WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cercocebus atys JZLG00000000.1 (JZLG01) 301 77 41 75 42 57 6 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cercocebus atys V94 trbv JZLG01012874.1 33610 HTEPEVTQIPSHQVTRMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVIFFNNNISEKSERFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Cercocebus atys V95 trbv JZLG01012874.1 40585 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Cercocebus atys V96 trbv JZLG01012875.1 692 PTDSGVTQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKAKKPPELMFVYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Cercocebus atys V97 trbv JZLG01012876.1 5872 HTEPEVTQTPSHQVTQMGQEVILQCVPIPNHLNFYWYRQILGQKVEFLVSFYNGKISEQSEIFDDRLSVGRSDGVHFTLKIKSTKLEDSAMYFCASNE
Cercocebus atys V114 igkv JZLG01015772.1 21965 SGDIILNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Cercocebus atys V115 igkv JZLG01015776.1 40514 TSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNENTYLHWYLQKPGQSPQLLIYEVSNRASGVPERFSGSGSGTDFTLKISLVEAEDVGVYYCMQT
Cercocebus atys V116 igkv JZLG01015776.1 67223 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALEFP
Cercocebus atys V145 iglv JZLG01020331.1 2884 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYDRVSWYQQHPGTAPRLLIYDVSKRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Cercocebus atys V164 ighv JZLG01023646.1 4820 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQPPGKGLEWIGNIDGNSAGTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V165 trav JZLG01023972.1 1012 LSGEDQVIQSPEALSLQEGDSSSLNCSYTVSSFRGLLWYRQHPGKGPEFLFILYSAGEEKEKERLKGTLTKKESFLHITGPKPEDSATYLCAVQ
Cercocebus atys V221 trdv JZLG01032553.1 88750 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSQGSYFAKGRFSVRHHLTQRAFHLVISPVSTEDSATYYCAM
Cercocebus atys V222 igkv JZLG01032588.1 3623 SSGDAVMTQPPLSLPVTPSEPASISCRSSHSPLHSNGYTYLNWDLQKPGQPPWLPIYLIFTWDSGVLDRFRGSGSVADFMLKISRVDTEDVGVYYCQQS
Cercocebus atys V223 igkv JZLG01032589.1 5611 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKLLIYKASSLVSGIPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQDSSYP
Cercocebus atys V224 igkv JZLG01032590.1 1250 TTGEIVMTQSPATLSLSPGERATISCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCQQESSW
Cercocebus atys V225 igkv JZLG01032591.1 3649 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Cercocebus atys V226 igkv JZLG01032591.1 19213 TTGETVVTQSPATLSLSPGERATISCRTSQSVGSRLAWYQQKPGQAPRLLIYGASNRATGIPDRFSGSGSGTDFTLTISSLKPEDAAVYYCQQDNDWK
Cercocebus atys V227 igkv JZLG01032592.1 43648 CNGDIVLTQSPASLAVSPGQRATITCRASESVSLFGINFIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKDLP
Cercocebus atys V228 igkv JZLG01032593.1 15343 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSNLASGVPARFSGSGYGTSYTLTISSMEAEDAANYYCQQGNSI
Cercocebus atys V238 iglv JZLG01033614.1 36865 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSYVYWYQQRPGSAPTTVIYSDDQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSG
Cercocebus atys V239 iglv JZLG01033615.1 35331 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Cercocebus atys V240 iglv JZLG01033615.1 44988 SWAQSVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAATKLLIYDVNKRPSGVPDRFSGSQSGTSATLGITGLWPEDEADYYCLAWNSSLSA
Cercocebus atys V241 iglv JZLG01033615.1 50332 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTAPKLLIYGNNKRPSGVSDRFSGSQSGTSASLAITGLQSEDEADYYCQSYDSSLS
Cercocebus atys V242 iglv JZLG01033615.1 65363 SLSQPVLTQPPSASASLGASVTLTCTLGSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGV
Cercocebus atys V243 iglv JZLG01033615.1 85728 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCAAWDNSLSS
Cercocebus atys V244 iglv JZLG01033615.1 99265 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSSNYPSWFQQKPGQAPRALIYSTNSKYSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCSLYYSGA
Cercocebus atys V245 iglv JZLG01033615.1 103931 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIHWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Cercocebus atys V246 iglv JZLG01033615.1 108820 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLTITGLRSEDEAHYYCEAWDNSLS
Cercocebus atys V247 iglv JZLG01033615.1 117893 SNSQAVVTQEPSMTVFPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPRTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLLYYSGA
Cercocebus atys V248 iglv JZLG01033615.1 125504 SLSQPVLTQPASLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Cercocebus atys V249 iglv JZLG01033615.1 130338 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVSWYQQLSGTAPKLLIYKNNQRPSGVPDRFSGSKSGNSASLAISGLQSKDEADYYCAAWDDSLNG
Cercocebus atys V250 iglv JZLG01033615.1 143564 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGRHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCW
Cercocebus atys V251 iglv JZLG01033616.1 6761 SLSQPVLTQPTSLSASLGASARLTCTLSSGINVGSYSIYWYQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQSDDEADYYCAI
Cercocebus atys V252 iglv JZLG01033616.1 17490 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRGYVSWYQQVPGTAPKLLIYDNNKRPSGISDRFSGSKSGNSASLAITGLQTEDEADYYCAAWDNSLS
Cercocebus atys V253 iglv JZLG01033616.1 21671 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYYVSWYQQFPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQPGDEADYYCEAWDNSLS
Cercocebus atys V254 iglv JZLG01033616.1 26694 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVHWYQQVPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSGSLTITGLQSGDEADYYCQSYDSSLS
Cercocebus atys V255 iglv JZLG01033617.1 4544 SRAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYNVYWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLQTEDEADYYCQSYDSSLS
