WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhinopithecus bieti MCGX00000000.1 (MCGX01) 229 45 32 45 42 53 7 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhinopithecus bieti V20 igkv MCGX01000692.1 14354 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYYASNLETGIPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQSDNSP
Rhinopithecus bieti V21 igkv MCGX01000692.1 51332 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYSHWYLQKPGQSPQLLIYKVTNRESGVPDRFSGSGSGTDFILKISRVEPEDVGVYYCMQSTKAP
Rhinopithecus bieti V41 igkv MCGX01000931.1 35344 SSGDIVMTQTPLSLPLSLPGEPASNSCRSSQSLLHSDGRTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Rhinopithecus bieti V42 igkv MCGX01000931.1 74915 SSGDIVMTQTPLSLPITVGEPASISCRSSQSLLSSNGYNYLSWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Rhinopithecus bieti V43 igkv MCGX01000931.1 83447 TRCAIQMTQSPSSLSAYVGDIVTITCRASQSIGSNLAWYQQKPRKVPKLLIYAASTLQSEVPSQFSGSGSGTDFTLTISSLQPEDVATYYCQKCDSAP
Rhinopithecus bieti V44 igkv MCGX01000931.1 139159 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Rhinopithecus bieti V45 igkv MCGX01000931.1 155757 SKGEIVLTQSPAFRSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Rhinopithecus bieti V46 igkv MCGX01000931.1 186613 TTGEIVLTQSPAILSLSPGERATFSCRASQSIGSNLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Rhinopithecus bieti V47 igkv MCGX01000931.1 192099 VRCDIQMTQSPSFLSASVEDTVTITCQVSQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Rhinopithecus bieti V48 igkv MCGX01000931.1 235615 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLLIRYASQPISGVPSRFSGSGSGTDFTFTISSLEVEDAATYYCQQGN
Rhinopithecus bieti V49 igkv MCGX01000931.1 251858 VRCDIQMTQSPSSLSASVGDRVTITCRASQSFSSSLAWYQQKLGKAPKLLIYGASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVAAYYCQQYYSYP
Rhinopithecus bieti V50 igkv MCGX01000931.1 267129 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQHNSYP
Rhinopithecus bieti V51 igkv MCGX01000931.1 290695 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLSWYQQKPGKAPKLLIYKASSLASGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQHNSA
Rhinopithecus bieti V52 igkv MCGX01000931.1 301202 TTGEIVMTQSPATLSLSPGERATLSCRASQSAGSNLAWYQQKPRQAPRLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVGIYYCQQYNDWP
Rhinopithecus bieti V53 igkv MCGX01000931.1 348509 ARCDIQMSQSPSSLSASVGDRVTITCQASQGISNALAWYQQKPGKAPKLLIYDASSLDSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Rhinopithecus bieti V54 igkv MCGX01000931.1 377027 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLSWYQQKPGKAPKLLIYAASSLASGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQHNSLP
Rhinopithecus bieti V55 igkv MCGX01000931.1 390751 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYATTLQSGVPSRFSSSGSGTEFTLTISSLQPEDFAAYYCLQHNSDP
Rhinopithecus bieti V56 igkv MCGX01000931.1 397180 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQSNSVP
Rhinopithecus bieti V57 igkv MCGX01000931.1 415338 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPARFGGSGSGTDFTLTISSLEPEDVGVYYCQQDYSWP
Rhinopithecus bieti V58 igkv MCGX01000931.1 489195 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYFCQQYNNWN
Rhinopithecus bieti V59 igkv MCGX01000931.1 513239 ARCDIQMTQSPSSLSASVGDTVTITCHASQSISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Rhinopithecus bieti V60 igkv MCGX01000931.1 530598 TTGEIVMTQSPATLSLSPGERAILSCRVSQSVGSYLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSGTEFTLTISSLEPEDVAVYYCQQGSNLS
Rhinopithecus bieti V74 trbv MCGX01001316.1 6654051 VRSQTVHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRLAAGRGLQLLFYSVGVGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Rhinopithecus bieti V143 trav MCGX01003362.1 16149 VRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQLPSQGPEYVIHGLTSNVNNRMVSLTIAEDRKSSTLILHHATLRDAAVYYCILR
Rhinopithecus bieti V144 trav MCGX01003362.1 20876 VSSQELEQSPQSLIIQEGKNLTINCTSSKTLYSLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Rhinopithecus bieti V145 trav MCGX01003362.1 36792 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNNLLWYKQDPGEGPVLLIALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Rhinopithecus bieti V204 iglv MCGX01004693.1 1478900 VVTQEPLLSVSSGGTVAITCGLSSGPVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI
Rhinopithecus bieti V254 iglv MCGX01006385.1 102700 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPHWFQQKPGQAPRTLIYNTNSKYSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYHSGT
Rhinopithecus bieti V255 iglv MCGX01006385.1 110744 SLSQPVLTQPASLSASPGASASLTCTFSGGIVVAGYHIHWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRVSGLQSEDEADYYCAI
Rhinopithecus bieti V279 trbv MCGX01007161.1 1842317 HTEPEVTQTPSHQVTRMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVYFYNDEISEKSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Rhinopithecus bieti V280 trbv MCGX01007161.1 1849538 SLDTAVSQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKELIINETVPNRISPDSPDKAHLILHIKSLELGDSAVYFCASSQ
Rhinopithecus bieti V281 trbv MCGX01007161.1 1856293 PTDTGVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPEIMFMYNYEQLSINESVPSRFSPECSKSSLLSLHLQALQPEDSALYLCASSQ
Rhinopithecus bieti V282 trbv MCGX01007161.1 1864729 HTEPEVTQTPSHQVTRMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVYFYNDEISEKSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Rhinopithecus bieti V283 trbv MCGX01007161.1 1872636 SLDTAVSQTPKYLVTQTGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNEEPILNETIPDRFSPDSPDKAHLILHIKSLELGDSAVYFCA
Rhinopithecus bieti V284 trbv MCGX01007161.1 1881122 HTEPEVTQTPSHQVTRMGQEVILQCVPISNHFYFYWYRQILGQKVEFLVSFVNDNISERSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Rhinopithecus bieti V285 trbv MCGX01007161.1 1887607 SLDTVVSQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYNNEEPILNETVPNRFSPDSPDKVHLILHIKSLELDDSAVYFCASRP
Rhinopithecus bieti V286 trbv MCGX01007161.1 1903493 SVEAGVTQTPRSLIKMRGQQVTLSCSPISGHRSVFWYQQTPGHGLQFLFEYFSETQRDKGNFPSRFSGRQFSNSRSEMNVSALELGDSALYLCASSL
Rhinopithecus bieti V287 trbv MCGX01007161.1 1928836 PLDTAVSQTPKYLVMQTGKKESLKCEQNLGHNAMYWYKQDSKKLLQIMFIYNNQEPILNETVPDRFSPKSPDKVHLILHIKPVELGDSAVYFCASSQ
Rhinopithecus bieti V288 trbv MCGX01007161.1 1932262 PMETGVMQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPLELMFVYNFKERAENNSVPSRFVPECPDSSHLYLHVRALQPEDSALYFCASSQ
Rhinopithecus bieti V289 trbv MCGX01007161.1 1942565 PVSAGVTQTPKFQVLKTGQSMTLQCAQDMNHERMYWYRQDPGMGLRLIHYSVAENTTDKGEVPDGYSVSRLNKKDFLLRLESAAPSQTSVYFCASSE
Rhinopithecus bieti V290 trbv MCGX01007161.1 1945240 PVNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGKGSTDTGEVPDGYSVSRSNLQNFMLRLESAAPSQTSVYFCASSE
Rhinopithecus bieti V291 trbv MCGX01007161.1 1947913 PVNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGKGSTDTGEVPDGYSVSRSNLQNFMLRLESAAPSQTSVYFCASSE
Rhinopithecus bieti V292 trbv MCGX01007161.1 1951647 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGKDAPDKSGLPSGRFSVERPEGSVSTLKIQPTQQGDSAVYLCASSL
Rhinopithecus bieti V293 trbv MCGX01007161.1 1969229 HTGAGVSQSPRNKVTEKGKDVALRCDPISGHTVLYWYRQNLGQGLEFLIYFRGTGAVDDSGLRSDQFSATRPEGSDSTLKIQCTEQRDSAMYFCASSL
Rhinopithecus bieti V294 trbv MCGX01007161.1 1974946 PVQAGVTQSPTYLIKRRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYANELRTSEGNFPDRFSGRQFRNYHSEMNVSALELGDSAPYLCASSF
Rhinopithecus bieti V295 trbv MCGX01007161.1 1977596 SVDSGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGKEREKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Rhinopithecus bieti V296 trbv MCGX01007161.1 1986257 HRDAEIIQSPRHKITETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Rhinopithecus bieti V297 trbv MCGX01007161.1 2013360 HRDARITQSLRYKITETGRQVTLTCHQTWSHNNMFWYRQDLGHGLRLIYYSAGAGVTDKGEVPDGYVVSRSKTEDFPLTVESATRSQTSVYFCASSE
Rhinopithecus bieti V298 trbv MCGX01007161.1 2039074 PVNAGVTQTPKFQVLKTGQSMILQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGAGITDKGEVSNGYSVSRSNTEDFPLRLESAAPSQTSVYFCASSY
Rhinopithecus bieti V299 trbv MCGX01007161.1 2043256 HTGAGVSQSPRYRVTKRGQEVALRCDPISGHEYLYWYQQAPGQGPEFLIYFRNDAQLDKSGLLSSRFSAERPKGSVSTLKIQRTEQGDAAVYLCASSL
Rhinopithecus bieti V300 trbv MCGX01007161.1 2051214 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTNVYWYQQTLDQGLQFILWYDEEEERDRGTFPHRFSGLQFPNYSSELNVSALLLGDSALYLCASSL
Rhinopithecus bieti V301 trbv MCGX01007161.1 2062602 HTCAGVLQSPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFWNDAQQDKSGLPSGRFSAERPEGSVSTLKIQPTQQGDSAVYLCASSL
Rhinopithecus bieti V302 trbv MCGX01007161.1 2078080 LVNAGVTQTSKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPNGYNVSRLNTEVFPLRLESAAPSQTSVYICACGY
Rhinopithecus bieti V303 trbv MCGX01007161.1 2082669 HTGAGVSQSPRYKVSKRGQKVALRCDPISGHAALYWYQQALGQGPELLTYFSYEAQQDKSGLLSDRFSAERPEGSVSTLTIERTEQGDSAVYLCASSL
Rhinopithecus bieti V304 trbv MCGX01007161.1 2090611 PVDTEVTQSPTHLIKTRGQQVTLRCSPISGHSSVYWHQQTLGQGPQLIFEYDSKEERGRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Rhinopithecus bieti V305 trbv MCGX01007161.1 2107144 HTCAGVSQSPRYKVTKRGQDVTLRCDPISGHEYLYWYQQVPGQGPEFLTYFQNDAQLDKSGLPSDRFSAERPEGSISILKIQRTEQGDSAVYLCASSL
Rhinopithecus bieti V306 trbv MCGX01007161.1 2115554 PVDTSVTQSPTHLIKTRGQQVILRCSPISGHSSVSWYQQALGQGPQFIFEYYKEEERERGNFPERFSGRQFPNYSSELNVNTLEMGDSALYLCASSL
