WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ellobius lutescens LOJG00000000.1 (LOJG01) 87 16 5 18 23 19 4 2
Ellobius lutescens LOEQ00000000.1 (LOEQ01) 115 23 5 19 35 26 4 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ellobius lutescens V69 trav LOJG01013687.1 15419 VNSQQKVQQSPGYLSVSEGAMASINCTFSDSNSQYFWWYRQHPGEGPKALMSIFSNGKKEEGRFTVHLNKANLQVSLHFRDSEPSDSAVYLCAV
Ellobius lutescens V70 trbv LOJG01014746.1 7563 SLDGQVIQTPKRLFRGKGQKAKMSCIPESGHTFVYWYQQKQNKELKFLIYFQRQEVRERIDFVKERFVAECPINSPCSLEIQSSEAGDSALYLCASSL
Ellobius lutescens V71 trbv LOJG01014746.1 9251 FCDAAVTQTPRHLIKMKRQKATMKCSPEKGHTAVYWYQQKQGKELKFLIYLQNKQPLDQIDMVKERFSVEFLSDSDCSLEIKSSEAGDSALYLCASSQ
Ellobius lutescens V72 trbv LOJG01014746.1 11256 SFDAKVIQTPRHLVKEKGQKANMGCFPEKGHTAFYWYQQSQTELKLLINFRNEEIIEQTDMVKKRFSAECPSNSPCSLEIQSSEAGDSGLYFCASSQ
Ellobius lutescens V75 igkv LOJG01015219.1 6223 SWGQVVLTQSPASMAVSQGEKVTITCSSSASTSYLHWYQQKPEASPKLLIYRVSNLASGVPARYSGSSSGTSYSLTISSIQAEDAATYYCQQGSSY
Ellobius lutescens V93 igkv LOJG01020181.1 3122 TRCDIQMTQSPAFHSASLGDSVTMTCQASQNIYSNLAWYHQKPGNPPKLLIYDANRLADGVPTRFSGSGSGTQYSLKISGLQSEDVATYYCQQYSNF
Ellobius lutescens V98 ighv LOJG01021499.1 15989 IQCEVQLLESGGGLVKPGDSLKLPCAASGFTFSDYYMYWVRQPPGKGLEWVGHIKNKANSYTTEYNESVKGRFTISRDDSKNTLYLQMNSLRAEDTATYYCTR
Ellobius lutescens V101 trbv LOJG01022301.1 1341 PTNAGVTQTPRHKVTKMGQEATLRCEPIPGHSGVSWYRQTTVKELEFLISFRNQAPIDDTGMPKERFSAQMPNAKLSTLKVQTTQPQDSAVYLCASSL
Ellobius lutescens V102 trbv LOJG01022301.1 8871 CVDAMVMQNPRYKIARVGKPVNLSCSQSLNHDVMYWYQQKPNQAPKFLLYYYDTTLNREADTSENFHSNRPNTSFCSLGIHSAGLGDSSMYLCASSR
Ellobius lutescens V103 trav LOJG01022641.1 8683 LSTQQLEQNPQFLSIQEGQDLTMYCSSSSTFPQFYWYRQEPREGPVFLMTLVKSGEVKEQKRMIAKFGEAKKDSSLSIIRAQPGDAGIYFCAG
Ellobius lutescens V116 trbv LOJG01027807.1 11777 RTDAGVTQSPRHEVAKKGQTVTLACEPVSGHTDLFWYRQTKTQGLELLRYFRSKSLMEDDKTGKDRFTAEMLDSSVSTLKIQPTEPQDSAVYLCASSL
Ellobius lutescens V126 iglv LOJG01030770.1 7215 SCAQFVLTQPSSVSGSLGSTVTISCKRSSGNIGSNYVHWYQQHIGSPPTNVIYYDNKRPSGIPDRFSGSIDSSSNSASLTIADVQIEDEGDYYCQSYGSSY
Ellobius lutescens V129 trbv LOJG01033205.1 14131 HTKAGVSQSPAHTIIKKGQNVSFRCDPISGHTRLFWYQQKSGQGPEFLIYFQNEVALDKSGLPGDRFSAARPNGSYSVLKIQPAKQEDWAVYLCASSL
Ellobius lutescens V159 trav LOJG01045780.1 7267 MSQGEQVEQHPFILRVQEGASAVINCTYVESTSSYFPWYKQEPGKHPKLIIDIRSNMERKQDQRLIISHDKKDKHFSLHVIDTQPGDSAMYFCAAS
Ellobius lutescens V197 igkv LOJG01063907.1 8288 ACADIVVTQSPSFLAVSAGEEVTINCKSSLSLLYSKDKKNYLNWYQQKPGQSPKLLIYWASTRETGVPDRFIGSGSETDFTLTISSVQAEDLADYYCQQHYSS
Ellobius lutescens V199 trav LOJG01064876.1 5502 VSQGEQVEQRPSILRVQEGDRVVINCTYVDSALSYFPWYKQEPGKHPKLITDIRSNMERKQDQRLIISHDKKDKHFSLHITDTQPGDSAMYFCAAS
Ellobius lutescens V204 trbv LOJG01066687.1 1545 PVSAGIIQTPKSMLMKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDIPEGYNVSRSHTEDFSLTLESASPSQTSVYFCASSN
Ellobius lutescens V205 trbv LOJG01066687.1 4254 LTNAGVSQSPLYRIIKRGQETALECDPVSGHRGLYWYRQNLGQGPVFMVYFLDERLSDKSGMPNDRFSAVRPEGSVSTLKIQSTDEEDSGIYLCASSL
Ellobius lutescens V215 trav LOJG01071042.1 6853 VNSQVLSQSAQYVSISEGKDASVSCNSSSALNNVLWYKQNPKEGLVLLMALYKSGEMVRSGKVTAEFGGTRKDSVLTLSVSEPADTGTYFCAG
Ellobius lutescens V224 trav LOJG01074522.1 7565 VSQGEQVEQSPSTLRVQDGASAVINCTYVDRTSYNFLWYKQGPGEHPKHIVDIHSNMERKHDERLIVLLDKKAKHFSLHITYAQAEDSAMYFCATD
Ellobius lutescens V225 trav LOJG01074522.1 9259 RSNGDSVTQTEGLVTVPEGSPVMLNCTYQTTYSSSFPLWYVQYLSKAPRLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALS
Ellobius lutescens V236 ighv LOJG01078200.1 12763 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITNGYYWSWIRQAPEKKLEFIGYISYDGGTYYNPSFKSRISITRDTSKNQFFLQLNSLTTEDTATYYCAR
Ellobius lutescens V247 trgv LOJG01083789.1 1089 GLGQLEQPEMSVTKAIGENAQIACKVPPDLGDTDIHWYRQKENQQFDYLINVRQNYNQRPLDGINKKIEVSKDRQTSTSTLKVNFLKKEDEAFYYCAIWT
Ellobius lutescens V263 trbv LOJG01095259.1 6099 LMDMDVTQTPRYLVKKMGEEVLLECVQDMGHERMYWYRQDPGLGLWLIHFSYDVDSNSERDIPEGYRVSWKKREHFSLILESAKTSQTSVYFCATSL
Ellobius lutescens V264 trbv LOJG01095259.1 13672 SVFSVLVSQKPKRDICQSGTSLKIQCVLDSQATAMFWYRQVPGQSLVLMATANEGSEATYEKEFTKDKFPISRPNLTFSTLMVSNAKPEDSSFYFCSAG
Ellobius lutescens V266 igkv LOJG01096019.1 2464 TYGNIVVTQSPKSLSVSVGDKAIVSCKSSQNVGTSIAWYQQKPEQAPKLLIYYASNRETGVPDRFTGSGSGTDFILTISNVEAEDLADYYCQQYYSYP
Ellobius lutescens V268 ighv LOJG01096676.1 1972 VQCDVQLVETGGGLVQPGGSVKLSCATSGFTFSDHWMNWIRQAPGKGLEWIAVIKHKPGNYEILYAESVKSRFTISRDDSKSILYLQMNSLRAEDTAIYYCVR
Ellobius lutescens V284 ighv LOJG01108976.1 3287 VQSEVQLVESGGGLVKPGGSLRLSCVASGFTFSDYWMEWIRQAPGKGLEWVGEINKDSSTTNYAPSVKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Ellobius lutescens V292 trav LOJG01117300.1 1898 GVRGVEVEQSPSALSLHEGKSSTLSCNFSITMTNVQWFRQNSRGSIINLFYLNPGTKEKGRLNSTFDSKERYSTLHIWDAQLVDSGTYLCAAY
Ellobius lutescens V296 trav LOJG01118867.1 1412 DVQAQSVTQLDAHVTVFEGHLVELRCSYSYSGAPYLFWYMQRPGQGLQLLLSYRSGSSVVRGVNGFEADFQKSNSSFHLKKASVHLSDSAVYFCALS
Ellobius lutescens V300 trav LOJG01121508.1 3594 RTHGDSVTQTEGQVTLSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDKESSSFHLQKVSVQESDSAVYYCALG
Ellobius lutescens V301 trav LOJG01122349.1 532 VSYGVQVEQHPSILTIQEGSSAVINCTYVDSASSYFLWYKQGHGKHPKVIIDIRSNMEKKQDQRLIVLLDKKSKLFSLNITDTQPGDSAMYFCATD
Ellobius lutescens V307 igkv LOJG01128159.1 1739 STGDVVMTQTPTSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKPGQSLKLLIYKVSNRFSGVSDRFSGSGSGTDFTLKINRVEPEDLGVYYCFQS
Ellobius lutescens V309 trbv LOJG01129559.1 4610 PLEMAVFQTPQYLVTQVGNKATLKCEQDLGHNAMYWYKQDSKQSLKIMFTYNNKQLILNESVPSRFSPQSPDKAHLNLQVEPVEPDDSAVYFCASSY
Ellobius lutescens V314 igkv LOJG01131163.1 3360 ACADIVMTQSPSTLAVSAGEKVTISCRSSQNLLHSASQKNLLNWYQQKPGQSPKLLIYWASTRKTGVPDRFIGSGSGTDFTLTISSVQVEDVAEYYCQQ
Ellobius lutescens V321 trbv LOJG01137189.1 648 STHGAITQTPKFLVGLQGQRLTMECQQDFNHDAMYWYRQDPGKGLRPIYYSITEKDIQKGELSEGYSVSREKKPFFPLTVTSAQKIQTAVYLCASS
Ellobius lutescens V323 trav LOJG01140630.1 2610 VSSQQKLQQNPEFLSVPEGAMASLNCTFSDGASDNFRWYRQQPGKGPELFMSIFSSGEKEEGRFTIHLNKDSRHVSLHIRVSQPSDSAVYFCAVR
Ellobius lutescens V326 trav LOJG01144003.1 5048 GVRGVDVEQSPTDLSLHEGTSFALRCNFSTTIMSVQWFRQNPRGSLIRLFYLTPGTKENGRLKSTFTSKEHYSTLQIEDAQLEDSGTYLCAVE
Ellobius lutescens V328 igkv LOJG01147757.1 2844 ACADIVMTQSPSSLAVTAGQKVTISCKSSQSLLSGGNNYLAWYQQKPGQAPKLLIYWASTQETGVPNRFTGSGSGTDFTLTISSVQAEDLADYYCQQHYSAP
Ellobius lutescens V335 trav LOJG01154585.1 1066 RSNGESITQTEGPGTLTVGASLILSCSYQTPYLDPLLLWYVQYLNKAPQLLLWSATDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALR
Ellobius lutescens V343 igkv LOJG01164877.1 3769 SSGDIVLTQSPSLVSVSLGQKATISCKSSESVNKYGINLMHWYQQKPGQSPKFLIYAASNLESGVPARFSGSGSGTDFTLTISHVEADDAATYYCQQGKEFP
Ellobius lutescens V344 ighv LOJG01167060.1 454 VQCEVQLLESVGGLVQPGKSLKLSCAASGFTFSDYWMNWVRQAPGKGLQWVAEINQDGGSTYYIDSVKGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCTR
Ellobius lutescens V353 trav LOJG01190043.1 75 VNSQEKVQQTPEFLGVSEGAMASLNCTSSDRNYNYFWWYKQYPGKGPMFLMSIFSNGEKKEGRFTVHLNQDSLHVSLHIRDSQPSDSAVYLCAV
Ellobius lutescens V355 trbv LOJG01190600.1 48 LLNGEVIQTPRYLVKGKEQKAKMSCSPEKGHAVVFWYKQNNNNEFTFLISFQNQEVLQQIDMVKNRFSAECPLNSPCSLEIQSSEAGDSALYLCASSQ
Ellobius lutescens V361 iglv LOJG01199578.1 1164 SWAEVVFTQPQFVSGSLGQKITISCTRSTGNIESNYVYWYQQHSASAPRLLIYNYDQRPSGVPDRFSGSKDSSSNSGTLTISGLQAEDEADYYCLSGYDNY
Ellobius lutescens V366 igkv LOJG01234223.1 66 ARCDIQVTQSPSSLSVSLEGRITITCKTSQDVSNFMAWYQQKPGEVPKLLIYYASTLQSGVPQRFSGSGSGTDFSFTINRLEPEDTATYYCQLGYGL
Ellobius lutescens V420 trbv LOJG01008107.1 3915 PVSAGIIQTPKSMLMKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDIPEGYNVSRSHTEDFSLTLESASPSQTSVYFCASSN
Ellobius lutescens V421 trbv LOJG01008107.1 1206 LTNAGVSQSPLYRIIKRGQETALECDPVSGHRGLYWYRQNLGQGPVFMVYFLDERLSDKSGMPNDRFSAVRPEGSVSTLKIQSTDEEDSGIYLCASSL
Ellobius lutescens V474 trbv LOJG01021164.1 11828 VSAQIIHQRPAVSVQSVGSSLSLECTVKGQSSPNLYWYWQDKGGTLQQLFYSVSVGDAESVAARNLSASRPQDGQFTLSSEKLLLSHSGFYFCAWS
Ellobius lutescens V487 ighv LOJG01024576.1 1993 VHSQVQLQQSGAELVKPGSSLKLSCKASGYNFASYYINWVKQRPGQGLEWIANIYPGSGGANYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAIYYCA
Ellobius lutescens V496 ighv LOJG01026777.1 9359 VQCNVQLVETGGGLAQPGGSIKLSCLASGFTFSDYWMYWVRQAPGKGPEWVGVIKHKPNNYETHYAESVKGRFTISRDDSRSILYLQMNSLRVEDTAIYYCTT
Ellobius lutescens V516 ighv LOJG01031875.1 4377 VLSQYQLKESGPGLVQPSKTLSLTCTVSGFSLSSYNIYWVRQPPGKGLQWMGAIWYDGNTDYNSALKSRVTITRDTSKSQVFLKLNNLQTEDTAMYYCAR
Ellobius lutescens V523 trav LOJG01033519.1 5339 GSQGEKVEQHPSTMSVQEGDSTIINCTYTDNASVYFPWYKQEPGKQPQFIIDIRSNVERKQSQRLTLLLNKKVKHLSLHVTATQPGDSAIYFCAAD
Ellobius lutescens V540 trgv LOJG01041842.1 10813 GLGKVEQPEISVSRATDETAQISCKVSINSFKSVAIQWYWQKPNQGLQFLLYVMATPTHILLDETKKMEASKNSSASTSTLTIYSLKEEDEAIYYCSYG
Ellobius lutescens V541 trgv LOJG01041842.1 4514 GDSWISQDQLSYTRRPNKTVHISCKLSGVPLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Ellobius lutescens V545 ighv LOJG01043811.1 8845 VQCEVQLVESGGGLVQPGKSLKLSCVASGFTFSNYWMGWVRQAPEKALEWVASIYNSNNIYYADAVKGRFTISRDNAKNTLYLEMGSLKSEDTAIYYCAR
Ellobius lutescens V569 iglv LOJG01053060.1 482 SWAEVVYTQPQSLSGSLGQKITISCTRSSGSIDSNSVSWYLQRSANTPRLLIYRYDLRPSGAPDRFSGSKDSSSNSATLTISGLQAEDEADYYCLSGYDNY
Ellobius lutescens V575 trav LOJG01054890.1 8331 RTNGDSVTQTEGLVTVIEGSPVMLNCTYQTTYSAPFVFWYVQYLNKAPQLLLKSSTDNKRTKHQGFHATLHKSSSSFHLQKSSVKLWDSALYYCALS
Ellobius lutescens V582 trdv LOJG01056715.1 1203 SSTAQKATQVQPAINKQEGKQVTLDCSYETSKSFYQLCWYKQTPSGEMIFLICQISSSHHNESSGRYAVVFQKSAKFIGLIISASQVEDSMNYFCALGEP
Ellobius lutescens V605 trgv LOJG01066445.1 8248 RQTSPNLKERIMSITRPMGSSVIITCDVRTTYSYIHWYRFQEGRTPQYLLSYDFISSTTMVDSGLSSEKYHVYEGTDKTYKFVLRNVEESDAGLYYCASWT
Ellobius lutescens V616 trbv LOJG01071088.1 699 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHNYIYWYYKKPGEELKFLAYFQNADIIDKIDRIGKNILAKCPINLPCTLELQSSQLTDSAVYFCASSQ
Ellobius lutescens V617 trav LOJG01071138.1 1348 ESNGDSVTQSEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRVSKANNKGSSRGFEATYDKESSSFHLQKVSVQESDSAVYYCALG
Ellobius lutescens V631 ighv LOJG01076463.1 656 VHSQVQLYQSGPELGKPGTSVKLSCKASGYTFTSYYVSWVKQSPGQGLEYIGYINPSNGGTGYAQKFQGKAKFTVDTSSSTAYMELSSLKSGDSAIYYCA
Ellobius lutescens V644 igkv LOJG01082013.1 2784 ARCDIQMTQSPTSLSASLGDSVTITCQASQNIGSWLAWYQQKTGNPPKLLIYYASSLAEGVPSRFSGTRSGTQYSLKISSLQPEDVANYYCLQYNNLP
Ellobius lutescens V663 iglv LOJG01090551.1 1250 TCAQFVLTQPNSVSGSLGSTVTISCKRSSGNIGSYYVHWYQQHIGSPPTNVIYDNNKRPSGIPDRFSGSIDSSSNSASLTITDVQNEDEADYYCQSYDSSY
Ellobius lutescens V676 trav LOJG01099693.1 9882 RTHGDSVTETEGHVSHLEEGCPTKQCNYSASGYSVLFWYMQYPSECPHILFKASKANEKRSSRGFEVTYDKGSTFFHLEKALVQESDLAVYYCALS
Ellobius lutescens V679 igkv LOJG01102725.1 919 SRGDIQVTQSPSSLSASLGDRVTITCRTSQDISRYLRWFQQKPGKAPKLLIYGASSLADGVPSKFSGSGSGTDYSLTISSLESEDIANYYCLQYHKYP
Ellobius lutescens V681 trav LOJG01104675.1 3545 VDSQQGEENPQALSIQEGEDVTMNCSYKTYSVTLQWYKQDSGRGPVMLILLRSNEKEKHSGRLRATFNTSTQSSSLSIPAAQAADTAVYFCATD
Ellobius lutescens V682 iglv LOJG01105377.1 2771 SFSQPVLTQSPTASASLGASVKLTCTLSSQHSTYSIGWYQQHPDKAPKYLMYVTSNGNHGKGDGIPDRFSGSSSGAHRYLSISNIQSEDEAVYFCGTAY
Ellobius lutescens V683 ighv LOJG01105856.1 3007 IYSQVQLHQSGPELGRPGTSVKLSCKASGYTFTNYDMHWVKQRPGQGLEWIGWIYPGNGGTGYAQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Ellobius lutescens V689 igkv LOJG01109569.1 1533 ACADIVMTQSPSSVAVSAGEKVTISCKSSQSLFAGSYNYLAWYQQKPGQAPKLLIYRASNRYTGVPDRFTGSGSGTDFTLTINSVQSEDLANYYCQQYYSAP
Ellobius lutescens V693 trbv LOJG01111521.1 6220 PVDPRITQKPKHLVAVTGNERTLKCEQHLGHNAMYWYRQNAKKSLELMFSYSFQGLVENQTIQSRFQPHNPEKSYLDLQISALEPDDSATYFCASSQ
Ellobius lutescens V696 igkv LOJG01115491.1 2509 ARCDIQMTQSPSSLSASLGDRVTITCKASQGISSYLEWRQQKSGKAPKLLIYYTNRLADGVPSRFSDSGSWTDYSLTIISLESEDTATYYCLQTNKIP
Ellobius lutescens V699 igkv LOJG01116725.1 1489 IRGNILMAQSPSSLSASLGDRVTISCQASQGISNYLNWYQQKPGNAPKLLIYYASNLENGVPSRFSGSGYGTDFTLTISSLEPEDTAIYYCQQTSNLP
Ellobius lutescens V708 igkv LOJG01126208.1 1250 CSCDIKMNQSPSSLSASLRGRVTITCQASQSVSDNLYWFQQKPGKSPKLLIYWAKNLANGVPSRFSGSGSGTDFTLTINNLEPEDISTYYCLQTNEYP
Ellobius lutescens V709 ighv LOJG01130248.1 856 VYSQVQLHQSGPDLGKPGTSVKLSCKTSGFTFTSNYVSWVKQRPRQGLEWIGWIYPGSGGTKYNERFQGKATLTAEKSSSTAYMELSILTSEDSAVYYCA
Ellobius lutescens V714 trav LOJG01136402.1 7731 RSNGDSVTQTEGQVTVTEGLPVKLNCNYETTYTSPFLLWYVQHPRKAPQLLLNTFTDKKRIEHQGFYVGLNKSSSSFHLQKSSVQLWDSALYYCALR
Ellobius lutescens V721 igkv LOJG01141086.1 1478 SRCDIQMIQSPSQTASLGDTVTIKCQASQNINNELNWYQQKPGKSPKLLIYAASRLFAGVPSRFSGSGSGRDFTLTISSVMTEDIATYYCKQDLTY
Ellobius lutescens V728 trav LOJG01147843.1 4664 GNRAQSVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYIQYPDQSLQLLLKYFSGNTLVKGINGFEAEFGRSNSSFNLRKNPAHWSDSAKYFCALS
Ellobius lutescens V738 ighv LOJG01160251.1 662 ALYQIQLKETGPGLVQPSQTLSLTCTVSGISLMSNVVHWIRQPPGKSLQWMGGIWSGGSTEYNSALQSRIRFSRDTSKSQVFLNLNSLQTEDTAMYYCAR
Ellobius lutescens V744 igkv LOJG01168642.1 1261 ARCDIQVTQSPFLSASLGDKVTITCLASQSISNDLNWYQQKSGQAPTLLIYYANSLQSGVPSRFSGQYSGKSFTLTIGSVEPEDVGTYFCLQHYSV
Ellobius lutescens V750 ighv LOJG01180903.1 1466 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVHWVRQPPGKGLEWMGVIWSGGGTNYNSALQSRITITRDTSKSQVFFKLNSLQTEDTAMYFCAR
Ellobius lutescens V751 igkv LOJG01181049.1 1903 ARSNIQITQSPASLSVSLGDSVTMTCQASQNIYSSLAWYHQKPGKPPKLLIYGANSLADGVPMRFSGSGSGTQYSLRISNLQSEDTAKYYCLEGRYS
Ellobius lutescens V760 ighv LOJG01199985.1 457 VQAEVLLVQSGSELKQPGQSVKISCKASGYTFTDYAMNWVKQEPGQHLKWMGYINTYTGEPNYADDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCAR
Ellobius lutescens V762 trdv LOJG01201080.1 1600 KDALCITLTQSSPDKTVTSGSEVTLLCTYDGNFQNPDLFWYRRRQDLSFQFILYRDDTRFRDADFVQGRFSVRHSKVYRTFHLVISPVRPQDSGTYYCAS
Ellobius lutescens V766 trav LOJG01218438.1 707 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIHWYRQVPLRSPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYHCILRE
Ellobius lutescens V770 ighv LOJG01254645.1 518 VNSQIQLLQSGAELVRPGASVKMSCKASGYSITEYYMHWVKQKPGQGLEWIGRIDPADDETKYAQKFHGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Ellobius lutescens V110 trbv LOEQ01000947.1 301682 VSAQIIHQRPAVSVQSVGSSLSLECTVKGQSSPNLYWYWQDKGGTLQQLFYSVSVGDAESVAARNLSASRPQDGQFTLSSEKLLLSHSGFYFCAWS
Ellobius lutescens V123 trav LOEQ01001064.1 587955 RTNGDSVTQTEGLVTVIEGSPVMLNCTYQTTYSAPFVFWYVQYLNKAPQLLLKSSTDNKRTKHQGFHATLHKSSSSFHLQKSSVKLWDSALYYCALS
Ellobius lutescens V124 trav LOEQ01001064.1 612814 MSQGEQVEQHPFILRVQEGASAVINCTYVESTSSYFPWYKQEPGKHPKLIIDIRSNMERKQDQRLIISHDKKDKHFSLHVIDTQPGDSAMYFCAAS
Ellobius lutescens V127 trav LOEQ01001125.1 60474 RSNGDSVTQTEGLVTVTEGLSVKLNCTYQTTDSAPFLFWYVQYVKASWLLLRSSTGNKRTEQQVFHDTLHKSSSSFHLQKSSVQLWDSALYYCALR
Ellobius lutescens V269 trav LOEQ01005163.1 11277 GNRAQSVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYIQYPDQSLQLLLKYFSGNTLVKGINGFEAEFGRSNSSFNLRKNPAHWSDSAKYFCALS
Ellobius lutescens V270 trav LOEQ01005163.1 55271 LSTQQLEQNPQFLSIQEGQDLTMYCSSSSTFPQFYWYRQEPREGPVFLMTLVKSGEVKEQKRMIAKFGEAKKDSSLSIIRAQPGDAGIYFCAG
Ellobius lutescens V271 trav LOEQ01005163.1 103829 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIYWYRQVPLRSPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYHCILRE
Ellobius lutescens V283 ighv LOEQ01005889.1 21093 VHSQVQLQQSGAELVKPGSSLKLSCKASGYNFASYYINWVKQRPGQGLEWIANIYPGSGGANYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAIYYCA
Ellobius lutescens V284 ighv LOEQ01005889.1 59280 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITNGYYWSWIRQAPEKKLEFIGYISYDGGTYYNPSFKSRISITRDTSKNQFFLQLNSLTTEDTATYYCAR
Ellobius lutescens V285 ighv LOEQ01005889.1 74077 VQSEVQLVESGGGLVKPGGSLRLSCVASGFTFSDYWMEWIRQAPGKGLEWVGEINKDSSTTNYAPSVKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Ellobius lutescens V311 ighv LOEQ01007523.1 107683 IYSQVQLHQSGPELGRPGTSVKLSCKASGYTFTNYDMHWVKQRPGQGLEWIGWIYPGNGGTGYAQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Ellobius lutescens V324 trbv LOEQ01009039.1 9966 HTKAGVSQSPAHTIIKKGQNVSFRCDPISGHTRLFWYQQKSGQGPEFLIYFQNEVALDKSGLPGDRFSAARPNGSYSVLKIQPAKQEDWAVYLCASSL
Ellobius lutescens V325 trbv LOEQ01009039.1 71052 HMEAAVTQSPRSKVTVTGGKVELSCHQMDNHNYMYWYRQDLGHGLRLIHYSYGTGNTENGDVPDGYKVIRSSQEDFSLILEKASLSQTSVYFCASSD
Ellobius lutescens V326 trav LOEQ01009124.1 14955 VNSQVLSQSAQYVSISEGKDASVSCNSSSALNNVLWYKQNPKEGLVLLMALYKSGEMVRSGKVTAEFGGTRKDSVLTLSVSEPADTGTYFCAG
Ellobius lutescens V329 igkv LOEQ01009197.1 14253 ACADIVVTQSPSFLAVSAGEEVTINCKSSLSLLYSKDKKNYLNWYQQKPGQSPKLLIYWASTRETGVPDRFIGSGSETDFTLTISSVQAEDLADYYCQQHYSS
Ellobius lutescens V330 igkv LOEQ01009197.1 35487 TYGNIVVTQSPKSLSVSVGDKAIVSCKSSQNVGTSIAWYQQKPEQAPKLLIYYASNRETGVPDRFTGSGSGTDFILTISNVEAEDLADYYCQQYYSYP
Ellobius lutescens V332 igkv LOEQ01009346.1 3506 ARCDIQMTQSPTSLSASLGDSVTITCQASQNIGSWLAWYQQKTGNPPKLLIYYASSLAEGVPSRFSGTRSGTQYSLKISSLQPEDVANYYCLQYNNLP
Ellobius lutescens V335 trav LOEQ01009590.1 18562 GVRGVEVEQSPSALSLHEGKSSTLSCNFSITMTNVQWFRQNSRGSIINLFYLNPGTKEKGRLNSTFDSKERYSTLHIWDAQLVDSGTYLCAAY
Ellobius lutescens V340 trav LOEQ01010659.1 47489 VNSQQKVQQSPGYLSVSEGAMASINCTFSDSNSQYFWWYRQHPGEGPKALMSIFSNGKKEEGRFTVHLNKANLQVSLHFRDSEPSDSAVYLCAV
Ellobius lutescens V341 trav LOEQ01010694.1 19979 RSNGESITQTEGPGTLTVGASLILSCSYQTPYLDPLLLWYVQYLNKAPQLLLWSATDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALR
Ellobius lutescens V346 ighv LOEQ01012057.1 35899 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVHWVRQPPGKGLEWMGVIWSGGGTNYNSALQSRITITRDTSKSQVFFKLNSLQTEDTAMYFCAR
Ellobius lutescens V347 ighv LOEQ01012057.1 48243 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVHWVRQPPGKGLEWMGVIWSGGGTNYNSALQSRITITRDTSKSQVFFKLNSLQTEDTAMYFCAR
Ellobius lutescens V351 ighv LOEQ01012893.1 19290 VYSQVQLHQSGPDLGKPGTSVKLSCKTSGFTFTSNYVSWVKQRPRQGLEWIGWIYPGSGGTKYNERFQGKATLTAEKSSSTAYMELSILTSEDSAVYYCA
Ellobius lutescens V352 trav LOEQ01013282.1 22059 RTHGDSVTETEGHVSHLEEGCPTKQCNYSASGYSVLFWYMQYPSECPHILFKASKANEKRSSRGFEVTYDKGSTFFHLEKALVQESDLAVYYCALS
Ellobius lutescens V353 ighv LOEQ01013931.1 11228 IHSQVQLQQSGPELVRPGTSVKLSCRDSEDISYYYIHWVKQSPGQGLEWIARIDPANGDTNYNEKFQGKATLTADTSSNTAYMELRSLTSEDSAVYYCA
Ellobius lutescens V354 igkv LOEQ01014143.1 8864 TRCDIQMTQSPAFHSASLGDSVTMTCQASQNIYSNLAWYHQKPGNPPKLLIYDANRLADGVPTRFSGSGSGTQYSLKISGLQSEDVATYYCQQYSNF
Ellobius lutescens V357 ighv LOEQ01014694.1 16043 IQCEVQLLESGGGLVKPGDSLKLPCAASGFTFSDYYMYWVRQPPGKGLEWVGHIKNKANSYTTEYNESVKGRFTISRDDSKNTLYLQMNSLRAEDTATYYCTR
Ellobius lutescens V361 trav LOEQ01015493.1 12198 GVRGVDVEQSPTDLSLHEGTSFALRCNFSTTIMSVQWFRQNPRGSLIRLFYLTPGTKENGRLKSTFTSKEHYSTLQIEDAQLEDAGTYLCAVE
Ellobius lutescens V363 igkv LOEQ01015624.1 4645 ARCDIQMTQSPSSLSASLGDRVTITCKASQGISSYLEWRQQKSGKAPKLLIYYTNRLADGVPSRFSDSGSWTDYSLTIISLESEDTATYYCLQTNKIP
Ellobius lutescens V364 igkv LOEQ01015624.1 15083 CSCDIKMNQSPSSLSASLRGRVTITCQASQSVSDNLYWFQQKPGKSPKLLIYWAKNLANGVPSRFSGSGSGTDFTLTINNLEPEDISTYYCLQTNEYP
Ellobius lutescens V366 ighv LOEQ01016444.1 8865 ALSQIQLKESGPGLVQPSQSLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWMGVIAWNGNTHYNSALQSRISISKDTSKSQVFLKLNSLQTEDTAMYFCAR
Ellobius lutescens V367 ighv LOEQ01016774.1 3245 VLSQYQLKESGPGLVQPSKTLSLTCTVSGFSLSSYNIYWVRQPPGKGLQWMGAIWYDGNTDYNSALKSRVTITRDTSKSQVFLKLNNLQTEDTAMYYCAR
Ellobius lutescens V369 igkv LOEQ01017446.1 17323 ACADIVMTQSPSTLAVSAGEKVTISCRSSQNLLHSASQKNLLNWYQQKPGQSPKLLIYWASTRKTGVPDRFIGSGSGTDFTLTISSVQVEDVAEYYCQQ
Ellobius lutescens V370 igkv LOEQ01017523.1 14479 ACADIVMTQSPSSLAVTAGQKVTISCKSSQSLLSGGNNYLAWYQQKPGQAPKLLIYWASTQETGVPNRFTGSGSGTDFTLTISSVQAEDLADYYCQQHYSAP
Ellobius lutescens V372 trbv LOEQ01019083.1 2779 LTDAGITQTPRYWITQTGRKMTLECSQNMNHYSMFWYRQDAGERLKLIYYSGSVGSTTKGDVPEGYSVFRNKTEHFPLTLGSARPSQTSTYFCASS
Ellobius lutescens V373 trbv LOEQ01019471.1 9091 PLEMAVFQTPQYLVTQVGNKATLKCEQDLGHNAMYWYKQDSKQSLKIMFTYNNKQLILNESVPSRFSPQSPDKAHLNLQVEPVEPDDSAVYFCASSY
Ellobius lutescens V374 trdv LOEQ01020063.1 6940 SSTAQKATQVQPAINKQEGKQVTLDCSYETSKSFYQLCWYKQTPSGEMIFLICQISSSHHNESSGRYAVVFQKSAKFIGLIISASQVEDSMNYFCALGEP
Ellobius lutescens V378 igkv LOEQ01023211.1 4366 ARCDIQMTQSPSSLSASLGDRVTITCKASQGISNFLNWYQQKPGKAPKLLIYYTNSLADGIPSRFSGSGSGTDYSLTISSLESEDIATYYCQQGNNYP
Ellobius lutescens V381 trbv LOEQ01027218.1 2863 LTDAGITQTPRYWITQTGRKMTLECSQNMNHYSMFWYRQDAGERLKLIYYSGSVGSTTKGDVPEGYSVFRNKTEHFPLTLGSARPSQTSTYFCASS
Ellobius lutescens V383 trbv LOEQ01029119.1 346 PLEMAVFQTPQYLVTQVGNKATLKCEQDLGHNAMYWYKQDSKQSLKIMFTYNNKQLILNESVPSRFSPQSPDKAHLNLQVEPVEPDDSAVYFCASSY
Ellobius lutescens V384 trav LOEQ01032798.1 182 VNSQLGEENPWALSIQEGENVTVNCSYKTSIAVLQWYRQDAGRGPAMLILVRSNEREKHSGRLRVTLNTSPQSSSLSITAVQPEDTAVYFCATD
Ellobius lutescens V385 ighv LOEQ01036193.1 317 VFSQIQLKDTGPGLVQPSQTLSLTCTVSGFSLTDYDIDWVRQPPGKGLEWMGAIWKGGGTNYSSALQSRITISRDTSNNEVFLKLNSLHTEDTAIYYCTR
Ellobius lutescens V388 iglv LOEQ01037939.1 1230 SMASYVLTQPSSLSVALGQTATITCSGDKLSDKYVHWYQQKAGHAPVLVIYEDNKRPDGIPDQFSGSNSGNKATLTIGKVQAEDEADYYCSTSS
Ellobius lutescens V389 iglv LOEQ01037947.1 1229 SMASYVLTQPSSLSVALGQTATITCSGDKLSDKYVHWYQQKAGHAPVLVIYEDNKRPDGIPDQFSGSNSGNKATLTIGKVQAEDEADYYCSTSS
Ellobius lutescens V390 ighv LOEQ01039925.1 527 IHSQVQLQQSGPELVRPGTSVKLSCRASDNIAKYYIHWVKQTSGQGLEWIAWIDPANGNTKYSQKLQGKATLTADTSSNTAYMEHRNLNSEDSAVYYCATYSVA
Ellobius lutescens V391 ighv LOEQ01042450.1 527 IHSQVQLQQSGPELVRPGTSVKLSCRASDNIAKYYIHWVKQTSGQGLEWIAWIDPANGNTKYSQKLQGKATLTADTSSNTAYMEHRNLNSEDSAVYYCATYSVA
Ellobius lutescens V392 iglv LOEQ01042811.1 507 SMASYVLTQPSSLSVALGQTATITCSGDKLSDKYVHWYQQKAGHAPVLVIYEDNKRPDGIPDQFSGSNSGNKATLTIGKVQAEDEADYYCSTSS
Ellobius lutescens V393 trdv LOEQ01051728.1 273 VSLDVSLEQVDQISVVAGDHAIFYCTVTGGDLRKFQMSWYKKGEDNALILVYKLNNSSTEDLMGNFKGKIDISESRFILDIQKATWKDSGTYYCGSD
Ellobius lutescens V595 trgv LOEQ01002557.1 511158 RQTSPNLKERIMSITRPMGSSVIITCDVRTTYSYIHWYRFQEGRTPQYLLSYDFISSTTMVDSGLSSEKYHVYEGTDKTYKFVLRNVEESDAGLYYCASWT
Ellobius lutescens V596 trgv LOEQ01002557.1 501890 GLGKVEQPEISVSRATDETAQISCKVSINSFKSVAIQWYWQKPNQGLQFLLYVMATPTHILLDETKKMEASKNSSASTSTLTIYSLKEEDEAIYYCSYG
Ellobius lutescens V597 trgv LOEQ01002557.1 495603 GDSWISQDQLSYTRRPNKTVHISCKLSGVPLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Ellobius lutescens V598 trgv LOEQ01002557.1 451106 GLGQLEQPEMSVTKAIGENAQIACKVPPDLGDTDIHWYRQKENQQFDYLINVRQNYNQRPLDGINKKIEVSKDRQTSTSTLKVNFLKKEDEAFYYCAIWT
Ellobius lutescens V705 trav LOEQ01006376.1 202353 DVQAQSVTQLDAHVTVFEGHLVELRCSYSYSGAPYLFWYMQRPGQGLQLLLSYRSGSSVVRGVNGFEADFQKSNSSFHLKKASVHLSDSAVYFCALS
Ellobius lutescens V706 trav LOEQ01006376.1 191316 RTHGDSVTQTGGQVTISEGGFLTINCTYIITNIGSPGLFWYVQYPGESLQFLLKVLTAGAKGSSRGFEATYDKGSSSFHLQKASVQESDSAVYYCALS
Ellobius lutescens V707 trav LOEQ01006376.1 144240 VSQGEQVEQSPSTLRVQDGASAVINCTYVDRTSYNFLWYKQGPGEHPKHIVDIHSNMERKHDERLIVLLDKKAKHFSLHITYAQAEDSAMYFCATD
Ellobius lutescens V708 trav LOEQ01006376.1 142543 RSNGDSVTQTEGLVTVPEGSPVMLNCTYQTTYSSSFPLWYVQYLSKAPRLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALS
Ellobius lutescens V709 trav LOEQ01006376.1 30730 VSQGEQVEQRPSILRVQEGNRVVINCTYVDSALSYFPWYKQEPGKHPKLITDIRSNMERKQDQRLIISHDKKDKHFSLHITDTQPGDSAMYFCAAS
Ellobius lutescens V710 trav LOEQ01006376.1 22857 VNSQEKVQQTPEFLGVSEGAMASLNCTSSDRNYNYFWWYKQYPGKGPMFLMSIFSNGEKKEGRFTVHLNQDSLHVSLHIRDSQPSDSAVYLCAV
Ellobius lutescens V718 trav LOEQ01006855.1 122950 GSQGEKVEQHPSTMSVQEGDSTIINCTYTDNASVYFPWYKQEPGKQPQFIIDIRSNVERKQSQRLTLLLNKKVKHLSLHVTATQPGDSAIYFCAAD
Ellobius lutescens V719 trav LOEQ01006855.1 107468 VNSQLGEENPWALSIQEGENVTVNCSYKTSIAVLQWYRQDAGRGPAMLILVRSNEREKHSGRLRVTLNTSPQSSSLSITAVQPEDTAVYFCATD
Ellobius lutescens V720 trav LOEQ01006855.1 98652 ESNGDSVTQSEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRVSKANNKGSSRGFEATYDKESSSFHLQKVSVQESDSAVYYCALG
Ellobius lutescens V721 trav LOEQ01006855.1 74134 RTNGDSVTQTEGLVTVIEGSPVMLNCTYQTTYSAPFVFWYVQYLNKAPQLLLKSSTDNKRTKHQGFHATLHKSSSSFHLQKSSVQLWDSALYYCALS
Ellobius lutescens V722 trav LOEQ01006855.1 30353 VSYGVQVEQHPSILTIQEGSSAVINCTYVDSASSYFLWYKQGHGKHPKVIIDIRSNMEKKQDQRLIVLLDKKSKLFSLNITDTQPGDSAMYFCATD
Ellobius lutescens V723 trav LOEQ01006855.1 18128 RTHGDSVTQTEGQVTLSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDKESSSFHLQKVSVQESDSAVYYCALG
Ellobius lutescens V724 trav LOEQ01006855.1 7060 VRSQQKVQQNPEFLSVSDRTTASLNCTFSDSASQSFWWYTQNPGKEPKSLMSIFSNGEKKKGRFTIQLNKSSLLVSLHIRDSQPSDSAVYLCAV
Ellobius lutescens V727 igkv LOEQ01007246.1 65355 STGDVVMTQTPTSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKPGQSLKLLIYKVSNRFSGVSDRFSGSGSGTDFTLKINRVEPEDLGVYYCFQS
Ellobius lutescens V728 igkv LOEQ01007246.1 34934 SRCDIQMIQSPSQTASLGDTVTIKCQASQNINNELNWYQQKPGKSPKLLIYAASRLFAGVPSRFSGSGSGRDFTLTISSVMTEDIATYYCKQDLTY
Ellobius lutescens V729 igkv LOEQ01007246.1 9805 IRGNILMAQSPSSLSASLGDRVTISCQASQGISNYLNWYQQKPGNAPKLLIYYASNLENGVPSRFSGSGYGTDFTLTISSLEPEDTAIYYCQQTSNLP
Ellobius lutescens V737 ighv LOEQ01008256.1 92351 ALYQIQLKETGPGLVQPSQTLSLTCTVSGISLMSNVVHWIRQPPGKSLQWMGGIWSGGSTEYNSALQSRIRFSRDTSKSQVFLNLNSLQTEDTAMYYCAR
Ellobius lutescens V738 ighv LOEQ01008256.1 67395 VQCEVQLVESGGGLVQPGKSLKLSCVASGFTFSNYWMGWVRQAPEKALEWVASIYNSNNIYYADAVKGRFTISRDNAKNTLYLEMGSLKSEDTAIYYCAR
Ellobius lutescens V745 igkv LOEQ01009259.1 48856 SRGDIQVTQSPSSLSASLGDRVTITCRTSQDISRYLRWFQQKPGKAPKLLIYGASSLADGVPSKFSGSGSGTDYSLTISSLESEDIANYYCLQYHKYP
Ellobius lutescens V746 igkv LOEQ01009259.1 30085 ARCDIQVTQSPFLSASLGDKVTITCLASQSISNDLNWYQQKSGQAPTLLIYYANSLQSGVPSRFSGQYSGKSFTLTIGSVEPEDVGTYFCLQHYSV
Ellobius lutescens V748 igkv LOEQ01009346.1 21721 ARCDIQVTQSPSSLSVSLEGRITITCKTSQDVSNFMAWYQQKPGEVPKLLIYYASTLQSGVPQRFSGSGSGTDFSFTINRLEPEDTATYYCQLGYGL
Ellobius lutescens V751 trbv LOEQ01009559.1 83588 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHNYIYWYYKKPGEELKFLAYFQNADIIDKIDRIGKNILAKCPINLPCTLELQSSQLTDSAVYFCASSQ
Ellobius lutescens V752 trbv LOEQ01009559.1 74122 SLDGQVIQTPKRLFRGKGQKAKMSCIPESGHTFVYWYQQKQNKELKFLIYFQRQEVRERIDFVKERFVAECPINSPCSLEIQSSEAGDSALYLCASSL
Ellobius lutescens V753 trbv LOEQ01009559.1 72436 FCDAAVTQTPRHLIKMKRQKATMKCSPEKGHTAVYWYQQKQGKELKFLIYLQNKQPLDQIDMVKERFSVEFLSDSDCSLEIKSSEAGDSALYLCASSQ
Ellobius lutescens V754 trbv LOEQ01009559.1 70431 SFDAKVIQTPRHLVKEKGQKANMGCFPEKGHTAFYWYQQSQTELKLLINFRNEEIIEQTDMVKKRFSAECPSNSPCSLEIQSSEAGDSGLYFCASSQ
Ellobius lutescens V755 trbv LOEQ01009559.1 56382 LLNGEVIQTPRYLVKGKEQKAKMSCSPEKGHAVVFWYKQNNNNEFTFLISFQNQEVLQQIDMVKNRFSAECPLNSPCSLEIQSSEAGDSALYLCASSQ
Ellobius lutescens V756 trbv LOEQ01009559.1 21791 LMDMDVTQTPRYLVKKMGEEVLLECVQDMGHERMYWYRQDPGLGLWLIHFSYDVDSNSERDIPEGYRVSWKKREHFSLILESAKTSQTSVYFCATSL
Ellobius lutescens V757 trbv LOEQ01009559.1 14504 SVFSVLVSQKPKRDICQSGTSLKIQCVLDSQATAMFWYRQVPGQSLVLMATANEGSEATYEKEFTKDKFPISRPNLTFSTLMVSNAKPEDSSFYFCSAG
Ellobius lutescens V761 ighv LOEQ01010005.1 15049 VHSQVQLYQSGPELGKPGTSVKLSCKASGYTFTSYYVSWVKQSPGQGLEYIGYINPSNGGTGYAQKFQGKAKFTVDTSSSTAYMELSSLKSGDSAIYYCA
Ellobius lutescens V773 trav LOEQ01011444.1 28860 AASKTQVEQSPKSLVVLQGDSCILHCNYTVSPANSLRWYRQDTGRGLVSLALMTYIENKKSNGRYSAILNADTKNSTLHITAAQLEDTAFYICVVG
Ellobius lutescens V774 trav LOEQ01011444.1 20299 VSSQQKLQQNPEFLSVPEGAMASLNCTFSDGASDNFRWYRQQPGKGPELFMSIFSSGEKEEGRFTIHLNKDSRHVSLHIRVSQPSDSAVYFCAVR
Ellobius lutescens V775 trav LOEQ01011444.1 10236 RSNGDSVTQTEGQVTVTEGLPVKLNCNYETTYTSPFLLWYVQHPRKAPQLLLNTFTDKKRIEHQGFYVGLNKSSSSFHLQKSSVQLWDSALYYCALR
Ellobius lutescens V784 trbv LOEQ01012232.1 45023 RTDAGVTQSPRHEVAKKGQTVTLACEPVSGHTDLFWYRQTKTQGLELLRYFRSKSLMEDDKTGKDRFTAEMLDSSVSTLKIQPTEPQDSAVYLCASSL
Ellobius lutescens V785 trbv LOEQ01012232.1 30792 PTNAGVTQTPRHKVTKMGQEATLRCEPIPGHSGVSWYRQTTVKELEFLISFRNQAPIDDTGMPKERFSAQMPNAKLSTLKVQTTQPQDSAVYLCASSL
Ellobius lutescens V786 trbv LOEQ01012232.1 20621 CVDAMVMQNPRYKIARVGKPVNLSCSQSLNHDVMYWYQQKPNQAPKFLLYYYDTTLNREADTSENFHSNRPNTSFCSLGIHSAGLGDSSMYLCASSR
Ellobius lutescens V787 trbv LOEQ01012232.1 7010 STHGAITQTPKFLVGLQGQRLTMECQQDFNHDAMYWYRQDPGKGLRPIYYSITEKDIQKGELSEGYSVSREKKPFFPLTVTSAQKIQTAVYLCASS
Ellobius lutescens V789 igkv LOEQ01012237.1 7614 ARSNIQITQSPASLSVSLGDSVTMTCQASQNIYSSLAWYHQKPGKPPKLLIYGANSLADGVPMRFSGSGSGTQYSLRISNLQSEDTAKYYCLEGRYS
Ellobius lutescens V790 ighv LOEQ01012313.1 34209 VQAEVLLVQSGSELKQPGQSVKISCKASGYTFTDYAMNWVKQEPGQHLKWMGYINTYTGEPNYADDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCAR
Ellobius lutescens V793 igkv LOEQ01012915.1 15964 SWGQVVLTQSPASMAVSQGEKVTITCSSSASTSYLHWYQQKPEASPKLLIYRVSNLASGVPARYSGSSSGTSYSLTISSIQAEDAATYYCQQGSSY
Ellobius lutescens V795 trbv LOEQ01013406.1 7757 PVSAGIIQTPKSMLMKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDIPEGYNVSRSHTEDFSLTLESASPSQTSVYFCASSN
Ellobius lutescens V796 trbv LOEQ01013406.1 5048 LTNAGVSQSPLYRIIKRGQETALECDPVSGHRGLYWYRQNLGQGPVFMVYFLDERLSDKSGMPNDRFSAVRPEGSVSTLKIQSTDEEDSGIYLCASSL
Ellobius lutescens V797 trbv LOEQ01013406.1 1031 LTDAGITQTPRYWITQTGRKMTLECSQNMNHYSMFWYRQDAGERLKLIYYSGSVGSTTKGDVPEGYSVFRNKTEHFPLTLGSARPSQTSTYFCASS
Ellobius lutescens V798 iglv LOEQ01013959.1 12100 SWAEVVYTQPQSLSGSLGQKITISCTRSSGSIDSNSVSWYLQRSANTPRLLIYRYDLRPSGAPDRFSGSKDSSSNSATLTISGLQAEDEADYYCLSGYDNY
Ellobius lutescens V801 ighv LOEQ01014431.1 4575 VQCEVQLLESVGGLVQPGKSLKLSCAASGFTFSDYWMNWVRQAPGKGLQWVAEINQDGGSTYYIDSVKGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCTR
Ellobius lutescens V802 ighv LOEQ01014652.1 11308 VQCNVQLVETGGGLAQPGGSIKLSCLASGFTFSDYWMYWVRQAPGKGPEWVGVIKHKPNNYETHYAESVKGRFTISRDDSRSILYLQMNSLRVEDTAIYYCTT
Ellobius lutescens V812 ighv LOEQ01017451.1 17599 VQCDVQLVETGGGLVQPGGSVKLSCATSGFTFSDHWMNWIRQAPGKGLEWIAVIKHKPGNYEILYAESVKSRFTISRDDSKSILYLQMNSLRAEDTAIYYCVR
Ellobius lutescens V813 trav LOEQ01017679.1 5514 VDSQQGEENPQALSIQEGEDVTMNCSYKTYSVTLQWYKQDSGRGPVMLILLRSNEKEKHSGRLRATFNTSTQSSSLSIPAAQAADTAVYFCATD
Ellobius lutescens V815 igkv LOEQ01018349.1 15181 ACADIVMTQSPSSVAVSAGEKVTISCKSSQSLFAGSYNYLAWYQQKPGQAPKLLIYRASNRYTGVPDRFTGSGSGTDFTLTINSVQSEDLANYYCQQYYSAP
Ellobius lutescens V817 igkv LOEQ01019879.1 4661 SSGDIVLTQSPSLVSVSLGQKATISCKSSESVNKYGINLMHWYQQKPGQSPKFLIYAASNLESGVPARFSGSGSGTDFTLTISHVEADDAATYYCQQGKEFP
Ellobius lutescens V819 trav LOEQ01021127.1 3127 GVRGVDVEQSPTDLSLHEGTSFALRCNFSTTIMSVQWFRQNPRGSLIRLFYLTPGTKENGRLKSTFTSKEHYSTLQIEDAQLEDAGTYLCAVE
Ellobius lutescens V824 trav LOEQ01023558.1 3127 GVRGVDVEQSPTDLSLHEGTSFALRCNFSTTIMSVQWFRQNPRGSLIRLFYLTPGTKENGRLKSTFTSKEHYSTLQIEDAQLEDAGTYLCAVE
Ellobius lutescens V827 ighv LOEQ01025857.1 2006 VNSQIQLLQSGAELVRPRASVKMSCKASGYSITEYYMHWVKQKPGQGLEWIGRIDPADDETKYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Ellobius lutescens V830 trbv LOEQ01027097.1 1031 LTDAGITQTPRYWITQTGRKMTLECSQNMNHYSMFWYRQDAGERLKLIYYSGSVGSTTKGDVPEGYSVFRNKTEHFPLTLGSARPSQTSTYFCASS
Ellobius lutescens V831 iglv LOEQ01028769.1 411 SWAEVVFTQPQFVSGSLGQKITISCTRSTGNIESNYVYWYQQHSASAPRLLIYNYDQRPSGVPDRFSGSKDSSSNSGTLTISGLQAEDEADYYCLSGYDNY
Ellobius lutescens V833 trbv LOEQ01030481.1 1924 PVDPRITQKPKHLVAVTGNERTLKCEQHLGHNAMYWYRQNAKKSLELMFSYSFQGLVENQTIQSRFQPHNPEKSYLDLQISALEPDDSATYFCASSQ
Ellobius lutescens V834 trbv LOEQ01030481.1 487 HTGPSVLQIPSHQVIHEGQMVTLSCDPVSNHLYFYWYKLILGQNIEFLVSFYNGKPMDTSKLFKEDRFSVERQDGSYFTLKIQPTTLEDSAVYFCASSL
Ellobius lutescens V835 trbv LOEQ01030482.1 1924 PVDPRITQKPKHLVAVTGNERTLKCEQHLGHNAMYWYRQNAKKSLELMFSYSFQGLVENQTIQSRFQPHNPEKSYLDLQISALEPDDSATYFCASSQ
Ellobius lutescens V836 trbv LOEQ01030482.1 487 HTGPSVLQIPSHQVIHEGQMVTLSCDPVSNHQYFYWYKLILGQKIEFLVSFYNGKPMDKSKLFKEDRFSVERQDGSYFTLKIQPTTLEDSAVYFCASSL
Ellobius lutescens V837 trav LOEQ01031742.1 1259 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIYWYRQVPLRSPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYHCILRE
Ellobius lutescens V838 trav LOEQ01036882.1 1156 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIYWYRQVPLRSPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYHCILRE
Ellobius lutescens V839 trav LOEQ01036908.1 1152 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIYWYRQVPLRSPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYHCILRE
Ellobius lutescens V840 trdv LOEQ01037848.1 1377 VSLDVSLEQVDQISVVAGDHAIFYCTVTGGDLRKFQMSWYKKGEDNALILVYKLNNSSTDDLMGNFKGKIDISESWFILDIQKATWKDSGTYYCGSD
Ellobius lutescens V843 ighv LOEQ01054905.1 387 VFSQIQLKDTGPGLVQPSQTLSLTCTVSGFSLTDYDIDWVRQPPGKGLEWMGAIWKGGGTNYSSALQSRITISRDTSNNEVFLKLNSLHTEDTAIYYCTR