Cercocebus atys V256 iglv JZLG01033617.1 26636 SLSQPVLTQPASLSASPGASASLTCTFSAGYYIYWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Cercocebus atys V257 iglv JZLG01033617.1 31179 SWAQSVLTQPRSASEATRKSVTISCSGSSSNIGSNDVSWYQQLPETAPKLLIYYDDQRASGVSDRFSGSKSGNSASLAISGLQTEDEADYYCAAWDDSLSS
Cercocebus atys V258 iglv JZLG01033618.1 56325 LTSQAKVIQETSRTTNPGETITLTCGSSAGAVTISSYADWFQQKPNQVPRGLIGDNTYRNLNVPERFSGSLRGGKAVLTITGAQPEDEAFYYCALW
Cercocebus atys V260 iglv JZLG01033623.1 15813 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTVSGAQAEDEADYYCYSGDGNS
Cercocebus atys V261 iglv JZLG01033623.1 24985 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Cercocebus atys V262 iglv JZLG01033624.1 5471 SATSYELTQPPSVSVSPGQTARITCGGDSIGSEAVHWYQQKPPQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQMWDISSDH
Cercocebus atys V263 iglv JZLG01033624.1 12573 SVVSSELTQEPALSVALGHTVSMTCQGDSLSSYYASWYQQKPGQVPVLVIYGNTNRPSGIPGRFSVSWSGNTASLTITGAQVEDEADYYCGSWDNSGDH
Cercocebus atys V264 iglv JZLG01033624.1 28779 SVASYQLTQPRSVSVSPGQTARITCGGDSIGSKNVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSKH
Cercocebus atys V265 iglv JZLG01033625.1 3905 SWAQAALTQPPSVSGSPGQSVTISCTGTSNDVGGYNYVSWYQQHPGKALKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYSGS
Cercocebus atys V266 iglv JZLG01033625.1 21725 SAASYDLTQPPSVSVSPGQTARITCGGDSIGSKVVNWYQQKPAQAPVLVIYSDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Cercocebus atys V267 iglv JZLG01033625.1 29679 SVVSSELTQDPSVSVALGQTVRITCQGDSLRSSYASWYQQKPGQAPVLVVYGNNYRPSAIPERFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGNH
Cercocebus atys V268 iglv JZLG01033625.1 48198 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSR
Cercocebus atys V269 iglv JZLG01033625.1 73107 SATSYELTQPPSVSAASGQTARITCGGDSIGSKNVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSEH
Cercocebus atys V270 iglv JZLG01033625.1 85227 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Cercocebus atys V271 iglv JZLG01033626.1 2780 SEASYELTQPPSVSVSTGQMARITCSGDTLAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Cercocebus atys V272 iglv JZLG01033626.1 19470 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNRVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYAGS
Cercocebus atys V273 iglv JZLG01033627.1 10078 SWAQAALTQPHSVSGSPGQSVTISCTGTSSDIGGYDRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Cercocebus atys V274 iglv JZLG01033627.1 33752 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYQQQPGTTTKLMMYNVNMWPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Cercocebus atys V275 iglv JZLG01033627.1 53296 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPRYIMKVNSDGNHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Cercocebus atys V276 iglv JZLG01033627.1 66059 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPRYIMKVNSDGNHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Cercocebus atys V341 trav JZLG01044248.1 1532 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISANEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCILRV
Cercocebus atys V343 trav JZLG01044267.1 3908 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHVTLRDTAVYYCIVRV
Cercocebus atys V347 ighv JZLG01045079.1 31304 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKAEDTAMYYCAR
Cercocebus atys V348 ighv JZLG01045079.1 34916 VLSQVQLQESGPGLVKPPETLSLTCAVSGGSFSSSYWSWIRQPPGKGLEWIGYIGGSSGSTNYNASLKSRATISTDTSKNQFSLKLSSVAAADTAVYYCAR
Cercocebus atys V349 ighv JZLG01045079.1 86578 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGYIRSKSNNYATQYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTT
Cercocebus atys V350 ighv JZLG01045079.1 107167 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMHWVRQAPGKGPEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Cercocebus atys V351 ighv JZLG01045079.1 121522 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYTMSWVRQAPGKGLEWVSSISNTGKTIYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCTR
Cercocebus atys V352 ighv JZLG01045079.1 126840 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSYISSGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Cercocebus atys V353 ighv JZLG01045080.1 4279 AHAQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Cercocebus atys V354 ighv JZLG01045080.1 11194 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQASGKGLEWVSGISNTGGSTWYADSVKGRFTISREDAKNTLYLQMDSLRAEDTAVYYCAR
Cercocebus atys V355 ighv JZLG01045080.1 22781 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Cercocebus atys V356 ighv JZLG01045080.1 32024 VQCEVQLVESGGGLVQPGASLRLSCAASGFTFGDYTMHWVRQAPGKGLEWVSYISSASSYIHYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCTR
Cercocebus atys V357 ighv JZLG01045080.1 37332 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPSGKALEWLANIYWDDGKYYSPSLKSRLTISKDTSKKQVVLTMTNMDPVDTVTYYCARG
Cercocebus atys V358 ighv JZLG01045083.1 25067 AHSEVQLVQSGAEVKKPGASVKVSCKVSGYTFTELSMQWVRQAPGKGLEWMGGVDPVYGETIHAEKFQGRVTVTEDTSTDTAYMELSSLRSEDTAVYYCAR
Cercocebus atys V359 ighv JZLG01045083.1 38454 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMQWVRQAPGKGPEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIASLQMNSLRAEDTAVYYCAR
Cercocebus atys V360 ighv JZLG01045083.1 43819 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLAQIYWTDSKDYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARG
Cercocebus atys V361 ighv JZLG01045083.1 53110 AQSQVQLVQSGAEVKKPGASVKVSCKSSGFTFGSDAISWVRQAPGQGLEWMGVIIPLVGITNYAQKFQGRVTITADTSTNTAYLELSSLRSEDTAVYYCAR
Cercocebus atys V362 ighv JZLG01045083.1 65783 VLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSADTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V363 ighv JZLG01045083.1 78450 VQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYWSWIRQAPGKGLEWIGYIHGGGSTNYNPSLKSRVTMSADTSKNQFSLKLSSVTAADTAVYYCA
Cercocebus atys V364 ighv JZLG01045083.1 97049 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMQWVRQAPGQGLEWIGWIYPYNGNTKYAQNFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAK
Cercocebus atys V365 ighv JZLG01045083.1 99958 VQCEVQLVESGGGLVQPGGFLRLSCAASGFTFGDYGMSWVRQAPGKGPEWVGLIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMSSLKTEDTAVYYCTR
Cercocebus atys V366 ighv JZLG01045083.1 106769 VQCEVQLVESGGDLVKPGASLRLSCAASGFTFGDYGMSWVRQAPGKGLEWVSYISYTGKTIYYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCTT
Cercocebus atys V367 ighv JZLG01045083.1 121136 VRCEVQLVESGGGVVQPEGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAISWSGSSTYYADSVKGRFTISRDNAKNSLFLQMNSLKTEDTAMYYCAKD
Cercocebus atys V368 ighv JZLG01045083.1 143650 VQCEEQLVESGGGLVQPGASLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVSAISVGGGTYYPDSVKGRFTISRGNAKNSLYLQMNSLRAEDTAVYYCAR
Cercocebus atys V369 ighv JZLG01045083.1 150422 AHSHVQLVQSGAEVKQPGSSMKVSCKASGYTFTSSVMQWVRQAPGQGLQWIGRICPYNGNTKYAQNFQGRVTMTTDTSTSTACIELGSLRSQDTVVYYCAK
Cercocebus atys V370 ighv JZLG01045083.1 166259 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISVSYHWSWIRQAPGKGLEWIGSIYGSSGNTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V371 ighv JZLG01045083.1 182027 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFTSYWMHWVRQAPGKGLEWVSAINSAGGSTYYADSVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAK
Cercocebus atys V372 ighv JZLG01045083.1 198611 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQAPGKGLEWIGIIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V373 ighv JZLG01045083.1 220142 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKRLEWVSAINSDGSSTSYADSMKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTT
Cercocebus atys V374 ighv JZLG01045083.1 228200 VQCEVQLVESGRGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGPEWVGFIRNKANGGTAEYATSVKGRFTISRDDSKSITSLQMNSLKTEDTAVYYCAR
Cercocebus atys V375 ighv JZLG01045083.1 237877 VRCEVQLVESGGGLVQPGRFLRLSCAASGFTFSNHYMDWVRQAPGKGLEWVGRIRNKANSYPTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Cercocebus atys V376 ighv JZLG01045083.1 246907 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMHWARQAPGKGLEWVSRISSGSGSSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Cercocebus atys V377 ighv JZLG01045083.1 254443 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVGFIKNKADGGTADYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTT
Cercocebus atys V378 ighv JZLG01045083.1 269557 VQCEVQLAEAGGGLVQPGGSLRLSCAASGFTFSSYEMHWVRQAPGKGLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCAR
Cercocebus atys V379 ighv JZLG01045083.1 275211 AHAQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMHWVRQAHGQRLEWMGWVNTNTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCAR
Cercocebus atys V380 ighv JZLG01045083.1 292778 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTDYYLSWVRQAPGKGLEWMGCIDPEDGEAIYAQKFQDRLTMTADTSTDTAYMELSSLRSEDTAVYYCA
Cercocebus atys V381 ighv JZLG01045083.1 300894 VQCEVELVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Cercocebus atys V382 ighv JZLG01045084.1 8120 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYVSWVRQAPGKGLEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSIASLQMSSLKTEDTAVYYCAR
Cercocebus atys V383 ighv JZLG01045084.1 25062 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYWWSWIRQPPGKGLEWIGRIDSSGSTEYNPSLKSRATISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V384 ighv JZLG01045084.1 38137 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSGISSGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Cercocebus atys V385 ighv JZLG01045084.1 50546 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYAMHWVRQAPGKGLEWVSVISTSGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCMR
Cercocebus atys V386 ighv JZLG01045084.1 54486 VLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCA
Cercocebus atys V387 ighv JZLG01045084.1 74113 VLSQVTLKESGPALVKPTQTLTLTCTLSGFSISTSGTGVGWIHQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Cercocebus atys V388 ighv JZLG01045084.1 85185 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRLTISRDNAKNSLSLQMNSLRAEDTAVYYCAK
Cercocebus atys V389 ighv JZLG01045101.1 5166 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFSTYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Cercocebus atys V390 ighv JZLG01045101.1 14762 AHSQVQLVQSGAEMKKPGSSVKVSCKASGYTFTSSAMQWVRQTPGQGLEWIGWIIIGNGNTNYAQKFQGRVTITRDTSTSTGYMELSSLRSEDTAVYYCAA
Cercocebus atys V406 ighv JZLG01048381.1 25895 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMNSLKTEDTALYYCT
Cercocebus atys V407 ighv JZLG01048381.1 36283 LVQPGRSLRLSCAASGFTFSSYGMHWVCQAPEKGLEWVSYIGSSTMYYAGSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCGRTW
Cercocebus atys V408 ighv JZLG01048381.1 51115 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMLVSWIRQPPGKALEWLALIYWDDGKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARG
Cercocebus atys V409 ighv JZLG01048381.1 74946 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMYWIRQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMNSLRTEDTAVYYCAK
Cercocebus atys V410 ighv JZLG01048381.1 98598 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLAHIYWTDSKYYSPSLKSRLTISKDTSKNQVVLTITNADPVDTATYYCARG
Cercocebus atys V411 ighv JZLG01048382.1 5808 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYWWGWIRQPPGKGLEWIGIIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V412 ighv JZLG01048384.1 14186 VQCEVQLVETGGGLVQPGGSLRLSCAASGFTFSSYGMHWARQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISRENAKNTLYLQMNSLRAEDTALYYCAR
Cercocebus atys V419 ighv JZLG01049808.1 6771 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYHYWSWIRQAPGKGLEWIGYISYSGSTNYNPSLKSRVTITTDTSKNQFSLKLSSVTAADTAVYYCAC
Cercocebus atys V420 ighv JZLG01049811.1 25886 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGGYGWSWIRQPPGKGLEWIGSIYGSSGNTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V421 ighv JZLG01049819.1 20994 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGWIILSAGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCGG
Cercocebus atys V422 ighv JZLG01049819.1 30452 AHSQVQLVQSGAEMKKPGASVKVSCKASGYTFTSSAMQWVRQTPRQGLEWIGGIIIGNGNTNYAQKFQGRVTITRDRSMSTAYMELSSLRSEDTAVYYCAA
Cercocebus atys V430 igkv JZLG01051028.1 870 AKCDIQMTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTDVPSRFSGSGSGTDFTPTISSLQPEDAATYYCFQ
Cercocebus atys V438 ighv JZLG01053127.1 5601 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQTPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Cercocebus atys V439 ighv JZLG01053131.1 5957 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYNINWVRQAPGQVLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Cercocebus atys V440 ighv JZLG01053131.1 20145 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFGTYAISWVRQAPGQGLEWMGVIIPLVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Cercocebus atys V441 ighv JZLG01053131.1 45336 VLSQVQLKESGPGVVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGGIYSNSGSTSYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V442 ighv JZLG01053131.1 64425 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYSINWVRQAPGQGLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Cercocebus atys V443 ighv JZLG01053131.1 75419 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISGYYLWSWIRQPPGKGLEWIGYIYGSSGSTSYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCA
Cercocebus atys V444 ighv JZLG01053134.1 15273 VQCEVQLVESGGGLVQPGRFLRLSCAASGFTFSSYNMHWVRQASGKGLEWVSGISNGGGSTWYADSVKGRFTISREDAKNTLYLQMNSLRAEDTAVYYCAR
Cercocebus atys V445 ighv JZLG01053134.1 23331 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVHQTPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITSLQMNNLKTEDTALYYCPR
Cercocebus atys V446 ighv JZLG01053134.1 26818 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYDWSWIRQPPGKGLEWIGYISYSGSTNYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V447 ighv JZLG01053134.1 38055 VQCEVQLVESGGGLVQPGESLRLSCAGSGFTFSSYGMSWVRQAPGKGLEWVSVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLRVEDTAVYYCAK
Cercocebus atys V448 ighv JZLG01053135.1 18114 VQCEVQLVESGGGSVQPGASLRLSCAASGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Cercocebus atys V449 ighv JZLG01053135.1 25336 VSAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSSWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFEGHVTISADKSISTTYLQWSSLKASDTATYYCAK
Cercocebus atys V450 ighv JZLG01053135.1 71962 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTHYPDSVKGRFTISRDNAKNTVYLQMNSPRAEDTAMYYCAR
Cercocebus atys V451 ighv JZLG01053135.1 81340 VQCEVQLVEYGGGLVQRGGSLRLSCGFTFSVHFMSWVHQAPAKGLEWVGFMRNKANGGTTEYATSVKGRSTISRANSKSMASLQMSSLKTEDTAVYYCAR
Cercocebus atys V452 ighv JZLG01053135.1 110443 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Cercocebus atys V453 ighv JZLG01053136.1 5034 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVARIKSKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Cercocebus atys V454 ighv JZLG01053136.1 24758 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSHWMHWVRQAPGKGLEWVSAINSAGGSTYYADSVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAR
Cercocebus atys V455 ighv JZLG01053136.1 62708 VSAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDSATYYCA
Cercocebus atys V467 iglv JZLG01054883.1 3360 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVHWYQQRPGSAPTTVIYEDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSYN
Cercocebus atys V485 igkv JZLG01058225.1 1153 TTGEIVMTQSPATWALSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVAVYFCQQDYSWP
Cercocebus atys V486 igkv JZLG01058226.1 16322 ARCDIQMNQSPSSLSASVGDKVTITCRASQGISNNLAWYQQKPGKVPKLLIYDASSLASGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQHNSLP
Cercocebus atys V487 igkv JZLG01058227.1 811 TTGEIVMTQSPATLSLSPGERATLSCTASQSVGSCLSWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYFCLQSNNW
Cercocebus atys V488 igkv JZLG01058228.1 6254 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Cercocebus atys V489 igkv JZLG01058229.1 1216 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLETEDVAVYFCQQESSW
Cercocebus atys V490 igkv JZLG01058231.1 6728 AKCDIQMTQSPSSLSASVGDRVTITCQASQGISNWLAWYQQKPGEAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Cercocebus atys V504 igkv JZLG01060416.1 9058 TTGEIVLTQSPATLSLSPGERATLSCRASQSVGSYLAWYQQKPGQVPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCLQRSNW
Cercocebus atys V505 igkv JZLG01060421.1 4077 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQRNSYP
Cercocebus atys V506 trav JZLG01060784.1 2045 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFKSGEAKKNSSLHITATQTTDEGSYFCA
Cercocebus atys V507 trav JZLG01060786.1 10776 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYLCAVS
Cercocebus atys V521 trav JZLG01064203.1 138047 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVNQTDYSIRIRDVLPEDAGTYYCVKLRV
Cercocebus atys V547 trbv JZLG01069874.1 8246 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVYFYNDNISEKSELFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Cercocebus atys V548 trbv JZLG01069877.1 9365 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDEISDKSEMFDDRFSVGRSDGSNFTLKIKSTKLEDSAMYFCASSE