Rhinopithecus bieti V307 trbv MCGX01007161.1 2123711 PGNADVTQTPKFQVLKMGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRLNTENFPLRLELAALSQTSVYFCASS
Rhinopithecus bieti V308 trbv MCGX01007161.1 2136398 SVDAGVTQSPTHLIKTRGEQVTLRCSPISRHSSVSWYQQALGQGPQFIFEYYEKEERGRGNFPERFSGLQFPNYSSELNVNALLLGDSTLYLCASSL
Rhinopithecus bieti V309 trbv MCGX01007161.1 2143679 PVNAGVTQTPKFQVLKTGQSMTVQCTQDMNHNYMYWYRQDPGMGLRLIYYSVTAGITTKGEVSNGYNVSRINTEDFLLRLESAAPSQTSVYFCASSY
Rhinopithecus bieti V310 trbv MCGX01007161.1 2148101 HTGAGVSQSPRYKVTKKGQDVALRCDPISGHAALYWYQQALGQGPKFLTYFNDDAQPDKSGLPNDRFSAERPKGSVSTLTIQRTEQQDSAVYLCASSL
Rhinopithecus bieti V311 trbv MCGX01007161.1 2157239 SVDAGVTQSPTHLIKMRGQQVTLRCSPISGHNSVSWYQQALGQGPQLIVQYYREQENGRGNFPERFSGHQFPNYSSELNVSALLLADSALYLCASSL
Rhinopithecus bieti V312 trbv MCGX01007161.1 2174666 SVAAGVIQAPRHLIKVKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSELNMSSLELEDSALYLCASSL
Rhinopithecus bieti V313 trbv MCGX01007161.1 2182263 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGYGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYLCASSE
Rhinopithecus bieti V314 trbv MCGX01007161.1 2193630 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENKEAIDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Rhinopithecus bieti V315 trbv MCGX01007161.1 2203270 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMIWGLELLIYFNNKAAIDDSGMPKDQFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Rhinopithecus bieti V316 trbv MCGX01007161.1 2206548 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLRIQPSEPRDSAVYFCASSL
Rhinopithecus bieti V317 trbv MCGX01007161.1 2223767 LIDAGVTQTPRHKVTEIGQEVTMRCQPILGHNTVFWYRQTMMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Rhinopithecus bieti V318 trbv MCGX01007161.1 2230737 HIEPGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVIGKEIKFLIYFMRASMQDESGMPKKRFSAERTGGTYSTLKLQPAELEDSGVYFCASSQ
Rhinopithecus bieti V319 trbv MCGX01007161.1 2235844 HGDVMVIQNPRYQVTQSGKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Rhinopithecus bieti V320 trbv MCGX01007161.1 2241126 SPGEEVTQTPKHLVKGEGQKAKLYCAPITGHSYVFWYQQVLKKEFKFLISFQNEDVVDETQMPKERFSAKCPRNSPCSLEIQATKLKDSATYFCASSQ
Rhinopithecus bieti V321 trbv MCGX01007161.1 2260144 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYQQLPEEGLKFMVYLQKEKIIDESGMPKERFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Rhinopithecus bieti V322 trbv MCGX01007161.1 2265378 TVDGGITQSPKYLFIKEGQNVTLSCEQNLNHDVMYWYRQDAGQGLRLIYYSQVVNDIQKGDIAEGYSVSRERKESFPLTVTPAQRNPTAFYLCASSI
Rhinopithecus bieti V323 trbv MCGX01007161.1 2273164 GSGLGAVVSQSPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSSVTYEQGIKKDKFPINHSDLTFSTLTVTNAHPEDSSFYICSAR
Rhinopithecus bieti V324 trbv MCGX01007161.1 2283174 STDTKVTQRPRLLVKANEQKAKMECVPIKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Rhinopithecus bieti V325 trbv MCGX01007161.1 2292066 SFHAKVTQTPGYLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFTFLISFQSEQVLQETELHKKRFSSQCPKNPPCSLEILSSEPGDTALYLCASSQ
Rhinopithecus bieti V326 trbv MCGX01007161.1 2301224 SMDADVTQTPRNMIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQEQAQFSLSLESATPNQTALYFCATSD
Rhinopithecus bieti V327 trbv MCGX01007161.1 2309700 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Rhinopithecus bieti V328 trbv MCGX01007161.1 2344193 PLEAQVTQNPRHLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEVIDKGDIPEGYNVSRKEKTNFPLILESPSPSQTSLYLCASSL
Rhinopithecus bieti V329 trbv MCGX01007161.1 2349712 LVDVKVTQSSRHLIKRMGEKVFLECVQDMDHERMFWYRQDPGLGLQLIYFSYDVKVNEKGDIPEGYSVSREKKERFFLILGSASTNQTSMYLCASSL
Rhinopithecus bieti V356 trav MCGX01009399.1 92655 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Rhinopithecus bieti V357 trav MCGX01009399.1 94909 ATHMFHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGHFPRVKEIGDTNNPGNTDFSIRIHEISLADAGTYYCVK
Rhinopithecus bieti V361 ighv MCGX01010008.1 17997 VLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYGWGWIRQPPGKGLEWIGYIYGSSGNTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus bieti V362 ighv MCGX01010008.1 28248 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRVNPKTGGTDYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAMYYCTT
Rhinopithecus bieti V363 ighv MCGX01010008.1 31096 AASGVWGRLGPAWGSLRLSCAASGFTFSDYHMSWVRQALGKGLQWVGLIRNKANGGTTDYSVSVKGRCTISRDDSKSVASLQMNSLKTEDTAVYYCAR
Rhinopithecus bieti V364 ighv MCGX01010008.1 37995 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Rhinopithecus bieti V365 ighv MCGX01010008.1 38355 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Rhinopithecus bieti V366 ighv MCGX01010008.1 93696 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSVGSNWWGWIRQAPGKGLEWIGHIHYSGSSYLNPSLKSRVTLSVDKSKNQFSLKLSSVTAADTAVYYCA
Rhinopithecus bieti V429 trav MCGX01014540.1 34713 MMTGTIETTGKISAKKGGSVLLQCHLSSTMAQVTQVSWEQQDQLLAICNADLGWHISPAFKDRVAPGPGLDLTLQSLTMNDTGEYFCIYHTYPDGT
Rhinopithecus bieti V437 iglv MCGX01015601.1 3631 SVASYELTQPPSVSVSPGQTAKITCSGDTLAKYYAQWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISRAQAEDEADYYCYSGDDNN
Rhinopithecus bieti V451 ighv MCGX01017017.1 21184 VQGEVQLVESGGGLAKPAGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWISYINSGGGSTRYADSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Rhinopithecus bieti V452 ighv MCGX01017017.1 29587 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITYLQMSSLKTEDTAVYYCAR
Rhinopithecus bieti V454 ighv MCGX01017017.1 91908 VQCEVQLVESGGGLVQPGVSLRLSCTASGFTFSSTKMNWIRQVPRKRLEWVADIKYDGSEKNYVDSVKGRFTISRDNTKNSLYLQMNSLRAEDTAVYYCVR
Rhinopithecus bieti V455 ighv MCGX01017017.1 99198 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPRKGLEWMGMIYLGDSDTRYSPSFQGQVTISADKSISTTYLQWSSLKASDTATYYCAK
Rhinopithecus bieti V456 ighv MCGX01017017.1 127415 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVGLIKNKANSYKTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Rhinopithecus bieti V457 ighv MCGX01017017.1 138185 VQCEVQLVESGGGLVQPEGSLKLSCAVSGFTFSDYYMHWVRQAPGKGLEWVSRISSGSGGSTWYPDSVKGRFTISRDNAQNTLYLQMNSLRAEDTAVYYCAR
Rhinopithecus bieti V458 ighv MCGX01017017.1 146026 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYHMTWVRQAPGKGLEWVGFIRNKASGGTAEYAASVKGRFAISRDDSKSITYLQMNSLKTEDTAVYYCAR
Rhinopithecus bieti V459 ighv MCGX01017017.1 162717 AAGGVWGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGPEWVSDISGSTIYYADSVKGRFTVSRDDAKNSLSLQMDSLRAEDTAVYYCARE
Rhinopithecus bieti V460 ighv MCGX01017017.1 188172 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLALIYWDDVKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAQG
Rhinopithecus bieti V461 ighv MCGX01017017.1 202376 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYAMNWVRQAHGQRLEWIGWINTNTGNPTYAQGFKERFAFSMDTSISTAYLQISSLKAEDTAVYYCAR
Rhinopithecus bieti V462 ighv MCGX01017017.1 213578 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTGYYLHWVRQAPGKGLEWMGLVDPEDGEANYAQKFQGRVTMTADTSTDTAYMELSSLRSEDTAVYYCA
Rhinopithecus bieti V463 ighv MCGX01017017.1 235188 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYLSWVRQAPGKGLEWVSFMRNNANGGRTEYAASVKGRCTISRDDSKSITSLQMSSLKTEDTAVYYCAR
Rhinopithecus bieti V464 ighv MCGX01017017.1 264115 VQCEVQLVESGGGLVQPGGFLRLSCAGSGFAFSSYGMDWVRQAPGKGLEWVAVISYDGSQKYYADSVKDRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAR
Rhinopithecus bieti V465 ighv MCGX01017017.1 280905 VLSQVQLQESGPGLVKPLETLSLTCAVSGGSISDGYYWSWIRQPPGKGLEWIGRIYGSSGSTDYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus bieti V466 ighv MCGX01017017.1 296263 VWSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGTGVGWIRQPSGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAHI
Rhinopithecus bieti V467 ighv MCGX01017017.1 308348 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSGISWNGGSTYYADSVKGRFTISRDNAKNSLYLQMDRLTAEDTALYYCAKD
Rhinopithecus bieti V470 igkv MCGX01017352.1 10897 SGDIILNQTPASLTAPLGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPAQYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Rhinopithecus bieti V471 igkv MCGX01017352.1 36751 SSGDIAMTQTPLSLPVTPGEPASISCRSSQSLLHSDGKTYLNWYLQKPGQSPQLPIYTVSNQASGVQERFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Rhinopithecus bieti V498 trav MCGX01021366.1 8876 LSGEDQVTQSPEALRLREGESSSLNCSYTVSSLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITDPKPEDSATYLCAVQ
Rhinopithecus bieti V499 trav MCGX01021366.1 21089 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSRHSTLYITASEPGDSATYLCAV
Rhinopithecus bieti V500 trav MCGX01021366.1 48702 VIGIQVEQSPPDLILQEGANSTLRCNYSATVSNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTSERYSLLHISSSQTTDSGIYFCAVEPQYSP
Rhinopithecus bieti V501 trdv MCGX01021366.1 74969 FSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYHIFWYKQLPGKEMIFLIRQGSSEQNAKNGRYSVNFEKAASSITLTISALQLEDSATYFCALWE
Rhinopithecus bieti V502 trav MCGX01021366.1 84121 MSSILNVEQSPQSLSVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPRALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Rhinopithecus bieti V503 trav MCGX01021366.1 91741 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIVLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Rhinopithecus bieti V504 trav MCGX01021366.1 102698 TIIDAKATQPTSMDCAEGRAANLPCNHSTISGNEYIYWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Rhinopithecus bieti V505 trav MCGX01021366.1 112358 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLKKPSAHVSDAAEYFCAVS
Rhinopithecus bieti V506 trav MCGX01021366.1 129834 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVLTSLQWYRQDPGEGPVLLVTVVTGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Rhinopithecus bieti V507 trav MCGX01021366.1 148449 VRSQKPVQGPQAVILQEGEDAIINCNSSKALYSVHWYRQKHGEVPDFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Rhinopithecus bieti V512 trav MCGX01021897.1 33906 VSSEDKVVQNPLSLVVHEGDTVTLNCSYEVINFRSLLWYKQEKKAPTFLFMLTSSGFDKKKGRLSGILDKKELFSILNITATQTRDSAIYLCAVE
Rhinopithecus bieti V513 trav MCGX01021897.1 64683 SGMAQTVTQSQPEMSVQEAETVTLNCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Rhinopithecus bieti V514 trav MCGX01021897.1 77075 FSMAQTVTQSQPEMSVQVAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIHQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAARYFCAYR
Rhinopithecus bieti V515 trav MCGX01021897.1 101226 LSGELKVGQNPLFLSTQEGRNYTVYCNYSTASDRLYWYRQNPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLYITAALQDLSATYFCAV
Rhinopithecus bieti V530 trav MCGX01025210.1 11230 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIAINALHWLQQHPGRGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Rhinopithecus bieti V531 trdv MCGX01025210.1 91602 VSLDIILEPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDPLKSQFMLDIQKATTQDVGTYYCASD
Rhinopithecus bieti V532 trdv MCGX01025210.1 112730 VMSAIELVPEHQTVIVSVGNPATLRCSMKGEAISNYYINWYRKTQDNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Rhinopithecus bieti V547 igkv MCGX01032288.1 1018 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGNTYLNWFQQKPGQPPRLLIYEVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQA
Rhinopithecus bieti V548 igkv MCGX01032740.1 52 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYYASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYDNSP
Rhinopithecus bieti V549 ighv MCGX01032988.1 2331 VQCELQLVESGGDLVQPGGYMRLSCAASGFTFSNYCISWVCQAPEKGLEWVSRINRDGSSTYYADSMKGQVTISRENAKNTLYLQMNNLRAEDKAVYYCTR
Rhinopithecus bieti V552 iglv MCGX01060282.1 917 SLSQPVLTQPASLSASPGASASLTCTFSSGINVAGYTIHWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQPDDEADYYCAI
Rhinopithecus bieti V555 iglv MCGX01064412.1 977 SWAQSMLTQPPSASGIPGQSVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDDNLSG
Rhinopithecus bieti V560 ighv MCGX01097976.1 203 VQCEVQLVESGGGLVQPEGSLRLSCAVSGFTFSDYNMAWVRQAPGKGLEWVSRISSGSGGSTYYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA
Rhinopithecus bieti V610 trbv MCGX01001316.1 6797878 SVFSALVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYEGGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Rhinopithecus bieti V614 trgv MCGX01001409.1 67639 SQKSSNLEGKTKTITGPTGSPAEITCDLSGVSTLYIHWYLHQEGKAPQRLLYYEPYYFKVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Rhinopithecus bieti V615 trgv MCGX01001409.1 62721 SQKSSNLEGRTKSVTRPAGSSAEITCDLPEFSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYVSTRRNLRLRLRNLIENDSGVYYCANWN
Rhinopithecus bieti V616 trgv MCGX01001409.1 58391 SQKSSNLEGRTKSVTRPAGSSAEITCDFSGDSNFYIHWYLHQEGKAPQRLLYYDVSNSRDVLKSGLSLGKYYTHTRTRWSWILILRNLIENDSGVYYCATWD
Rhinopithecus bieti V617 trgv MCGX01001409.1 44184 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCILDDGTVRKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Rhinopithecus bieti V618 trgv MCGX01001409.1 27085 EQFQLSVSTEVKKSIDIPCKIQSTNFANDVIHWYWQKPNQALEHLIYITSTKSAVQGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Rhinopithecus bieti V619 trgv MCGX01001409.1 10746 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFQKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Rhinopithecus bieti V620 trgv MCGX01001409.1 8729 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTIVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Rhinopithecus bieti V750 iglv MCGX01004693.1 261008 SWAQSVLTHLPSVSGSPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGACLDFSSLVIVTDPQESLIDFSGSKSGNLASLTITGLWPEDEADYHCQS
Rhinopithecus bieti V751 iglv MCGX01004693.1 193414 SWANFMLTQPHSVSGSVGQKVVISCTRSSGSIGSYYVQWYQQRPGSAPTTVIYDDNERPSGVPDRFSGSIDSSSNSASLTISGLETEDEADYYCQSYDSSS
Rhinopithecus bieti V752 iglv MCGX01004693.1 163431 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Rhinopithecus bieti V753 iglv MCGX01004693.1 153121 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSYYVQWYQQRPGSAPTTVIYNDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSAADSYS
Rhinopithecus bieti V754 iglv MCGX01004693.1 148645 CVSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQPEKAPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWEGG
Rhinopithecus bieti V755 iglv MCGX01004693.1 58484 SLSQPVLTQPSSHSASSGAPARLTCTLSSGFSVGDFWINWYQQKPGSPPRYLLYYHSDSDKGQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCCTWHGN
Rhinopithecus bieti V785 ighv MCGX01005541.1 3231 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFDSYAISWVRQAPGQGLEWMGGIIPVVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus bieti V818 iglv MCGX01006756.1 1618067 SWAQCVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVNKRTSGVPERFSGSQSGTSATLSISGLRPEDEANYYCLAWITA
Rhinopithecus bieti V819 iglv MCGX01006756.1 1606120 SLSQPVLTQPPSASASLGASFTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Rhinopithecus bieti V820 iglv MCGX01006756.1 1593231 SLSQPVLTQPTSLSASPGASARLTCTLSSGINVGSYRIFWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGSKDASANAGILRISGLHSEDEADYYCTI
Rhinopithecus bieti V821 iglv MCGX01006756.1 1588682 SWAQSVLTQPPSASGTPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLIIYGNNQRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSS
Rhinopithecus bieti V822 iglv MCGX01006756.1 1575977 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPYWFQQKPGQAPRTLIYNTNSKYSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYYSGT
Rhinopithecus bieti V823 iglv MCGX01006756.1 1567741 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPRRYLLWYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Rhinopithecus bieti V824 iglv MCGX01006756.1 1565268 SNSQAVVTQEASLTVSPGVTVTLTCAFSTGAVTSGHYPNWFQQKPGQVPRALIYATSSKHSWTPARFSGSILGGKAALALSGAQPEDEADYYCSLYYSGA
Rhinopithecus bieti V825 iglv MCGX01006756.1 1547373 SWAQSVLTQPPSVSPDPGQKVTISCSGSSSNIGRSYVSWYQQLPGIAPKLLIYESNKRPSGISDRFSGSKSGTSASLGITGLQTGDEADYYCSAWITA
Rhinopithecus bieti V826 iglv MCGX01006756.1 1541849 SWAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYQDNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEADYYCGTWDSSLNG
Rhinopithecus bieti V827 iglv MCGX01006756.1 1536725 SWAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYYVSWYQQLPGTAPKLLIYQDNKRPSGISDRFSGSKSGTSASLAITGLQSEDEADYYCQSYDSSLSG
Rhinopithecus bieti V828 iglv MCGX01006756.1 1510044 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNRVSWYQQLPGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSS
Rhinopithecus bieti V829 iglv MCGX01006756.1 1448028 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTISNYTDWFQQKPNQVPRGLTGDNTYRNPNVPEWFSGSLSAGKAIFTTTGAQPEDEAFYYCALW
Rhinopithecus bieti V830 iglv MCGX01006756.1 1255796 FAASYELTQPPSVSVSPRQMARITCGGDNIGSKAVYWYQQKPAQAPVLVIYDDSERPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSSDH
Rhinopithecus bieti V831 iglv MCGX01006756.1 1229511 SEPPMSWTQPPSESVSQDSEARITCGEDNIGSKAVHWYQQKPAQVPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Rhinopithecus bieti V832 iglv MCGX01006756.1 1196151 SVASYELTQPPSVSVSPGQTARITCSGDVLKENYADWYQQKPGQAPVLVIHEDSKRPSGIPEQFSGSTSGDTNTLTISSSLSEDEADYYCFSGNENN
Rhinopithecus bieti V833 iglv MCGX01006756.1 1178601 SVVSSELTQDPAVSVTLGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGNNRPSGIPERFSGSSSGNTGSLTITGAQVEDEADYYCNSWDSSGTH
Rhinopithecus bieti V834 iglv MCGX01006756.1 1156309 SEASYELTQPPLVSVSPGQSARITCSGDALPDNYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGIY
Rhinopithecus bieti V835 iglv MCGX01006756.1 1111205 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSSDSSDNH
Rhinopithecus bieti V836 iglv MCGX01006756.1 1100393 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQRHPGTALKLVIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYSSSYY
Rhinopithecus bieti V837 iglv MCGX01006756.1 1083544 CPDSASLSGSSGQLVTISCTGTSSDVGSYNIVSWYQQHPGTGPQLMIYHVSYRPSGVPDRFSGSKSGNTASMIISGFQVEEEADYYCYSYTSS
Rhinopithecus bieti V917 ighv MCGX01010704.1 954 AAGGVWGGLVQPEGSLKLSCAVSGFTFSDYYMHWVRQAPGKGLEWVSRISSGSGGSTWYPDSVKGRFTISRDNAQNTLYLQMNSLRAEDTAVYYCAR
Rhinopithecus bieti V940 igkv MCGX01011782.1 244418 TSGDIVMTQTPLSLPVTPGEPVSISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEYP
Rhinopithecus bieti V941 igkv MCGX01011782.1 190976 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Rhinopithecus bieti V942 igkv MCGX01011782.1 181267 SSGEIVMTQTPLSLPITPGELASISCRSSQSLMDSDDGFTYLYWYLQKPGQSPQLLMHFASYRASGVPDRFSGSGSGTDFTLEISKVEAEDIGVYYCMQALELP
Rhinopithecus bieti V943 igkv MCGX01011782.1 135700 SSGDIVMTQTPLSLPVTHGKPASISCRSSQSLLDSYGYTHLNWYLQKPGQSPQLQIYLVSNRSSGVPDRFSGSGSGSDLTLKINRVEAEDVGVYYCIQTLQTP
Rhinopithecus bieti V944 igkv MCGX01011782.1 126387 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLNWYQQKPEKTPKLLIYAASSLQSGIPSRFSGSGSGMDFTLTISSLQPEDFATYYCQQSY
Rhinopithecus bieti V945 igkv MCGX01011782.1 111539 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLHWYLQKPGQSPQLLFYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Rhinopithecus bieti V946 igkv MCGX01011782.1 103692 ARCDIQMTQSPSSLSASAGDRVTISCQASQSVYSNLAWYQQKPGKAPKLLIYAASSLQSGSPSRFSGSGSGTDFTLTISSLQHNDSATYYCQHYYSTP
Rhinopithecus bieti V947 igkv MCGX01011782.1 85814 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALEFP
Rhinopithecus bieti V948 igkv MCGX01011782.1 76358 ARCDIQMTHSPSSLSVSVGDRVTITCQESQGISNYLAWYQQKLGETPKLLIYDASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSAS
Rhinopithecus bieti V949 igkv MCGX01011782.1 53916 ARCDIQMTQSPSSLSASVGDRVTISCQASQNIYSNLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDYTLTISSLQPEDVATYYCQHGYSTP
Rhinopithecus bieti V950 igkv MCGX01011782.1 26857 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNDLAWYQQKLGESPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFAAYYCQHYYSTP
Rhinopithecus bieti V951 igkv MCGX01011782.1 15967 ARCDIQMTQSPSSLSASVGDRVTISCQASESISDYLNWYQQKPGKAPKLLIYAASTLQSVVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGT
Rhinopithecus bieti V969 trav MCGX01012761.1 457078 TAGQSLEQPSEVTAVEGAIVQINCSYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Rhinopithecus bieti V970 trav MCGX01012761.1 432081 KCLVLGTTGQNIDQPTEMTAMAGAIVQINCTYQTSGFNGLSWYQQHDGEAPTLLFYNVLDGLEEKGRFSSFLSNSKGYSYLLLKELQMKDSASYLCAVR
Rhinopithecus bieti V971 trav MCGX01012761.1 343053 GLRTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPKQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Rhinopithecus bieti V972 trav MCGX01012761.1 330982 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPADRKSSTLSLPRVALSDTAVYYCLVG
Rhinopithecus bieti V973 trav MCGX01012761.1 303748 VSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Rhinopithecus bieti V974 trav MCGX01012761.1 288203 VKNQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Rhinopithecus bieti V975 trav MCGX01012761.1 276137 ANGENQVEQSPRFLGPQQGDVAFMSCMYSVSRFNNLQWYRQNTGTGPKHLFSMYSAGYEKQKGRLNATLLKNGSSLYITAMQPEDSATYFCAVD
Rhinopithecus bieti V976 trav MCGX01012761.1 248505 EINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMMANDKESNKGFEATYHKETTSFHLKKDSVQESDSAVYFCALS
Rhinopithecus bieti V977 trav MCGX01012761.1 215932 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Rhinopithecus bieti V978 trav MCGX01012761.1 210503 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSPISPNLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFKAEFKKSETSFHLTKASVHVSDAAEYFCAVS
Rhinopithecus bieti V979 trav MCGX01012761.1 189895 VNGENVEQHPSILSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Rhinopithecus bieti V980 trav MCGX01012761.1 163701 VWSQQKVEQNSGSLSVPEGAIASLNCTYSDRGSQSFLWYRQYSGQSPELLISTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCVV
Rhinopithecus bieti V981 trav MCGX01012761.1 156377 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPSLFWYVQYPNQGLQLLLKYISGTALVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Rhinopithecus bieti V982 trav MCGX01012761.1 150865 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAVG
Rhinopithecus bieti V983 trav MCGX01012761.1 131659 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSVSDYFLWYKQESGKGPQFIIDIRSNMAKRQGQRLTVLLNKTVKHLSLQIAATEPGDSAVYFCAEN
Rhinopithecus bieti V984 trdv MCGX01012761.1 121021 SGIAQKITQTQPAMFMQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLIRQESYDKQNATEGRYSLNFQKARKSISLVISASQVGDSAMYFCAMR
Rhinopithecus bieti V985 trav MCGX01012761.1 99640 RTRGDSVTQMQGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKDDDKGSNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Rhinopithecus bieti V986 trav MCGX01012761.1 72704 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFVWYRQYSRKGPQLLIYTYSSGDKEDGRFTAQVDTSSKYISLFIRDSQPSDSATYFCAMS
Rhinopithecus bieti V987 trav MCGX01012761.1 61372 GTRAQSVTQLDSQVSVSEEAPVLLRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDMAEYFCAVS
Rhinopithecus bieti V988 trav MCGX01012761.1 48171 GARAQSVTQPEKLLSVFKGAPVELKCNYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSETSFHLKKLFAQEEDSAMYYCALS
Rhinopithecus bieti V989 trav MCGX01012761.1 38683 VNSQQGEEDPQALSIQEGENATMTCSYKTSIDNLQWYRQDSGRSLVRLILIRSNEREKSSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Rhinopithecus bieti V990 trav MCGX01012761.1 32540 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFMFWYVQYLNKEPELLLKSSENQETDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Rhinopithecus bieti V991 trav MCGX01012761.1 29041 SSMAQKVTQAQTEISVVEKEDVNLDCVYETRDSTYYLFWYKQLPSGELIFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Rhinopithecus bieti V1011 ighv MCGX01014072.1 44151 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Rhinopithecus bieti V1012 ighv MCGX01014072.1 22225 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMNWVRQAPGKGLEWVGRIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAT
Rhinopithecus bieti V1013 ighv MCGX01014072.1 7500 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVAVIWSDGSQKYYADSVKGRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAK
Rhinopithecus bieti V1041 ighv MCGX01018627.1 106720 VQCEVQLVESGGGLVQPEGSLRLSCVASGFTFSDYNMAWVRQAPGKGLEWVSSISSPSGSNTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Rhinopithecus bieti V1042 ighv MCGX01018627.1 97201 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMGWVRQAPGKGLEWVGRIKKTTDGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Rhinopithecus bieti V1043 ighv MCGX01018627.1 75579 VQGEVQLVESGGGLAKPAGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSAINSGGGSTYYADSVKGRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAR
Rhinopithecus bieti V1044 ighv MCGX01018627.1 32725 VQCEVQLVESGGGLVQPAGSLRLSCVGSGFTFSSYGMHWARQAPGKGLEWVSAINSGGGSTWYADSVKGRFTISRENARNTLYLQMDSLRAEDTAVYYCAK
Rhinopithecus bieti V1047 igkv MCGX01019279.1 54959 TVVTQSPATLSLSPGERATLSCRTSQSVGSNLAWYQQKPGQALRLLIYGASNRATGIPARFSGSGSGTEFTLTISSLEPEDVGVYYCQQDSNWK
Rhinopithecus bieti V1048 igkv MCGX01019279.1 2780 CNGDIVLTQSPASLAVSPGQRATITCRASESVNFFGINLIHWYQQKPGQPPKLLIYQVSNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKNFP
Rhinopithecus bieti V1059 ighv MCGX01021433.1 77527 AQSQEQLVQSGAEVKKPGASVKVSCKASGYTFSSYAISWVRQAPGQGLEWMGVINPIVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus bieti V1060 ighv MCGX01021433.1 54674 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWSWIRQPPGKGLEWIGRISGSGGSTYYNPSLKNRVTISIDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus bieti V1061 ighv MCGX01021433.1 41723 VQGEVQLVESGGGLAKPAGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWISYINSGGGSTRYADSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Rhinopithecus bieti V1062 ighv MCGX01021433.1 29594 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYMHWVHQAPGKGLEWVGFIRNNANGATTEYAASVKGRFTISRDDSKSVASLQMSSLKTEDTAVYYCAR
Rhinopithecus bieti V1063 ighv MCGX01021433.1 14726 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLALIYWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCVRR
Rhinopithecus bieti V1077 ighv MCGX01023970.1 49433 AQSQVQLVQSGAEVRKPGDSVKVSCKASGYTFTNHNMDWVRQAPGQGLVWMGGINTNTGGTSCAQTFQGRVTMTRDTSTSTAFMELSCLRSEDTAVYYCAR
Rhinopithecus bieti V1078 ighv MCGX01023970.1 36104 AHSQVQLVQSGAEIKQPGASVKVSCKASGYTFTSYYMHWVRQASGQGLEWIGLISPYNGNTGYAQNFQGRVTMTTDTSTSTGYMELSSLRSEDTAVYYCTR
Rhinopithecus bieti V1079 ighv MCGX01023970.1 28424 VQGEVQLVESGGGLAKPEGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSAINSGGGSTYYADSVKGRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAR
Rhinopithecus bieti V1080 ighv MCGX01023970.1 19751 AAGEVWRRLGPAWGSLRLSCATSGFTFSDHYVEWVRQVPGKGLQWVGQVNPNGGTTFLMDPVKGRFTISRDNAKNTLYLQINSLKTEDTAVYYCAR
Rhinopithecus bieti V1081 ighv MCGX01023970.1 10318 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGPEWVSDISGSTIYYADSVKGRFTVSRDDAKNSLSLQMDSLRAEDTAVYYCARE
Rhinopithecus bieti V1082 igkv MCGX01024624.1 128520 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLSSSSNKNYLAWYQQKPGQAPKLLIYLASTRESGVPNRFSGSGSGTDFTLTISGLQAEDMAVYYCQQHY
Rhinopithecus bieti V1083 igkv MCGX01024624.1 82968 AKCDVQLTQSPTFLSASVGDRVTIACRASQSINKGLAWYQQKPGKAPKLLISYAFSLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Rhinopithecus bieti V1084 igkv MCGX01024624.1 52991 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDMFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQI
Rhinopithecus bieti V1085 igkv MCGX01024624.1 34903 TAGQVILTQSPATLSLSAGEIATLSCRASQSVNRYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYNSGY
Rhinopithecus bieti V1086 igkv MCGX01024624.1 23748 TRAETILTQSLAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAHYFCLQQDNFP
Rhinopithecus bieti V1093 trdv MCGX01025210.1 161740 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDSTYSNPYLFWYRIRPDYNFQFVFYGIKSRSQGAYFTQGRFSVKHLLTQKAFHLVISPVRTEDSATYYCAM
Rhinopithecus bieti V1104 ighv MCGX01029131.1 1604 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPRKALEWLAHIYWDDDKYYSASLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Rhinopithecus bieti V1108 ighv MCGX01034736.1 1026 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSTYGWSWIRQPPGKGLEWIGYIYGSGGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR