTPQYLVTQVGNKASLKCDQDLGHNAMYWYKQHSKQSLKIMFTYNNKQLILNESVPSRFSPHSLDKAHLNLQVKPVELDDSAVYFCASSY
Ellobius talpinus V165 trbv LOJH01024316.1 5249 LSEAGVTQSPRYVIIRERQEVSFWCDPISGHNTLYWYQHPRDQGLQFLIYFQNEAVMGHSQLPKDRFSAVQPNGLNSTLKIQSAKLGDSATYLCASSL
Ellobius talpinus V166 trbv LOJH01024316.1 9063 RTDAGVTQSPRHEVAEKGQTVTLTCEPVSGHTDLFWYRQTKTQGLELLRYFRSKSLMEDDKTGKDRFTAEMLDSSVSTLKIQPTEPQDSAVYLCASSL
Ellobius talpinus V167 trbv LOJH01024316.1 18297 PTNAGVTQTPRHKVTKMGQEATLRCEPISGHSGVYWYRQATVRELEFLISFHNQAPIDDTGMPKERFSAQMPNAKLSTLKVQTTQPQDSAVYLCASSL
Ellobius talpinus V175 trbv LOJH01026972.1 12341 SMEAQVTQAPRHLITETGKKLIITCSQNMNHDSMFWYKQDSGLGLKLIYYSINTDHIDKGEVSDGYSVSRKEKKAFLLTLESTKINQTSLYFCASS
Ellobius talpinus V176 trbv LOJH01026972.1 15691 LVGMDVTQTPRYLVKRTGEEVLLDCVQDMGHERMYWYRQDPGLGLWLIHFSYDVDNNSEGDIPEGYRVSRKKRERFSLILESAKTSQTSVYFCASSL
Ellobius talpinus V180 iglv LOJH01028399.1 15131 AISQAVVTQETSLITSPGGKVILTCGSSTGAVTTSNYANWVQENSDQVHTGLIYRTSNRGSGVPARFSGSLLGDKAALTITGVHPEDEAVYYCGLFYSDR
Ellobius talpinus V210 igkv LOJH01039057.1 6146 VSCNIQMTQSPLTLSTSLGDRVTITCHASQNINSWLVWYQQKPGNVPVLLIYKTSNLRTGISSRFSGSGSGTDYTLTISSLQPEDVATYFCMQHQSC
Ellobius talpinus V238 ighv LOJH01046294.1 6221 VQSEVQLVQSGGGLVQPGKSLKLSCVASGFTFSNYWMSWVRQSPGKGLEWVASIYNSNNIYYADAVKGRFTISRDNAKNTLYLEMGSLKSEDTATYYCAR
Ellobius talpinus V243 ighv LOJH01047530.1 11823 VNPQIQLLQPGTELVKPGASVKMPCKASGYSITEYYMHWVKQKPGQRLELIGRIDPADGETKYAQKFQSKATLTADTSSSTAYMELSSLTAEDSAVYYCA
Ellobius talpinus V260 ighv LOJH01054787.1 2924 VQSEVQLVESGGGLVKPGGSLRLSCVASGFTFSDYWMGWVRQAPEKGLEWVGEINKDSSTTNYAPSIKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Ellobius talpinus V261 trbv LOJH01055106.1 2032 SLDGQVIQTPKHLFRGKGQKAKMSCIPENGHTFVYWYQQKQNKELKFLIYFQRQEVREIIDFVKERFVAECPINSPCSLEIQSSEAGDSALYLCASSL
Ellobius talpinus V262 trbv LOJH01055106.1 3711 FCDAAVTQTPRHLIKIKGQKATMKCSPEKGHTVVYWYQQKQGKELKFLIYFQNKQPLDQIDMVKERFAVEFLSDSDCSLEIKSSEAGDSALYLCASSQ
Ellobius talpinus V263 trbv LOJH01055106.1 5776 SFDAKVIQTPRHLVKEKGQKANMGCFPEKGHTAFYWYQQSQKELKLLINFRNEEIIEQTDMVKKRFSAKCPSNSPCSLEIQSSEAGDSGLYFCASSQ
Ellobius talpinus V276 trav LOJH01061110.1 5828 LSTQQLEQNPQFLSIQEGQDLTMYCNSSSIFPQFYWYRQEPREGPVFLMTLVKSGEVKEQKRMTAKFGEARKDSSLSIIRAQPGDAGIYFCAG
Ellobius talpinus V281 igkv LOJH01064695.1 14962 ARCDVQMTQSPSSLPASLRDRVIISCKASQGISGNLDWYQQKAGKAPKILISYANSLADGVPSRFSGRGPGTDYSLTISSLESEDIATYYCLQRNNFP
Ellobius talpinus V293 trav LOJH01068829.1 8131 VISQQKLQQNPEFLSFPEQTMASFNCTFSDGASDNFRWNRQQPGKGPELLTSIFSSGEKEGGRFTIHLNKDSRHVSLHISVSQLNDSAVYFCAVR
Ellobius talpinus V297 ighv LOJH01072849.1 8352 ALSQVRLHQSEPKLEKPGASVKLSCKASGYTFTSYYISWVKQRPEHGLEWIGWIYPNSGGTRYNEKFQGKAKLTVDKSSSTAFMELSSLTSEDSAVYYCA
Ellobius talpinus V308 igkv LOJH01078712.1 5641 SRGDVVMTQTPASLSVSLGDQASISCRSSQSLLLSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYHCSQSYYS
Ellobius talpinus V325 trbv LOJH01090676.1 6347 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHNYIYWYYKKLGEELKFLAYFQNADIIDKIDTIGKNISAKCPTDLPCTIEIQPSQLTDSAVYFCASSQ
Ellobius talpinus V352 igkv LOJH01105626.1 6346 ARCDIQMTQSPASLSVSLGDTVTITCRASEDIYGILAWYQQKPGNPPKLLIYNANSLEDGIPSRFSGSGSDTQYSLKIGGLQPEDIAAYYCQQGWNTP
Ellobius talpinus V358 igkv LOJH01112123.1 3389 ARCDIQMTQSPTFLSASLGDSVTITCQASQNIGSWLAWYQQKTGNPPKLLIYYASTLAEGVPSRFSGTRSGTQFCLKISSLQPEDVANYYCLQHNNVP
Ellobius talpinus V363 igkv LOJH01118298.1 507 ACADIVMTQSPSSLAVSAGQKVTISCKSSQSLSSGSYNYLAWYQQKPGQAPKLLIYRASTRETGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQYYSAP
Ellobius talpinus V369 igkv LOJH01124111.1 2977 GRCDIQMTQSPSSLSASLRDRVTITCQASQSIGNYLYWFQQKPGKSPKRLIYYASNLADGVPSRFSGSGSGTDFTLTISSVEPEDIATYYCLQTSKV
Ellobius talpinus V370 trav LOJH01125358.1 4085 VSSQQKVQQNPEYLSVSYGAMASLNCTFSDSTSQYFWWYRQNPGKGPKMLISIFSNGEKKEGRFTIQLNKSSLLVSLHIIDSEPSDSAVYLCTV
Ellobius talpinus V374 ighv LOJH01127031.1 1347 VQCNVQLVETGGGLVKPGGSIKLSCLASGFTFSDYWMHWVRQATGKGPEWVGVIKHKPNNYETHYAESVKGRFTISRDDSKSILYLQMNSLGVEDTAIYYCTE
Ellobius talpinus V377 ighv LOJH01131089.1 2399 VQTEVKLVESGGGLVKPGESLKLSCVASGFIFSDYWMDWVLQTPGKGLACVGEINKDSSTMRYAPSVKDRFSISRDLQMRSVRSEDNDTYYCAR
Ellobius talpinus V379 igkv LOJH01132322.1 3537 TSGDVVMTQTPLSLSVNIGQSASISCQSSQSLLHSDGKTYLNWFLQRPGQSPQQLIYQVSKLSSAVPERFSGSGSGTYFTLKISKVEPEDLGVYYCMQGTYTP
Ellobius talpinus V384 igkv LOJH01139781.1 2311 ACADIVMTQSPSSLAVSAGEKVTISCRASQSLLSGGNNYLAWYQQKPGQAPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTINSVQAEDLADYYCQ
Ellobius talpinus V386 ighv LOJH01142099.1 310 VFSQVQLKETGPGLVQPSQTLSLTCTVSGFSLTDYDIDWIRQPPGKGLEWMGAIWSGGGTKYSSALQSRITISRDTSNSEVFLKLNSVHTEDTAIYYCAR
Ellobius talpinus V396 trav LOJH01154156.1 6097 GSQGEKVEQRPSTMSVQEGDSTIINCTYTDSALSYFPWYKQEPGKQPQFIIDIRSNVESKRSQRLTLLLNKKVKHLSLHITATQPGDSAIYFCAAD
Ellobius talpinus V402 trav LOJH01163094.1 2127 VNSQLGEENPWALSIQEGENVTVNCSYKTSIAVLQWYRQDLGRGPAMLILVRSNEREKRSGRLRATLNTSTQSSSLSITAVQPEDTAVYFCATD
Ellobius talpinus V403 ighv LOJH01165041.1 2780 VQCEVHLLESGGRLVQPGKSLKLSCAASGFTFSNYWMNWVCQAPGKGLEWVAKINQGGGTTRYTDAVKGRFTVSRDNAKNTLNLEMSNLRSEDTAMYYCVK
Ellobius talpinus V405 trdv LOJH01169530.1 3269 SNLGQKVTQLQSIISTQEGKEVTIDCSYETSWSLYYLYWYKQLRSGEMIFLLHQISSSTRTEKSNRYSITFKKSAKSISLVISASQVEDSVKYFCALW
Ellobius talpinus V412 trbv LOJH01180196.1 728 LLNAKVIQTPRYLVKGKEQKAKMSCSPEKGHAVVFWYKQNNNNEFTFLISFQNQEVLQQIDMVKNRFSAECPSNSPCSVEIQSSEAGDSALYLCASSL
Ellobius talpinus V415 trav LOJH01184733.1 789 RSNGDSVTQTEGLVTVTEGSPLMLNCTYQTTYSSSFPLWYVQYLNKAPQQLLRSATDNKKTEHQGFHATLHKINSSFHLQKSSVQLWDSALYYCALS
Ellobius talpinus V416 trav LOJH01188303.1 1036 VNSQQKVQQSPGYLSVSDGAMASINCTFSDSNSQYFWWYRQHPGEGPKALMSIFSNGKKEEGRFTVHLNKASLQVSLHFRDSQPSDSAVYLCSV
Ellobius talpinus V417 trav LOJH01188558.1 1256 VNSQEKVHQTPEFLGVSEGGTASLNCTSSDRNYNYFWWYKQYPGKGPMFLMSIVSNGEKKEGRFTVHLNQDSLLVSLHIRDSQPSDSAVYLCAV
Ellobius talpinus V419 igkv LOJH01189541.1 615 AICDIQMTQSPSSLPASRGDKITISCRASQGISNNLNWYQQKPGKSPKLLIYYTNNLANGIPSRFSGSGSGTDYSLTISSLESEDIATYYCQQGYNYP
Ellobius talpinus V420 ighv LOJH01190913.1 1144 VQSQVLLQQSGPELKSLGSSVKMACKASGYTFTDHNINWMKQRPGEGLEWIGYINPSNGGTGCAHKFQGKSILTADKSSSTAYMELSSLTSENSEVYYCA
Ellobius talpinus V421 ighv LOJH01192092.1 113 VHSQIQLQQSGPELVRPGTSVKLSCRASGFTFTDYYIFWVKQHPGQGLEWIGDIDPENGNTDYNQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCA
Ellobius talpinus V424 ighv LOJH01204585.1 75 VHSQAQLQQSGPELRKPGSSVKLSCKASGYTFTDYTIHWMKQKPGESLEWIGYFYPGNGNTKYNQKFQGKATLTADTSSSTAYMELRSLTSEDSAVYYCA
Ellobius talpinus V427 igkv LOJH01213133.1 554 STGDIVLTQSPATLSMIPGDRVILTCRASQGIRSNLHWYHKKTNEATKLLIKYACQSISGIPSRFSGSGLGTDFTLIINNLEPEDIVVYYCQHDYSWH
Ellobius talpinus V428 igkv LOJH01217435.1 1641 ACADIVMTQSPSFMAVSLGEKVTISCKSSQSLFDSEYNKNFLNWYQQKPGQSPKLLIYWASTRHTGVPDRFKGSGSETDFTLTISSVQAEDLADYYCMQDEYL
Ellobius talpinus V429 trdv LOJH01220223.1 858 KDALCITLTQSSPDKTVTSGSEVTLLCTYDGNFQNPDLFWYHRRQDLSFQFILYRDDTRFRDADFVQGRFSVRHSKVYRTFHLVISPVRPEDSVTYYCAS
Ellobius talpinus V430 trav LOJH01220678.1 923 VKGQQVKQSPVSSVLQEGESAELQCNFSNMATQVQWFYQSPGGPLISLFYNPSGTKQSGRLTSKTVAKEYRSSLYISSCQTTDSGTYFCAVDTQR
Ellobius talpinus V432 trav LOJH01222927.1 437 VSQGEQVDQRPSTLRVQEGARAVINCTYVDSVSSYFPWYKQESGKHPKLIIDIRSNMERKQDQRLIISHDKKAKHFSLHITDTQPGDSAMYFCAAS
Ellobius talpinus V433 igkv LOJH01226601.1 321 ARCDIQMTQSPSSLSASLGDRVTITCKASQGISNYLTWYQQKPGKAPKPLIYYATSLADGVPSRFSGSGSGTDYSLTISSLESEDFATYYCLQYDEFP
Ellobius talpinus V434 trav LOJH01226856.1 521 DIQAQSVTQPDAHVIVFEGDSLELRCNYSFGGAPFLFWYMQHPGQGLQLLLRYFSGETVVHGVNGFEADFQKSNSSFHLKKASVHWSDSAVYFCALT
Ellobius talpinus V435 ighv LOJH01228565.1 64 VHSQVQMYQSGPELGKPGTSLKLSCKASGYTFTSYYISWMKQTPGQGLEYIGYINPSNGGTGYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAIYYCA
Ellobius talpinus V438 trav LOJH01239787.1 796 RTHGESVTQTVGQVTLSEEDFLTIHCNYSASGYPTLFWYVQYPEEGPQLLLRASKADEKGSSRGFEATYDKVSSSFHLQKASVQESDSAVYYCALG
Ellobius talpinus V543 trbv LOJH01013918.1 8266 PVSAGIIQTPKSMLMKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDVLEGYNVSRSNTEDFSLILESASPSQTSVYFCASSY
Ellobius talpinus V544 trbv LOJH01013918.1 5543 LTNAGVSQSPLYRIIKKGQETALECDPVSGHRGLYWYRQNLGQGPVFMVYFQDELLSDKSGMPNDRFSAVRPEGSVSTLKIQSTDEDDSGIYLCASSL
Ellobius talpinus V545 trbv LOJH01013918.1 1362 LTDAGITQTPRYWITQTGRKMTLECSQDMNHYSMFWYRQDAGEGLKLIYYSGSVGSTTKGDVPEGYSVFRNKTEHFPLTLGSARPSQTSTYFCASS
Ellobius talpinus V589 trgv LOJH01022964.1 8519 GLGQLEQPEMSVTKAIGESAQIACKVPPDLGDTNIHWYRQKENQQFDYLINVRQNYNQRPLDGINKKIEVSKDRQTSTSTLKVNFLKKEDEAFYYCAVWT
Ellobius talpinus V601 igkv LOJH01025754.1 9137 TIGDVVMTQTPLSLLVTIGQPASTSCRSSQSLLHSDGNNYLIWFLQRPGRSPQNLIYFVSKLNSGVPDRFSGSGSGIDFTLQISRVEAEDLGVYYCFQH
Ellobius talpinus V612 trgv LOJH01029316.1 14691 RQTSPNLEERIMSITRPMGSSVIITCDLRTTYSYIHWYRFQEGRTPQYLLSYNFISSTTVVDSGLSSEKYHVYEGTDKTYKFVLRNVEESDAGLYYCASWT
Ellobius talpinus V613 trgv LOJH01029316.1 4699 GSIPTSHLMSYITKRKGDTAFLKCQFEIILRLDTYIHWYRQKPGQPPKRMLCINSRGNIIFEKGFSEERYEAKHWQNDLSSNLRIYQVTEEDTGTYYCAYWV
Ellobius talpinus V614 trgv LOJH01029316.1 2864 GDSWISQDQLSFTRRPNKTVHISCKLSGVSLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Ellobius talpinus V650 igkv LOJH01040970.1 8293 TSGDIVMTQTPLSLSVTIGQSASISCQSSQSILYSNGKTYLSWFLQRPGKPPQRLIYQVSKLSSGVPERFSGSGSGTYFTLKISEVEPEDLGAYYCYQGSYVP
Ellobius talpinus V688 igkv LOJH01065139.1 5809 SRGDIQVTQSPSSLSASLGDRVTITCRTSQDISRYLRWFQQKPGKAPKLLIYGASNLADGVPSRFSGSGSGTDYSLTINSLESEDIANYYCLQYDEYP
Ellobius talpinus V692 igkv LOJH01067518.1 13273 CSCDVKMNQSPSSLSASLRDRVTITCQASQSISDNLYWFQQKPGKSPKLLIYWAKNLANGVPSRFSGSGSGTDFTLKINNLEPEDIATYYCLQTNELP
Ellobius talpinus V696 trbv LOJH01068937.1 4683 TTHGAITQTPKFLIGLQGQRLMMECQQDFNHDAMYWYRQDSGKGLRPIYYSITEKDIQKGELSEGYSVSREKKPFFPLTVTSAQKNQMAVYLCASSI
Ellobius talpinus V702 trav LOJH01072063.1 6299 RTHGDSVTQTEGQVTLSEEDFLTIHCNYSASGYPALFWYMQYPGEGPQLLLRASKANEKGSSRGFEATYDKGSGSFHLQKSSVQESDSAVYYCALS
Ellobius talpinus V705 igkv LOJH01072618.1 1314 ARCDIQVTQSPPFLSASLGDKVTITCLTSQDISNDLNWYQQKSGQVPTLLIYYANSLQSGVPSRFSGQYSGKSFTLTIGSMEPEDVGTYFCLQHYSF
Ellobius talpinus V706 trav LOJH01073555.1 3795 ASYGEQVEQRPLILTIQEGASTVINCTYVESASSYFLWYKQGHGKHPKVIIDIRSNMEKTQDQRLIVLLDKKGKQFSLHMTDTQPGDSAMYFCATD
Ellobius talpinus V710 ighv LOJH01074440.1 5052 IHSQLQQSGPELVRPGTSVKLSCRASDDISYYYIHWVKQSPGQGLEWIGSIYPGNGNTKCNQKFQGKDTLTADTSSNTAYVELRSLTSEDSAVYYCA
Ellobius talpinus V712 trav LOJH01075075.1 5915 KVNGDSVTQTDGLVTVTEGLPVKLNCTYQTTVSAPILFWYVQYGKAPHLLLRSITDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALS
Ellobius talpinus V715 trbv LOJH01077186.1 5453 SANPGVIQSPRHIIKAKGGRSILKCTPISGHDTVFWYQQTLGKELKFLIQHYEKMERAKGNIPKRFSVQQFSDYHSEMNMSALQLEDSAVYFCASS
Ellobius talpinus V716 trbv LOJH01077186.1 3073 HMEAAVTQSPRNKVTVTGGKVELSCHQTDNHNNMYWYRQDLGHGLRLIHYSYGAGSTEKGDVPDGFKVTRPIQKDFSLILEKASLSQTSVYFCASSD
Ellobius talpinus V719 iglv LOJH01080357.1 2099 AISKAVVTQETSLITSPGGTVTLTCGSSAGAVTTSNHANWVQEKSYQVYTGLIGDTNTRVPHVPARFSGSLLGDKAALTITGAHPEDEAVYYCALWYSDH
Ellobius talpinus V735 igkv LOJH01091037.1 5019 TYGNIVMTQSPKSLSVSVEDKATMSCKSSQNVGTGIAWYQQKPEQAPKLLIYSASTRYTGVPDRFTGSGYGTDFFLTISNVQAEDLADYYCQQYYSYP
Ellobius talpinus V736 igkv LOJH01091062.1 5653 ARCDIQMTQSPSSLSVSLGDRVTITCRASQGISGWLAWYQQKPGKVPKLLIYKASSLADGIPSRFSGSGSGSDYSLTITSLESEDIATYYCQQYDEYP
Ellobius talpinus V737 iglv LOJH01091435.1 5868 SCAQVVLTQPSSVSGSLGSTVTISCKRSSGNIGSNYVHWYQQHFGSPPTNVIYENNKRPSGIPDLFSGSIDSSSNSASLTITDLQIEDEADYYCQSSGSGY
Ellobius talpinus V738 igkv LOJH01091698.1 1872 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLLAGSYNYLVWYQQKPGKAPKLLIYDASTRATGVPDRFTGSGSGTDFTLTINSVQSEDLADYYCQQYKSYP
Ellobius talpinus V739 ighv LOJH01094286.1 2544 VLSQYQLKESGPGLVQPSQTLSLTCTVSGFSLSSNNIHWVCQPPGKGLEWMGAIWYNGDTDYNSALKSGVTITRDTSKSQVFLKLNSLQIEDTAMYYCAR
Ellobius talpinus V740 trav LOJH01094708.1 2452 VNSQQKVQQNPESLRVPEGAMTSLNCTFSDRNFQYFWWYRKHPRKGPTMLMSIFSSGEKKEGRFTVQLSQDSLHASLHITDSQPSDSAVYLCAG
Ellobius talpinus V746 ighv LOJH01099521.1 3170 VQCEVQLLESGGDLVQPGKSLKLSCAASGFTFSSYAMGWVRQASRKGLEWVASISSSGGSTYYTDAVKGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCAR
Ellobius talpinus V753 trdv LOJH01104078.1 4813 TSMAQKVTQAQTSISVMEKKTVTLDCVYESRESTYYLFWYKQTTNGEMVFLILQESYQKNATEGRYSLNFQNSESSIGLIITATRIEDSAVYFCAMRE
Ellobius talpinus V757 iglv LOJH01108014.1 4306 SFSQPVLTQSPTASASLGASVKLTCTLSSAHSTYTIGWYQQQPEKAPKYVMWLSNNGNHGKADGIPDRFSGSSSGAHRYLSISNIQPEDEADYFCGTGDGSV
Ellobius talpinus V759 trav LOJH01113134.1 3678 RTDGDSVTQKQGQVTLSKDEFLFINCTYSTTGYPTLFWYVQYPGEGPELILKVTTANNKGSNRGFEATYDEGSTSFHLQKAAVKESDSAVYYCALS
Ellobius talpinus V772 trbv LOJH01124817.1 1560 CVDAMVMQNPRYKVARVGKPVNLSCSQSLNHDVMYWYQQEPNQAPKLLLYYYDTTLNREADTSENFQSNRPNTSFCSLGIHSAGLGDSSMYLCASSR
Ellobius talpinus V774 trav LOJH01125379.1 4387 RSNGDSVTQTKGLVTITEGFPVMLNCTYQTIYPDSYIWWYVQYTNRAPQVLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALS
Ellobius talpinus V803 trav LOJH01186119.1 402 GSQGEKVEQRPSTMSVQEGDSTIINCTYTDSALSYFPWYKQEPGKQPQFIIDIRSNVESKRSQRLTLLLNKKVKHLSLHITATQPGDSAIYFCAAD
Ellobius talpinus V805 trbv LOJH01191060.1 1748 SVFSVLVSQKPKRDICQSGTSLKIQCVLGSQVTAMFWYRQIPGQSLVLMATANEGSEAMYEKEFTKDKFPISRPNLTFSTLTVSNARPEDSSFYFCSAG
Ellobius talpinus V808 igkv LOJH01199095.1 1434 AICDIQMTQSPSSLSASLGDRVTITCKASQDINYNLNWYQQKPGKPPKLLMYYTDSLADGVPSRFSGSGSGTDFSLTISSLEYEDSATYYCQNGII
Ellobius talpinus V810 igkv LOJH01204285.1 874 AKCDIQMTQSPASLSAFLGDSVTITCRASENIYSYLAWYQQKSGKPPNLQIYSAKSLAAGVPSRFSGSGSGTQYSLKISSLQPEDIAIYYCQHYYGTP
Ellobius talpinus V813 trav LOJH01209940.1 2955 RTQGDSVTQTGGQVTISEGGFLTINCTYIITNIGSPGLFWYVQYPGESLHFLLKVITAGAKGSSRGFEATYDKGSSSFHLQKASVQESDSAVYYCALS
Ellobius talpinus V815 trbv LOJH01211052.1 354 HMEAAVTQSPRSMVTVTGGKVELSCHQMDNHNNMYWYRQDLGHALRLIYYSYGADSIEKGDVADGYKVTRPRTEDFSLILEKASLSQTSVYFCASSD
Ellobius talpinus V820 iglv LOJH01218527.1 522 SWAEVVFTQPQFVSGSLGQKITISCTRSTGNIESNYVYWYQQHSASAPRLLIYKYDQRPSGVPDRFSGSKDSSSNSGTLTISGLQAEDEADYYCLSGYDNY