Cercocebus atys V549 trbv JZLG01069877.1 15872 PLDTAVFQTPKYLVTQTGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPDSLDKAHLNLHIKSVELGDSAVYFCASSQ
Cercocebus atys V550 trbv JZLG01069877.1 20213 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLHLHLRALQPEDSALYLCASSQ
Cercocebus atys V551 trbv JZLG01069877.1 31118 PVEAGVSQTPRSLIKMRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRQKGNFPSRFSGRQFSNSRSEMNVSTLELEDSALYLCASSL
Cercocebus atys V552 trbv JZLG01069877.1 38882 PANAGVTQSPKFQILKTGQSMTVQCAQDMNHNSMYWYRQDPGMGLRLIHYSAAEGTTDPGEIPDGYSVSRLNKTDFLLRLESAAPSQTSVYFCASSE
Cercocebus atys V553 trbv JZLG01069877.1 53496 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPNRFSPKSPDKAHLNLHIKSMELGDSAVYFCASSQ
Cercocebus atys V554 trbv JZLG01069877.1 56917 LMDTGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKEPAENNSVPSRFVPECPDSSLFYLHLRALQPEDSALYLCASSQ
Cercocebus atys V555 trbv JZLG01069877.1 75060 YTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Cercocebus atys V556 trbv JZLG01069877.1 97426 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAVDDSGLRSDRFSATRPEGSVSTLKIQRTEQGDSAMYFCASSL
Cercocebus atys V557 trbv JZLG01069877.1 102472 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQAPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Cercocebus atys V558 trbv JZLG01069877.1 105158 SVDAGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGEEREKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Cercocebus atys V559 trbv JZLG01069877.1 113155 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNEGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Cercocebus atys V560 trbv JZLG01069877.1 122436 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNEGVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Cercocebus atys V561 trbv JZLG01069877.1 135008 HRDAEITQSPRYKVTETGRQVILTCHQTWNHNNMFWYRQDLGHGLRLIYYSAGASIIDKGEVPDGYVVSRSKTEDFPLTLESATRSQTSVYFCASSE
Cercocebus atys V562 trbv JZLG01069877.1 144112 LTEAGVVQSPRYKVIEKSQAVTFWCDPVSGHATLYWYRQILGQGPELLVQFQNNDVVDDSQLPKDRFSTERLKGVNSTLKIQPAELGDSAVYLCASSL
Cercocebus atys V563 trbv JZLG01069877.1 161253 PVNAGVTQTPKFQILKTGQSMTLQCAQDMNHDCMYWYRQDPGMGLRLIHYSVGEGSTDKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Cercocebus atys V564 trbv JZLG01069877.1 165448 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQAPGQGPAFLTYFQNDAQLDKSGLPNDRFSAERPEGSISTLKIQRTEQGDSAVYLCASSL
Cercocebus atys V565 trbv JZLG01069877.1 173381 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHSNVYWYQQALGQGLQFILWYDEEEQRDRGTFPHRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Cercocebus atys V566 trbv JZLG01069878.1 11030 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVALYWYRRTLGQGPEFLTYFQNDAQPDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDAAVYLCASSL
Cercocebus atys V567 trbv JZLG01069878.1 21611 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSL
Cercocebus atys V568 trbv JZLG01069878.1 29554 HTGARVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQHTQQGDSAVYLCASSL
Cercocebus atys V569 trbv JZLG01069878.1 39842 LVDAGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGHQFPNYSSELNVNTSEMGDSALYLCASSL
Cercocebus atys V570 trbv JZLG01069880.1 9808 YTGAGVSQSPRYKVTKRGQDVALRCDPISGHAGLYWYQQALGQGPELLTYFSYGAQQDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDSAVYLCASSL
Cercocebus atys V571 trbv JZLG01069881.1 764 SVDAGVTQVPTHLIRTRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYDRKEERVRGNFLDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Cercocebus atys V572 trbv JZLG01069881.1 6785 LFSAGPGNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMSWYRQDPGVGLRMIHYSVGAGVTDKGEVSNGYNVSRLNTEDFPLSLESAASSQTSVYFCASSY
Cercocebus atys V573 trbv JZLG01069881.1 12731 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDAQLDKSGLPSDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Cercocebus atys V574 trbv JZLG01069881.1 21201 PVEPGVTQSPTHLIKTRGQQVILRCSPISGHSSVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Cercocebus atys V575 trbv JZLG01069881.1 28659 PGNAGVTQTPKFQLLKTGQSLTLLCAQDMNHKYMYWYRQDPGVGLRLIQYSVAAGITDKGEVPNGYNVSRLNTEDFPLRLESVALSQMSVYFCASS
Cercocebus atys V576 trbv JZLG01069882.1 9790 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFQYYEKEERVRGNFPDRFSGRQFPNYSSELNVSALLLGDLALYLCASSL
Cercocebus atys V577 trbv JZLG01069882.1 17073 PVNADVTQTPKFQVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESAAPSQTSVYFCASSY
Cercocebus atys V578 trbv JZLG01069882.1 21427 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYQAQPDKSGLPNDRFSAERHEGSVSTLTIQRTEQQDSAVYLCASSL
Cercocebus atys V579 trbv JZLG01069882.1 30642 PVDAGVAQSPTHLIKTRGQQVTLRCFPISGHNTVYWYQQALGQGPQLIFQYYRGEDRGRGNFPERFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Cercocebus atys V580 trbv JZLG01069882.1 46059 SVAAGVIQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASSL
Cercocebus atys V581 trbv JZLG01069883.1 1919 HMDAGITQSPRYKITETGTPVTLRCHQTENHRYMYWYRQDLGHGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Cercocebus atys V582 trbv JZLG01069883.1 12913 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPALLVRFENEGVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Cercocebus atys V583 trbv JZLG01069883.1 18693 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKDPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Cercocebus atys V584 trbv JZLG01069883.1 21947 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKDPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Cercocebus atys V585 trbv JZLG01069883.1 37180 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLVYLRNKASLDDSGMPKDRFSAEMPNASLATLKIQPSEPRDSAVYLCASGL
Cercocebus atys V586 trbv JZLG01069883.1 44068 HTEAGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVMGKEIKFLISFMRVSTQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQDIV
Cercocebus atys V587 trbv JZLG01069883.1 49546 HGDVMVIQNPKYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Cercocebus atys V588 trbv JZLG01069883.1 54527 SPGEEVTQTPKHLVKGEGEKAKLYCDPIKGHSYVFWYQQVLRKEFKFLISFQNENVFDETGMPKERFSAKCPANSPCSLEIQATKLKDSAVYFCASNQ
Cercocebus atys V589 trbv JZLG01069884.1 2084 LSNTGITQNPGHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKERFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Cercocebus atys V590 trbv JZLG01069884.1 5246 TVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQNGDIAEGYSVSWERKESFPLTVTSAQRNPTAFYLCASSI
Cercocebus atys V591 trbv JZLG01069884.1 13212 GSGLAAVVSQYPSRFICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNGGSDVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Cercocebus atys V593 trbv JZLG01069884.1 32286 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQDEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Cercocebus atys V594 trbv JZLG01069884.1 43994 SMDANVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDKNKGEISDGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Cercocebus atys V595 trbv JZLG01069884.1 52448 LMEADIYQNPRHRVIETGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Cercocebus atys V596 trbv JZLG01069884.1 88460 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSSNVELVDKGDIPEGYNVSRKEKTTFPLILESPSPSQTSLYLCASSL
Cercocebus atys V597 trbv JZLG01069884.1 93790 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Cercocebus atys V598 trbv JZLG01069884.1 113696 SVFSAVVSQKPSSDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Cercocebus atys V656 trgv JZLG01002204.1 54382 EQFQLSISTEVKKSIDISCKIRSTNFENDVIHWYWQKPNQALEHLIYVISTKSAVHGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Cercocebus atys V657 trgv JZLG01002204.1 36199 TCGDNLITQLVTSVTKKKGKTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Cercocebus atys V658 trgv JZLG01002204.1 34197 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Cercocebus atys V659 trgv JZLG01002205.1 2792 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCILYDGTVKKESSIPSSKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Cercocebus atys V660 trgv JZLG01002206.1 11350 GRKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Cercocebus atys V661 trgv JZLG01002208.1 3699 SQKSSNLEGKTKTITGPTGSPAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Cercocebus atys V742 igkv JZLG01015760.1 42927 SIGDIVMTQTPLSLPVTPGELASISCRSSQSLLHSNGNTYLYWHLQRPGQPPQLLIYRVSNQFSGVPDRFSGSGSGTDFTLKISQVEAEDVRVYYCMQALQTP
Cercocebus atys V743 igkv JZLG01015760.1 27399 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDITTYYCQKHDNSP
Cercocebus atys V744 igkv JZLG01015760.1 17977 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQNTKAP
Cercocebus atys V745 igkv JZLG01015761.1 20168 ARCDIQLTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGI
Cercocebus atys V746 igkv JZLG01015761.1 5189 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGRTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Cercocebus atys V747 igkv JZLG01015762.1 15546 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIQEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Cercocebus atys V748 igkv JZLG01015762.1 6046 ARCDIQMTQSPSSLSASVGDRVTITCRASQGITNDLAWYQQKTGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Cercocebus atys V749 igkv JZLG01015763.1 30349 ARCDIQMTQSPSSLSASVGDTVTITCQASQSLSNYLNWYQQKPGKIPKLLIYTASSLQSGIPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGYSYP
Cercocebus atys V750 igkv JZLG01015763.1 14874 TSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSDGYTYLDWYLQKPGRSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Cercocebus atys V751 igkv JZLG01015764.1 24617 ARCDIQMTQSPSSLSASVGDRVTISCRASQNIYSNLAWYQQKPGKAPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDSATYYCQQVYSNP
Cercocebus atys V752 igkv JZLG01015764.1 6037 TSGDIVMTQTPLSLPVIPGEPASISCRSSQSLFDSDDGNTYLDWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGLYYCMQGIQLP
Cercocebus atys V753 igkv JZLG01015766.1 24768 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSYGYTNLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Cercocebus atys V754 igkv JZLG01015766.1 15192 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQRYSAP
Cercocebus atys V755 igkv JZLG01015769.1 24696 YSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Cercocebus atys V756 igkv JZLG01015770.1 23140 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYTTP
Cercocebus atys V757 igkv JZLG01015770.1 4286 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYNYLYWYLQKPGHSPQLLMYFASYRASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQS
Cercocebus atys V758 igkv JZLG01015771.1 25926 SRGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Cercocebus atys V759 igkv JZLG01015771.1 15701 ARCAIQMTQSPSSPSATVGDRVTTTCRVSQSINNILAWYQQKPGKTPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCQHGYSYP
Cercocebus atys V798 trav JZLG01022760.1 9768 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Cercocebus atys V799 trav JZLG01022761.1 938 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGFRGLFWYRQDPGKGPEFLFILYSAGEEKEKERLKGTLTKKESFLHITGPKPEDSATYLCAVQ
Cercocebus atys V800 trav JZLG01022763.1 19941 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Cercocebus atys V801 trav JZLG01022763.1 16717 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYSSNFQKSTSSFNLTIIASQVVDSAVYFCALNE
Cercocebus atys V802 trav JZLG01022767.1 2691 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLILIRSNEREKNSGRLRVTLDTSKKSSSLLIMASRAADTASYFCATD
Cercocebus atys V803 trav JZLG01022768.1 7185 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEGSATYYCALS
Cercocebus atys V804 trav JZLG01022769.1 11540 GIRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGIDGFEAEFKKSETSFHLRKTSAHISDTAEYFCAVS
Cercocebus atys V805 trav JZLG01022770.1 2981 VWSQQKEVEQNPGPLSVPEGGTASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYSSLFIRDSQPSDSATYFCAMS
Cercocebus atys V806 trav JZLG01022773.1 2073 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDDKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Cercocebus atys V807 trav JZLG01022775.1 8011 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLILQMSYDKQNATEGHYSLNFQKARKSVNLVISASQVGDSAMYFCAMR
Cercocebus atys V808 trav JZLG01022777.1 50705 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKEPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Cercocebus atys V809 trav JZLG01022777.1 28198 VWSQQKVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Cercocebus atys V810 trav JZLG01022777.1 21673 GTGAQSVTQLDSQVSVSEGAPVLLRCNYSSSFSPSLFWYVQYPNQGLQFLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Cercocebus atys V811 trav JZLG01022777.1 16119 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKHSVHWSDAAEYFCAVG
Cercocebus atys V812 trav JZLG01022777.1 2190 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIIDIRSNMAKRQGQRLTVFLNKTMKHLSLQIAATEPGDSAVYFCAEN
Cercocebus atys V813 trav JZLG01022778.1 83874 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLIYILSNMDLKRDQRVTVLLNKKDKHLSLRIADTQTEDSAIYFCAES
Cercocebus atys V814 trav JZLG01022778.1 74471 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Cercocebus atys V815 trav JZLG01022778.1 37179 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMKFNDKESNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Cercocebus atys V816 trav JZLG01022778.1 23936 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPISLTIMTFSENTKSNGRYIATLDADTKQSSLHITAAQLSDSASYICVV
Cercocebus atys V817 trav JZLG01022778.1 8232 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQYSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVY
Cercocebus atys V818 trav JZLG01022778.1 2747 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Cercocebus atys V819 trav JZLG01022780.1 25226 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLQFLLKYITGDNLVKGSYGFEAELNKSQTSFHLKKPSALVSDSALYFCAVR
Cercocebus atys V820 trav JZLG01022780.1 12289 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIENEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVS
Cercocebus atys V821 trav JZLG01022784.1 42696 MCLVLGTTGQNIDQPTEMTAMEGATVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Cercocebus atys V822 trav JZLG01022787.1 1740 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQRDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Cercocebus atys V883 iglv JZLG01031609.1 12050 VDSETVVTQEPSLSVSSGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCTLYMGSGI
Cercocebus atys V891 trdv JZLG01032554.1 18726 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Cercocebus atys V892 trav JZLG01032555.1 177443 SGRADWLEPQETEVSGTEGKTVNLLCNYGISSGSYFDLYWFQQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTEKATNLYIRNLVPADTALYYCVL
Cercocebus atys V893 trav JZLG01032555.1 149474 SGMAQTVTQSQPEMSVREAETVTLSCTYDTSESNYYLFWYKQPPSRQMILIIHQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Cercocebus atys V894 trav JZLG01032555.1 140322 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYRS
Cercocebus atys V895 trav JZLG01032555.1 116814 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLLVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Cercocebus atys V896 trav JZLG01032555.1 99794 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINALHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Cercocebus atys V897 trdv JZLG01032555.1 14378 VSLDIILKPDTKALTVLIGEAATFRCSVIGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Cercocebus atys V898 trav JZLG01032556.1 67780 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLMTVVTGGEVKKQKRLTIQFGDARKDSSLHITATQPGDTGLYLCAG
Cercocebus atys V899 trav JZLG01032556.1 48441 VRSQQPVQSPQAVILQEGKDAIINCNSSKALYSVHWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNKKKQQSSLYLMASQLSYSGTYFCGAE
Cercocebus atys V900 trav JZLG01032556.1 25110 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Cercocebus atys V901 trav JZLG01032556.1 20375 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSFLHITAAQPSHAGIYLCGGD
Cercocebus atys V902 trav JZLG01032556.1 7469 VSGQQLNQSPHSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Cercocebus atys V903 trav JZLG01032556.1 2713 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPTFLFTLTSSGIEKKSGRLSSILDKKGLFSILNITATQTRDSAVYLCAVE
Cercocebus atys V904 igkv JZLG01032593.1 23043 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQLEPGEAPKLIIKDAATLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Cercocebus atys V905 igkv JZLG01032594.1 21152 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDRFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQL
Cercocebus atys V906 igkv JZLG01032594.1 3111 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQHNSGY
Cercocebus atys V907 igkv JZLG01032595.1 10133 ARAETILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Cercocebus atys V908 igkv JZLG01032597.1 36832 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYY
Cercocebus atys V953 igkv JZLG01041754.1 2107 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKAPGLQSGVPSMFSGSGSGTEFTLTISSLQPEDFATYYCQEFSSAL
Cercocebus atys V960 trbv JZLG01044060.1 1396 LVNAGVTQTPKFQVLKTGQSVTLQCAQDMNYNFMYWYRQDPGMGLRPIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPPRLESVAPSQTSVYFCASSY
Cercocebus atys V988 igkv JZLG01049656.1 8401 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQSYNWP
Cercocebus atys V989 igkv JZLG01049660.1 11059 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKASGLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQEFSSAL
Cercocebus atys V990 igkv JZLG01049661.1 4280 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYDATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYKSYP
Cercocebus atys V991 igkv JZLG01049662.1 52136 TTGETVMTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLVYYASSRATGIPDRFSGSGSGTEFTLTISSLDPEDVGVYYCQKYNDWP
Cercocebus atys V992 igkv JZLG01049662.1 10456 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWFQQKPGKAPKLLIYDATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQHNSYP
Cercocebus atys V993 igkv JZLG01049663.1 10254 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKHLIYAASSLQSGVPSRFSGSGSRTVFTLTISSLQPEDFATYYCLQYNSAP
Cercocebus atys V994 igkv JZLG01049664.1 21525 ARCDIQLTQSPSSLSASVGDRVTVTCRASQGISSYLAWYQQKPRKAPKLLIYDASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Cercocebus atys V995 igkv JZLG01049664.1 14999 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSAP
Cercocebus atys V996 igkv JZLG01049665.1 95344 ARCDIQMTQFPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYKSDP
Cercocebus atys V997 igkv JZLG01049665.1 82883 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASSRATGIPARFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Cercocebus atys V998 igkv JZLG01049665.1 69153 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSDP
Cercocebus atys V999 igkv JZLG01049665.1 53745 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNW
Cercocebus atys V1000 igkv JZLG01049665.1 41137 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Cercocebus atys V1001 igkv JZLG01049665.1 28364 TTGEIVMTQSPATLSLSPGETATLSCRASQSVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTAFTLTISSLEPEDVGVYHCQQYHDWS
Cercocebus atys V1002 igkv JZLG01049665.1 28145 RFSGSGSRTAFTLTISSLEPEDVGVYHCQQYHDWSPTVIQPETKTSTRPSVFTDYTSCFLYRQLVRWPLSFSISALFGSFGVHVLKSKMNYICP
Cercocebus atys V1003 igkv JZLG01049667.1 181147 SSGDIVMTQTPLSLPVTLGEPASVSCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Cercocebus atys V1004 igkv JZLG01049667.1 172826 TRCAIQMTQSPSSLSASVGDRVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGADFTLTISSLQPEDVATYYCQKCDSAP
Cercocebus atys V1005 igkv JZLG01049667.1 120634 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Cercocebus atys V1006 igkv JZLG01049667.1 91257 TTGQVILTQSPATLSLSPGERATLSCRASQSIGSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Cercocebus atys V1007 igkv JZLG01049667.1 86263 VRCDIQMTQSPSFLSASVGDRVTNTCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Cercocebus atys V1008 igkv JZLG01049667.1 37374 SSGDTVMTQIPLSLPVTPGEPASISCRSSQNLLHSDGNTYLHWYLQKPGQSPQLLIYGGSNRFAGVPDRFSGSGSGTDFTMKISRVEAEDVGVYYCTQG
Cercocebus atys V1009 igkv JZLG01049667.1 23510 SRGDIVMTQSPAFISVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLLIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Cercocebus atys V1010 igkv JZLG01049667.1 7495 VRGDIQMTQSPSSLSASVGDRVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDLTLTISSLQPEDIASYYCQQYYSYP
Cercocebus atys V1011 igkv JZLG01049670.1 7446 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSNGNTYLSWLQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Cercocebus atys V1012 igkv JZLG01049671.1 94001 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGRTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Cercocebus atys V1013 igkv JZLG01049671.1 89047 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYGVSNRASGVSDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Cercocebus atys V1014 igkv JZLG01049671.1 69634 SIGDIVMTQTPLSLPVTPGEPASNSCRSSQSLLHSDGNTYLYWYLQKPGQPPWLLIYRVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAL
Cercocebus atys V1015 igkv JZLG01049671.1 49418 ARCDIQMTQSPSSLSASVGDRVTITCRASQGIRNWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYDNSP
Cercocebus atys V1016 igkv JZLG01049671.1 39542 SSGDVVLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQGTKAP
Cercocebus atys V1017 igkv JZLG01049671.1 17930 ARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKRLIYYASSLATGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNFP
Cercocebus atys V1018 igkv JZLG01049671.1 12165 SSGDVVMTQSPLSLSVTLGQPASISCRSSQSLVHSDGKTYLNWLQQKPGQPPRRLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQG
Cercocebus atys V1031 ighv JZLG01051511.1 7585 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISGGYGWGWIRQAPGKGLEWIGGIYGSSGNTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V1032 ighv JZLG01051512.1 8273 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISGGYGWGWIRQAPGKGLEWIGGIYGSSGNTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Cercocebus atys V1033 ighv JZLG01051514.1 466 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGWIILSAGITNYAQKFQGRVTIIADTSASTAYMELSSLRSEDTAVYYCGG
Cercocebus atys V1060 igkv JZLG01058160.1 5250 SSGDVVMTQSPLTLPVTPGQPASISCRSSQSLVHSNGNTYLSWLQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCCK
Cercocebus atys V1122 trbv JZLG01069889.1 103038 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGVGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS