WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ailurus fulgens styani LNAC00000000.1 (LNAC01) 136 21 15 29 44 16 7 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ailurus fulgens styani V52 igkv LNAC01000033.1 33643 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVNKYVSWYQQKPGQSPRLLIYYASSRATGVPDRFSGSGSGTDYTLTISSLQAEDVGDYYCQQYDST
Ailurus fulgens styani V53 igkv LNAC01000033.1 44620 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVSSYVNWYQQKPGQSPRLLIYYASSRATGVPDRFSGSGSGTDFTLTISSLQAEDVGDYYCQQYDSYP
Ailurus fulgens styani V54 igkv LNAC01000033.1 45203 YPGDIVLTQSPASLTLSPGQRATISCKTSQKVSDLLGITQFITWYQQKSGQRPKILIYKASSLVSGVPTRFSGSGSGTEFSLTVDPVEASDTATYYCQQSKETP
Ailurus fulgens styani V55 igkv LNAC01000033.1 70695 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVNWYQQKPGQSPRLLIYYASSRATGVPDRFSGSGSGTDFTFTISSLQAEDVGDYYCQQGYST
Ailurus fulgens styani V56 igkv LNAC01000033.1 80900 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVNKYVSWYQQKPGQSPRLLIYYALSRATGVPDRFSGSGSGTDFTLTISSLQAEDVGDYYCQNSYST
Ailurus fulgens styani V57 igkv LNAC01000033.1 121708 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSSYVSWYQQKPGQSPRLLIYRASNRATGVPDRFSGSGSGTDFTLTISSLQAEDVGDYYCQQYDSYL
Ailurus fulgens styani V58 igkv LNAC01000033.1 131894 ARADITMTQSPGSLAVSPGQRVTMNCRASQSVSSYVNWYQQKPGQSPRLLIYAASSRATGVPDRFSSSGSGTDFTLTISSLQAEDVGDYYCQQYYNY
Ailurus fulgens styani V59 igkv LNAC01000033.1 198570 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVNKYVSWYQQKPGQSPRRLIYYASNRATGVPDRFSGSGSGTDFTFTISSLQAEDVGDYYCLQSYSNP
Ailurus fulgens styani V86 trav LNAC01000050.1 2132673 TSDQDFQVTQPESSVSVREGEILTLGCNVSAHSPAGPVLWFRENGQERKLIYNFNEGQFPRVTQVENTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Ailurus fulgens styani V103 trav LNAC01000073.1 1952293 PHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Ailurus fulgens styani V175 igkv LNAC01000180.1 51 FSGEVVLTQTPLSLSVTPGQSASISCKASQSLVHNNGNTYLSWYLQKPGQSPQLLIYKVSNRLTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQGTYFP
Ailurus fulgens styani V176 igkv LNAC01000180.1 6939 SSEEVVMTQTPLSLPVTPGQPASISCRANQSLVHSNGNTYLSWFRQKPGQSPQGLIYGVSNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQV
Ailurus fulgens styani V260 iglv LNAC01000325.1 876042 CGSQPVLNQPPSMSSSLGTTIHLPCTLSRDHDVSIYSIYWYQQRPGHPPRFVLRYFSHSDNNQGSKIPPRFSGSKDVAKNTGYLSIAELQLEDEAMYYCAVGAQ
Ailurus fulgens styani V333 trav LNAC01000664.1 23376 SSTARTVTQTQPDTSVRETETVTLHCTYDTSDTNYYLFWYKQSPSGEMILIIRQEAYKQENATKDRFSVNFQIEKKSFGLRISDSQLEDAATYFCAFSE
Ailurus fulgens styani V334 trdv LNAC01000664.1 30319 SSMAQTATQTQPDTSVRETETVTLHCTYDTSSSDYYLFWYKQSPSGEMILIIRQEAYKQENATKDRFSVSFQIEKKSFGLRISDSRLEDAAMYFCA
Ailurus fulgens styani V335 trav LNAC01000664.1 62695 GTSGNSVQQTDQITVLEGASVTMNCIYTSTQYPTLFWYVQYPNKALQFLQRETMENSKNFGARNIKDKSSPITKSTVQMSDSAVYYCLLRDTHSAK
Ailurus fulgens styani V336 trav LNAC01000664.1 66093 VSGKTGVEHSPQYLTAQEGDSVTVTCGYSIGMTALHWLQQNPEGRIVSLFILSLEMKKKGRMRATINTEELLSSLYIIASQPRDSATYLCAV
Ailurus fulgens styani V337 trdv LNAC01000664.1 100121 SSNTDKIRQSPSVVHVEEGKSVTLDCSFTLNFNYYVMNWYYQPPNGKMTQIISMFSDSSSTSQGRYSLSLQKGSKMLKLTITGLTPADTGVYFCAIGES
Ailurus fulgens styani V338 trav LNAC01000664.1 131254 GSCRTEIIQSSTLAAMIGTDVTFQCQYHIVDGSYDSVYWYLQRAYQRLTYINHISQGTIESEHYQLSVNRELSSSTLTIKHVQPRDKAIYYCAL
Ailurus fulgens styani V372 iglv LNAC01001181.1 20482 SMASYVLTQPPSMSVNLGQTVRITCGGNNIGSKNAYWYQQKPGQAPVLIIYDDNSRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCEVWNSGN
Ailurus fulgens styani V373 iglv LNAC01001181.1 73659 SVVSSELTQPPSVSVALGQTATITCTGEEVSYGYVQWYQQKPGQSPLTVIYGDSERPSGIPERFSGSKSGNTATLTISKAQAEDEADYYCQSYDSSGN
Ailurus fulgens styani V374 iglv LNAC01001181.1 127352 SMASYVLTQPPSMSVNLGQTIRITCGGNNIGRKSVHWYQQKPGQVPILIIYNDNNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSTD
Ailurus fulgens styani V384 trgv LNAC01001394.1 39675 GGAGLKLEQQDVVVERLGRTASLSCKVDTWVRYIHWYRHQKGSAPQRLLYLDMSRSDVMRDSVLKVDKVDAKKGRDSYSCTMSMLKLEKRDEGVYYCAAWE
Ailurus fulgens styani V385 trgv LNAC01001394.1 103923 LGAGLTLQQQQDMVVERLGRTASLQCKVDTGVSYIHWYRHQEGSAPQRLLYLDMSRSNVKRDFVLRADKVDAKKGRDSYSCTLSLLKLEKSDEGVYYCAAWE
Ailurus fulgens styani V386 trgv LNAC01001410.1 87782 TNADILITQLIPSITKKQGNTAFLECQIKTGGLRNNVYIHWYQQKPDQPLKRILYISSNENVVHEQGVNEERYEARKWQRDLPASLRIHQVKEEDAGLYYCACWD
Ailurus fulgens styani V387 trgv LNAC01001410.1 124173 GLGQVKLEQHEISVSRPRHKSAPIPCKVFTDDFNSAVIHWYRQKPGQEIEHLTNIAASSTQVALGGKKNKLEASKDASTSTATLNVNFLEQEDEAMYYCACWST
Ailurus fulgens styani V393 ighv LNAC01001543.1 93249 VQCEGQLVESGGDLVKPGGSLRLSCAASGFNFRIYYMNWVRQAPGKGLQWVAWINKGGSSTYYADAVKGRFTISRDDAKNTLYLQMNSLRAEDTAVYYCAS
Ailurus fulgens styani V394 ighv LNAC01001543.1 127060 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLQWVGEIKGDGSSINYADAVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCTR
Ailurus fulgens styani V402 iglv LNAC01001656.1 36177 YWAQSTLDQTPLLSGALGSTVTISCAGSSSNIGSNPYISWYQQALGTSPKLLIYRVSSRPSGIPDRFSGLKTGNTAILTISGIQAEDEGDYYCTTFTSSDD
Ailurus fulgens styani V403 iglv LNAC01001656.1 111848 SMASYVLTQPTSMSVNLRQMVRITCGGNNIGGKSVSWYQQKPAQAPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCAVWDSSAY
Ailurus fulgens styani V404 trgv LNAC01001681.1 13538 GGAGLKLDQPALLVARLGSSPSLRCQADTSVSYIHWYRHQEGTAPKRLLYLDMSRSYVQMDFVLKADKIDAKKGRDSYSCTLSVLKLEKSDEGVYYCAGWE
Ailurus fulgens styani V405 trgv LNAC01001681.1 99464 GGAGLKLKQPALLVARLGSSPSLDCQVDTSVSYIHWYRHQEGTAPKRLLYLDMSKSYVQRDFPMKSDKVNAKKGRDSYSCTLSVLKLEKSDEGVYYCAAWE
Ailurus fulgens styani V406 iglv LNAC01001697.1 2105 TSSEAVVTQEPSLSVSPGKTVTLTCASSYGELNNGHFPCWFQQKPGQVPRALIYNVYNKHSWTPTRFSGSLLEGKAVLTLTGAQPEDEAEYYCFLQYSDG
Ailurus fulgens styani V407 ighv LNAC01001708.1 170 VQCEVQLVESGGDLVKPAGSLRLSCAASGFTFSSNGMSWVRQAPGKGLHWVAWINTDGSSTSYADAVKGRFTISRDNGKNTLYLQMNSLRAEDSAVYYCAN
Ailurus fulgens styani V408 ighv LNAC01001708.1 11991 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQPPGKGLQWVAAISYDGSSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAK
Ailurus fulgens styani V409 ighv LNAC01001708.1 41001 VQCEVQLMESGGDLVKPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLQWVAWINTDGSSTSYADAVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAR
Ailurus fulgens styani V410 ighv LNAC01001708.1 59520 VLSQLTLQESGAELVKPSQTLSLTCVVSGGSVTSSYYWSWIRQRPGRALEWMGYWTGSTSYNPAFQGRISITADTSKNQFSLQLNSVTTEDTAVYYCAR
Ailurus fulgens styani V416 ighv LNAC01001999.1 883 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYDMTWVCQAPGKELQWVADISNGGNTYYAGSVKGRFTISRDDGKNTLYLQMNSLRVDDTAVYYCVS
Ailurus fulgens styani V417 ighv LNAC01001999.1 16511 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYDMYWIRQAPGKGLQWVAWINYGGSSTSYADSVKGRFTISRDNGKNTLYLQMNTLRAEDTAVYYCAK
Ailurus fulgens styani V418 ighv LNAC01001999.1 27583 VQCEVQLVESGGDLVKPAGSLRLSCAASGFTFSSSWMSWVRQVSGKRPQWVARISSDGSSTDYADSVKGRFTISRDNGKNTLYLQMNNLRAEDTAMYYCAK
Ailurus fulgens styani V474 igkv LNAC01000033.1 326316 CGGQLVLTQTPETLATSQDSFISITCRSSMEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFQGSGCGSGSDFSLTIHGVEAEDMGVYYCQ
Ailurus fulgens styani V475 igkv LNAC01000033.1 317176 ASSEIQMTQSPSSLFASPGDRVTITCRASQNANKWLVWYQQKPGRAPKSLIYEASKLQAGVPSRFSGSGSGTDFTLTISSLEPEDVGTYYCQQYNSY
Ailurus fulgens styani V476 igkv LNAC01000033.1 312810 ARGITGLTQAPALLSLSLREGASITCTANESVSDYLSWYRQKPGQAPELLIYDADNRKSGVPARFSAIQSDTEFTLKISAVEAEDAASYYCQQDYTRP
Ailurus fulgens styani V477 igkv LNAC01000033.1 309175 SSGDIVMTQTPLSLSITPGQSASISCKASQSLLHSNGNTCLHWFRQKPGQSPQGLIYLVSNRLTGVPDRFSGSGSGTDFTLTISRVEADDVGVYYCVQKGQSP
Ailurus fulgens styani V478 igkv LNAC01000033.1 270904 STGDIVMTQTPLSLSVTPGEPASISCKASQSLLHSNGKTYLYWFRQKPGQSPQGLIYLVSNRYSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQGLQSP
Ailurus fulgens styani V479 igkv LNAC01000033.1 254774 SSGDVVMTQTPLSLSVTPGQPASISCKASQSLLHSNGNTYLNWFRQKPGQSPQSLIYRVSNRYSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Ailurus fulgens styani V480 igkv LNAC01000033.1 247552 ATGEIVMTQSPALLSLSPGEKATLNCRASQSVSKYLAWYQQKPGQAPRLLIYGVSSRATGIPARFSGSGSGTDFTFTISSLEPEDVAVYYCQQHNSGY
Ailurus fulgens styani V481 igkv LNAC01000033.1 221661 SHGEIVLTQSPAVLSKAPKEKVTITCRASQNVNKWLAWYQQKPGQAPKLLIYEASKLQTGVPSRFSGSGSGTDFALTISSLEPEDLGTYYCQQSNSNP
Ailurus fulgens styani V482 igkv LNAC01000033.1 208854 ASGEVVLTQTPLSLSVTPRQSASISCKASQSLMHNNGNTYLHWYLQKPGQSPKHLIYKVSNHFTGVPDRFSGSGSGTDFTLRISRVEDDDVGVYYCQQG
Ailurus fulgens styani V483 igkv LNAC01000033.1 181734 SSEEVVMTQTPLSLSITPREPASISCRASQSLVDSNGNTYLSWYLQKPGQSPQLLIYEVSNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQD
Ailurus fulgens styani V484 igkv LNAC01000033.1 172657 TNGEVVLTQTPLSLSVTPGQPASISCKASQSLVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Ailurus fulgens styani V485 igkv LNAC01000033.1 167557 SSAEVVLTQTPLSLSVTPGEPASISCKASQSLVHSNRNTYLQWYLQKPGQSPQLLIYLVSNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCMQV
Ailurus fulgens styani V486 igkv LNAC01000033.1 160621 SSGEVVMTQTPLSLSITPGGPASISCRASQSLVHSNGNTYLQWYLHKPGQSPQGLIYGVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQT
Ailurus fulgens styani V487 igkv LNAC01000033.1 151265 QTPQLQTPLSLSITPGQPASISCKASQSLVHSDGNTYLNWFQQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Ailurus fulgens styani V488 igkv LNAC01000033.1 51675 ISGEIVMTQTPLSLSVTPGQPASISCKASQSFVHSDGNTYLSWFRQKPGQSPQLLIYKVSIRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQV
Ailurus fulgens styani V489 igkv LNAC01000033.1 13900 STAEVVLTQTPLSLSVTPGESASISCKASQSLVHSDGNTYLSWFRQKPGQSPQGLIYKVSNHFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCVQG
Ailurus fulgens styani V490 igkv LNAC01000033.1 9046 YSGEVVLTQTPLSLSITPGQPASISCKASQSLVHSDGNTYFYWYLQKPDQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISTIGTCRRGVYYCVQG
Ailurus fulgens styani V522 trbv LNAC01000057.1 860413 PLDTAVSQTPKYLIAQTGNKKLLKCEQNLGHDAMDWYKQDSQKLLKVMFTYNNKELILNETVPRRFLPESPDKAHLKLHVDSLETGDSGVYLCASSQ
Ailurus fulgens styani V523 trbv LNAC01000057.1 856995 SMDPGVIQTPKHLVTGMGRKVTLKCKQHLGHNAMYWYKQSAQEPLKIMLAYNIKDVIENETASSRFKPHRPDNSQLDLQVDTLVPKDSALYLCASSE
Ailurus fulgens styani V524 trbv LNAC01000057.1 838200 LLNAGITQTPKFQVLGTGQNVTLECHQDMNHNSMYWYRQDHGHGLRLIHYSISDGTSENGDIPDGYRASRSKIEIFLLELLSTAPAQTSVYFCASSV
Ailurus fulgens styani V525 trbv LNAC01000057.1 834562 HAGAGVFQFPTYRVTKRGQNVNLSCDPISGHNGLFWYQQTAGKGPEFLIAFQNKDPVDESGMTNNRFSAERTDGTRSTLQIRRAEQVDSAVYLCASS
Ailurus fulgens styani V526 trbv LNAC01000057.1 828498 PVGAEVIQTPRHLIQGPGGKAVLKCHPISGHSSVRWYQQTPGQGPRFLIEYYEQMQRDKGDIPGRFSAQQFSNYSSQLDLNLLELEDSALYLCASS
Ailurus fulgens styani V527 trbv LNAC01000057.1 823868 HVDAGITQSPRHEITRTGKKVTLRCHQTENYDYMYWYRQDPGHGLRLIYYSVDVGRTEKGEVSDGYNVSRSSTEDFHLRLLSVTSSQTSVYFCANSY
Ailurus fulgens styani V528 trbv LNAC01000057.1 810938 FIDAGVIQTPRHKVTKMGQEVTLRCKPVSGHEVLYWYSQTLAQGLKQLIYFNNQAPIDDSGMPKERLSAEMPSKSLSILRIKPTEPGDLATYLCASSV
Ailurus fulgens styani V529 trbv LNAC01000057.1 798637 PIGAVVIQSPRYQVTRVGKPVNLSCSQDMNHDGMYWYQQKQSQGPKLLLYYYDTSLNKEADTSENFHSSRLNTSFCSLNIRSAGLGDSALYLCASSK
Ailurus fulgens styani V530 trbv LNAC01000057.1 794313 TLHANVTQTPGHLVKGKGQKAKMHCVPIKGHSYVFWYQQIPAKEFKFLISFQKDAIFDKTGMPEKRFLAECPQNSLECSLEIEHTELQDSAVYFCASSE
Ailurus fulgens styani V531 trbv LNAC01000057.1 785436 PTNAGVTQTPRHLVRRTGQAATLRCSPKKGHDYFYWYKQPPGEGLKFMVYLQNKNIIDDSGLSKNLFSTEFSQEGLSILKIHQAELGDSAVYFCASSS
Ailurus fulgens styani V532 trbv LNAC01000057.1 782640 ATDGGITQTPKYLSREEGREVTLECEQDLNHDCMCWYRQDPGQGLRLIYCSLSEKDVQKGDIPEGYSASREEERIFSLIVTSMQKNHTALYLCASSR
Ailurus fulgens styani V533 trbv LNAC01000057.1 747471 LMDAGISQTPRHCVSGTGKKIVLECSQTMGYDNMYWFRQDPGKALQLMHYSYGVNTTEKAELSFGSTVSRIREEHFPLTLESASPSQTSLYFCASSE
Ailurus fulgens styani V534 trbv LNAC01000057.1 742224 LKDAVVTQFPRHRILGTGKEITLQCLQDMNYVSMYWYRQDPGFGLRLIYYSTGTNTFQKGDVPQGYRVSRDELRSFLLTLESASTNQTSVYLCASSE
Ailurus fulgens styani V535 trbv LNAC01000057.1 733048 LFPSFTGPVEAGVTQTPRHCIARTGRQLTLHCSQDMDHDAMYWYRQDPGLGLRLIYFSRNVEFVEDGDVPDGFTALRKEKKKFPLTLKSAGTNQTSLYLCASS
Ailurus fulgens styani V536 trbv LNAC01000057.1 724379 LVGAQVTQTPRHLIKPVGAKVLMECSQNKDHENMFWYRQDPGLGLQLLHWSYDVGETEPGDIPFGYTVSRKKKEAFPLTLESASTNQTSVYLCASS
Ailurus fulgens styani V537 trbv LNAC01000057.1 718971 SVFRALLSQKPRRDICQRGTSKTIQCEADTQLSLMYWYRQLPGQSLILIATANQGMEATYESGFTKEKFPISHPNLTFSTLTVNNMSLEDSSFYLCCAG
Ailurus fulgens styani V619 igkv LNAC01000180.1 21554 ARGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVSWYQQKPGQSPRLLIYDASKRATGVPDRFSGSGSGTDFTLTISSLQAEDVGDYYCYQYYSTP
Ailurus fulgens styani V620 igkv LNAC01000180.1 15611 SSGDIVLTQSPASLTLSPGQRATISCKTSQKVSDLLGITHFITWYQQKSGERPKILIYKASSLVSGVPARFSGGGSGTEFSLTVDPVEAGDAATYYCQQSKETP
Ailurus fulgens styani V621 iglv LNAC01000185.1 584518 SWAQPVLTHPPSESGALGQRVTISCTGSSPSIGGYGVNWYQQLPGMAPKLLIDGSNSRASGVPNQFSGSRSGNLHSLTITGIQAEDEADYYCQSIERTLG
Ailurus fulgens styani V685 iglv LNAC01000325.1 945474 SQPGLAQPDALLVFPGQVAQLSCMLSPRHATIGEYGVSWYQQRAGSAPRYLFYYRSEDDYHRPPDIPDRFSAATDAAHNACILIISPVQPEDDADYYCSVA
Ailurus fulgens styani V737 trdv LNAC01000664.1 213188 EGVLCDQVTQSPLDQTVAGGDKVMLFCTYHTTESNPDLYWYRVRPDHSFQFILYRDNTLSHNADFAQDRFSVLHKQSQRTFHLVIFPVEPEDSATYYCAMD
Ailurus fulgens styani V774 ighv LNAC01001152.1 293835 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLQWVAYISSGGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCAK
Ailurus fulgens styani V775 ighv LNAC01001152.1 239546 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFGSYGMNWVRQAPGKGLKWVAYISSGGSSTSYADSVKGRFTISRDNGKNTLFLQMNSLRAEDTAAYYCAR
Ailurus fulgens styani V776 ighv LNAC01001152.1 200915 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYYMSWICQAPGKGLQWVASISSDGSYIYYADSVKGQFTISRDNGKNTLYLQMNNLRAEDTAVYYCAK
Ailurus fulgens styani V777 ighv LNAC01001152.1 181766 VQCEMQLLESGGDLAKPGGSLRLSCAASGFTFSGYGMSWVRQAPGKGLQFLSSIDAGGSSTTYTDSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYFCAK
Ailurus fulgens styani V778 ighv LNAC01001152.1 158471 VQCEVQLVESGGDLVKPGGSLRLSCAASGFNFGSYWMSWVRHAPGKGLQWIASIRYDGSSTYYTDSVKGQFTISRDNGKNTLYLQMNSLRTEDTAVYYCTS
Ailurus fulgens styani V779 ighv LNAC01001152.1 141203 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYEMSWVRQAPGKGLQWVAYISNTGGSTGYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTAVYYCTS
Ailurus fulgens styani V780 ighv LNAC01001152.1 114605 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMGWIRQAPGKGLQWVASISNSGRYTYYADAVKGRFTISRDNGKNTLFLQMNSLRAEDTAVYYCAR
Ailurus fulgens styani V781 ighv LNAC01001152.1 95874 VHSQVQLVQSEAEVRKPGESVKVSCKASGYTFTSYGMNWVRQAPGKSLQYMGWINTNTGNPTYAQGFSGRFLFSMDTSVSTAYLQISSLNSEDTAMYYCAR
Ailurus fulgens styani V782 ighv LNAC01001152.1 79915 VQCEVQLVESGGDLVKPGGSLRISCAASGFTFSSYAMYWIRQAPGKGLQWVAWINYVGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAK
Ailurus fulgens styani V783 ighv LNAC01001152.1 53691 VHSQVQLVQSEAEVRKPGESVKVSCKASGYTFTSYGMNWVRQAPGKSLQYMGWINTNTGNPTYAQGFSGRFLFSMDTSVSTAYLQISSLNSKDMAMYYCAR
Ailurus fulgens styani V784 ighv LNAC01001152.1 39749 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAGIYSGGSSTYYADAVKGRFTISRDNGKNTLYLQMNSLKPEDTAVYYCAK
Ailurus fulgens styani V785 ighv LNAC01001152.1 20260 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMGWVHQAPGKGLQWVASIDDDGSTYYADSVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAK
Ailurus fulgens styani V786 trav LNAC01001156.1 303932 VRGVNVEQSPSALSLQEGDSSTLKCNFSSSVNNVQWFRQNLGGGGLTRLFYIASGMKQSGRLNCTANTRERTSILHIRASQLEDSATYLCAVE
Ailurus fulgens styani V787 trav LNAC01001156.1 296425 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASVYFPWYKQELGKGPQLLIDIRSNVAKKEDQRLTVLLNRTAKHLSLHITDTQPEDSAVYFCAA
Ailurus fulgens styani V788 trav LNAC01001156.1 284859 VRGIDVEQSPSALSLQEGDSSTLKCNFSSTPDSVQWFRQNLGGGGLTRLFYIVSGMKQSGRLNCTANTRERTSTLHIGASQLEDSATYLCAVE
Ailurus fulgens styani V789 trav LNAC01001156.1 279664 FSQGEKVEQYPSTLSVQQGSSSVINCSYSDSTSNYFPWYKQELGKSPQLLIYISSSMAKKEDQRLTVLLNRTAKHLSLHITDTQPEDSAVYFCAA
Ailurus fulgens styani V790 trav LNAC01001156.1 271837 QTHGQSVTQTEGQMTLSEKAFLTTNCTYSASGYPALFWYVQYPGEGLQLLLKASRDKEKGSNKGFEATYHRDSKSFHLEKGSVQASDSAVYYCALS
Ailurus fulgens styani V791 trav LNAC01001156.1 268330 ASIAQKVTQAQRAMLVQEKGAVTLECTYNTVDPNYSLFWYKQPSSGTMIFLIRQNSYSQQNTTEGRYSLNFWKMRRSIQLVILASELEDSAVYFCALS
Ailurus fulgens styani V792 trav LNAC01001156.1 259599 KTRGDSVTQTEGQVTLLEEASLTVNCTYSASGSFTLFWYVQYPGEGLQLLLKALKDKEKGSKKGFEATYDSKSKSFHLEKGSVQASDSAVYYCALS
Ailurus fulgens styani V793 trav LNAC01001156.1 250662 VRGMNVEQSPSALSLQEGASSTLKCNFSSGVYNVQWFRQNLGGGGLTSLFYIASGMKQSGRLNCTANTREQSSTLHIMASQLEDSATYLCAVE
Ailurus fulgens styani V794 trav LNAC01001156.1 244460 FSQGEKVEQYPSTLSVQQGSSSVISCSYSDSTSDYFPWYKQELGKGPQLLIDIRSNVARKEDQRLTVLLNRTAKHLSLHITDTQPEDSAVYFCTA
Ailurus fulgens styani V795 trav LNAC01001156.1 238579 QTHGNSVTQTEGQVTLSEEASLTLNCTYSTTVFPSLFWYVQYPGKGPQLFLSAFTDQEKSRNKGFEATLDNKLKSFHLEKGSVQASDSAVYYCALS
Ailurus fulgens styani V796 trav LNAC01001156.1 229329 VRGMNVEQSPSALSLQEGASSTLKCNFSSTLRSVQWFRQNPGGGSLTSLFYVASGMKQSGRLNCTVNTREQSSTLHIMASQLEDSATYLCAVE
Ailurus fulgens styani V797 trav LNAC01001156.1 224752 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASEYFPWYKQELGKGPQLLIDIRSNVAKKEDQRLTVLLNRTAKHLSLHIADTQPEDSAVYFCAA
Ailurus fulgens styani V798 trav LNAC01001156.1 217691 QIHGDSVTQTEGQVTLSEKAFLTVNCTYSTTGFPTLFWYVQYPGEGPQLLLKALQDKEKGSNKGFEATFHSKSKSFHLEKGSVQVSDSAVYYCAMN
Ailurus fulgens styani V799 trav LNAC01001156.1 208741 VRGIDVEQSPSALSLQEGASSTLKCNFSSSVNSVQWFRQNPGGGGLTRLFYIASGMKQSGRLNCTANTRERTSTLHIGASQLEDSATYLCAVE
Ailurus fulgens styani V800 trav LNAC01001156.1 200854 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSTSEYFPWYKQELGKGPQLLIDIRSNVARKEDQRLTVLLNRTAKHLSLHITDTQPEDSAVYFCAA
Ailurus fulgens styani V801 trav LNAC01001156.1 192675 QTHGDSVTQTKGQVTLSEEAFLTINCTYSTTTLGYPTLFWYVQSPGEGLQLLLKASRDKEKASNKGFEATYDRNSKSFHLEKGSVQASDSAVYYCAMN
Ailurus fulgens styani V802 trav LNAC01001156.1 188885 SSIAQKVTQAQRAMLVQEKGAVTLECTYNTNEPRYSLFWYKQPSSGAMIFLIRQDSYSQQNATDGSYSLNFQKTRKSIQLVVSSSKLEDSAVYFCALSE
Ailurus fulgens styani V803 trav LNAC01001156.1 182800 QIHGDSVTQTEGQVTLSEEAFLTINCTYSTTIGYPTLFWYVQSPREGLQLLLKASRDKEKGSNKGFEATFHSKSKSFHLEKGSVQASDSAVYYCAMN
Ailurus fulgens styani V804 trav LNAC01001156.1 174591 GVSGQNQVEQNPTSLVILEGKNCTIQCNYTVNPFSSLRWYKQGTGRGPASLIVVGSSDSKKSDGRYTATLDATSKHSSLHITAALLSVSALYICAVS
Ailurus fulgens styani V805 trav LNAC01001156.1 161216 MRSQQEGVEQSPGSLSVQEGATASFNCSYSDRASQYFSWYRQYSGKGLELLMYMYSKGDKKEGRFSGQVDTAKQYVSLLIRDSQPSDAATYLCAV
Ailurus fulgens styani V806 trav LNAC01001156.1 158924 GTGAQSVTQPDAHVTVFEEAFLELRCNYSYGATPYLYWYVQYRNQGLQLLLQYFSGNALVKGIKGFEAEFRKTESSFHLRKHSAHGSDTGVYFCAVS
Ailurus fulgens styani V807 trav LNAC01001156.1 153210 GTGAQTVTQPEDHISVFEGDFVQVKCNYSYSGSPVLFWYVQYPKQALQLLLKHTSGESIKGFMANLNRDETSFHLKKQSAQEEDSATYYCALS
Ailurus fulgens styani V808 trav LNAC01001156.1 149131 VSSQQEQYHQVLSIQEGGNATMSCSYKTSISNLQWYRQDAGRGFVQLILIRSNEKEKHSGRLQVTLNKSIKSSSLSIIASETADTATYICAM
Ailurus fulgens styani V809 trav LNAC01001156.1 144330 GTNGDTVTQTEGSVTLPEGTPLTLNCTYQSSYSVFAFWYVQYQNKEPKLLLKSSSENQRVEHHGFQASLKSDKSFHLEKRSVQTSDSAVYYCAVG
Ailurus fulgens styani V810 trav LNAC01001156.1 131291 SSMTQKVTQAQPAISTLENESVTLDCVYEVSGSSYYLFWYKQPPSGEMIFLILQESYREKNATEGRYSLNFQKSDSSISLTITALQPADSAVYFCAVR
Ailurus fulgens styani V811 trav LNAC01001156.1 122063 LSGEDRVEQSPQTLRLQEGDSVSLNCSYTVSYFNGLQWYKQDPGKGPEVLFLLYSVGDEKQKERLRATLLKEGSSLHIEASKPEDSATYLCAV
Ailurus fulgens styani V812 trav LNAC01001156.1 114585 VSSKQEVKQNPEALNIRERDSAVLGCNYTDGNPYSLQWFRQDPGKGLTFLLMILSNQKEQTSGRIKVSLDTSARQSTLYIAASQPSDSATYLCAV
Ailurus fulgens styani V813 trav LNAC01001156.1 104426 VTCAEVEQRPPALSLQEGASSTLQCNFSSSATSVHWYRQDPGGRLIHLFYIPSGTKKNGRLNSTTIAKERRSSLYISLSQTTDSATYYCAADPQCSP
Ailurus fulgens styani V814 trav LNAC01001156.1 74701 VGSVLNVEQNPPWLRVQEGENTNFTCRFPSSNLYSLHWYRWERAKSPTFLFSVTLNGDEKRKGRVKTILNTQEGYSSLYIKGCQPEDAATYLCAM
Ailurus fulgens styani V815 trav LNAC01001156.1 67352 INGQEIKQNPQFLLLQEGQDFTIYCNSSSTLNSLQWYKQRPGGGPVLLITLLRGGEVKQKRLTARFGETRKDSSLHMEAAQTADAGTYFCMVPQCSQ
Ailurus fulgens styani V816 trav LNAC01001156.1 55005 ESTQQLEQSPRFLSIQEGENFTAYCNSTSIFPSFQWYRQKPEEGPVHLMTLSKGGEMKKHKSLTARFGEERKDSSLIITAAQPVDAAIYLCAG
Ailurus fulgens styani V817 trav LNAC01001156.1 48843 VRRVQMKVEQSPRVLILQEGRNASMMCNYSISMTSVQWFQQSPEGRLTYLSYIASGMQQKGRLKFTVNIKERNSHLYITDSQPGDSVTYFCAVE
Ailurus fulgens styani V818 trdv LNAC01001156.1 27658 SSMAEKVVQTQNPINRQEGEAATFYCKYETSWKNYYALYWYKQPPSGEMIFLIYQDESKPNAKQGRFSMDFKKEVKSISLTISPLQLTDSAVYFCALGS
Ailurus fulgens styani V819 trav LNAC01001156.1 24513 IMSDAKTTQPNAMESTEEEPVHLPCNHSTISGNEYIFWYRQLPNQGPEYIIRGLKDNVTDGMATLIITRARESSTLILPRVTLGDAAVYYCIVRE
Ailurus fulgens styani V820 trav LNAC01001156.1 17507 VSSQELEQRPQSLIIQEGEDFTINCSSSKPVYALHWYRQKKSEGLISLMLLWKNGEEKNHEETTATLDEKKQQSFLRITASQPSHSGTYLCAAD
Ailurus fulgens styani V822 trav LNAC01001156.1 2885 VSSEDKVIQNPSLVVREGDNATLSCSYEVTGFQSLFWFKQEEKTPTFLLRRISSGTEKSGRLKGTLGKKEFLGTLHITATQPGDSATYLCAVE
Ailurus fulgens styani V835 iglv LNAC01001598.1 95429 SQAQSSLSQPSSVSGALGQTVTISCAGTSNDIGSYNLVSWYQQLPGTSPKLLIYRVSSRPTGIPDRFSGSKSGNTASLTISRLQAEDEADYYCASYRSG
Ailurus fulgens styani V836 iglv LNAC01001598.1 19951 SQAQSSLSQPSSVSGALGQTVTISCAGTSNDIGRYNYVSWFQQLPGTSPKLLIYNVNSRPSGIPDRFSGSKSGNTASLTISRLQAEDEADYYCASYTTSST
Ailurus fulgens styani V844 trav LNAC01001723.1 14742 VRGVNVEQSPSALSLQEGDSSTLKCNFSSSVNSVQWFRQNLGGGGLTRLFYIASGMKQSGRLNCTANTRERTSTLHIGASQLEDSATYLCAVE
Ailurus fulgens styani V845 trav LNAC01001723.1 10102 VSRGEEVQQHPSFLTVWEGDSFVINCTYTGTVPDYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLFNKENKHLSLQDTAAQLGDSATYFCATR
Ailurus fulgens styani V846 trav LNAC01001723.1 6476 VSSQKMEQNPQSLSIQEGEKAVLTCNYTNYSPFVFQWYRQELGRGLVFLLLIRENEGEKQSGRLRATFDKTTQQSSFYITTSQPADSATYFCAA
Ailurus fulgens styani V847 iglv LNAC01001774.1 86271 SVTSYVLTQPPSVSVALGQTAQVTCGGNNIGIRSVNWYQQKPGQAPVLIIYYSNRRPSWIPERFSGTKSGNTAILTISGAQAEDEADYYCHVWDSSGN
Ailurus fulgens styani V848 iglv LNAC01001774.1 54622 SMASYVLTQPPSMSVNLGQTARIMCGGNNIGSKNAYWYQKKPGQAPVMIIYWSSNWPSGIPDWFSGMNAGNTATLTISGAQAEDEADYYCQEWDSSAY
Ailurus fulgens styani V849 iglv LNAC01001774.1 17345 SVVSSELTQPPSVSVALGQTATITCTGEEVSYGYVQWYQQKPGQSPLTVIYEDSERPSGIPERFSGSKSGNTATLTISKAQAEDEADYYCQSYGNSGN
Ailurus fulgens styani V850 iglv LNAC01001778.1 38674 SWAQSVLTQPPSVSGALGQRVTISCTGIPTIMEYDEEEYPSYVHWYQQLPGKGPRLLIYADDNRNSRVPDRFSGSKSGSSASLTITGLQAEDEADYYCQ
Ailurus fulgens styani V851 trgv LNAC01002038.1 21094 GGAGLKLEQQDMVVERLGGTASLRCKVDSWVSYIHWYRHQEGSAPQRLLYLDMSKSNIRNDYVLKADKVKARKGMESNSCILSLLKLEKSDEGVYYCAAWE