WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pogona vitticeps CEMB00000000.1 (CEMB01) 588 304 148 16 92 12 16 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pogona vitticeps V0 trbv CEMB01002966.1 576109 PADSQSNVKVIQQPPSENLLQGKALELRCSVNQENYYFYWYRQVPGETKLQSLGTFRTFESTLQEPADELKERLSGERKNNECSLNLASLQSSDSGLYLCAAK
Pogona vitticeps V3 ighv CEMB01002971.1 49406 AQSQIQLVQSGPEIKKPGESVRFTCKASGYTFNQYSLSWIRQAPGKGLEWVGRIRTDNFDTFYPESLKTRVTITVDVSISTLYLQLTGLKTEDTAVYYCA
Pogona vitticeps V5 ighv CEMB01002971.1 88133 ILSQISLRESGGGVKKPGETLQLTCTVSGFPLTSYGVHWIRQPPGKGLEWAGVIWGDGSNNYNSALQSRISITRDVSKSQVFLQLRNLKPEDSAMYYCAR
Pogona vitticeps V6 ighv CEMB01002971.1 90592 ILSQISLRESGGGVKKPGETLQLTCTVSGFSVASKAVHWIRQPPGKGLEWAGVIWSSGGNSYNSALQSRISITRDPSKSQVSLQLRNLKPEDSATYYCAR
Pogona vitticeps V7 ighv CEMB01002971.1 120112 ISSQVTLTESDGGLKKPGETLHLICTVAGYSLTDSTYATDWVRQPLGKGLEWSGAIWHDGTARYNSALQNRATITRDISKSQVLFQLSAVKTEDSAVYYCA
Pogona vitticeps V8 ighv CEMB01002971.1 122484 ISSQVTLTESGGGLKKPGETLHLTCTVAGYSLTDSSYATNWVRQPSGKGLEWVGIMWHNGGTAHNSVLQNRATITRDTSKSQVFLQLSALKPEDSAVYYCAR
Pogona vitticeps V9 ighv CEMB01002971.1 128357 VSSQVTLTESGGGLKKPGETVHLTCMVTGYSLTDSSYATHWVRQPLGKGLEWTGGIWYDGTARYNSALQNRATITRDISKSQVFFQLSDVKPEDSAVYYCARE
Pogona vitticeps V10 ighv CEMB01002971.1 130919 ISSQVTHTESGGAPNKPGEALHLTCIVTGYSLTDASYATGWVRQPFGKGLEWIGIIWSHGPSVYNTALQNRAIITRDTSKSRVFLQLNALKPEDSAVYYCIR
Pogona vitticeps V11 ighv CEMB01002971.1 145823 VQSQGRLEQSEGGIRKPGESLRLSCRGSGFAFGSTGMHWVRQATGKGLEWIAVIWYDASKQYYADSVKGRFIISRDNPSSVAYLQMNDLKAEDTAVYYCA
Pogona vitticeps V12 ighv CEMB01002971.1 148247 VHASVRLVESGPGMLKPGQSLRLSCAITGDSVKSSYWHWVRQAPGKRLEWVGRIDWSSSTWRILYAPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V13 ighv CEMB01002971.1 152900 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V14 ighv CEMB01003547.1 637 VISQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMHWVRQKPGKGLEWLVSYYTASSNNYSPAIRGRFTASKGASDFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V15 iglv CEMB01004663.1 11643 SFGQYVLTQPPSASVSLGQNAQISCSGNNIERKSVQWYQQKPGKAPVLIIYVDNRRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVWDSNA
Pogona vitticeps V0 trbv emb|CEMB01002966.1| 576109 PADSQSNVKVIQQPPSENLLQGKALELRCSVNQENYYFYWYRQVPGETKLQSLGTFRTFESTLQEPADELKERLSGERKNNECSLNLASLQSSDSGLYLCAAK
Pogona vitticeps V3 ighv emb|CEMB01002971.1| 49406 AQSQIQLVQSGPEIKKPGESVRFTCKASGYTFNQYSLSWIRQAPGKGLEWVGRIRTDNFDTFYPESLKTRVTITVDVSISTLYLQLTGLKTEDTAVYYCA
Pogona vitticeps V5 ighv emb|CEMB01002971.1| 88133 ILSQISLRESGGGVKKPGETLQLTCTVSGFPLTSYGVHWIRQPPGKGLEWAGVIWGDGSNNYNSALQSRISITRDVSKSQVFLQLRNLKPEDSAMYYCAR
Pogona vitticeps V6 ighv emb|CEMB01002971.1| 90592 ILSQISLRESGGGVKKPGETLQLTCTVSGFSVASKAVHWIRQPPGKGLEWAGVIWSSGGNSYNSALQSRISITRDPSKSQVSLQLRNLKPEDSATYYCAR
Pogona vitticeps V7 ighv emb|CEMB01002971.1| 120112 ISSQVTLTESDGGLKKPGETLHLICTVAGYSLTDSTYATDWVRQPLGKGLEWSGAIWHDGTARYNSALQNRATITRDISKSQVLFQLSAVKTEDSAVYYCA
Pogona vitticeps V8 ighv emb|CEMB01002971.1| 122484 ISSQVTLTESGGGLKKPGETLHLTCTVAGYSLTDSSYATNWVRQPSGKGLEWVGIMWHNGGTAHNSVLQNRATITRDTSKSQVFLQLSALKPEDSAVYYCAR
Pogona vitticeps V9 ighv emb|CEMB01002971.1| 128357 VSSQVTLTESGGGLKKPGETVHLTCMVTGYSLTDSSYATHWVRQPLGKGLEWTGGIWYDGTARYNSALQNRATITRDISKSQVFFQLSDVKPEDSAVYYCARE
Pogona vitticeps V10 ighv emb|CEMB01002971.1| 130919 ISSQVTHTESGGAPNKPGEALHLTCIVTGYSLTDASYATGWVRQPFGKGLEWIGIIWSHGPSVYNTALQNRAIITRDTSKSRVFLQLNALKPEDSAVYYCIR
Pogona vitticeps V11 ighv emb|CEMB01002971.1| 145823 VQSQGRLEQSEGGIRKPGESLRLSCRGSGFAFGSTGMHWVRQATGKGLEWIAVIWYDASKQYYADSVKGRFIISRDNPSSVAYLQMNDLKAEDTAVYYCA
Pogona vitticeps V12 ighv emb|CEMB01002971.1| 148247 VHASVRLVESGPGMLKPGQSLRLSCAITGDSVKSSYWHWVRQAPGKRLEWVGRIDWSSSTWRILYAPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V13 ighv emb|CEMB01002971.1| 152900 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V14 ighv emb|CEMB01003547.1| 637 VISQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMHWVRQKPGKGLEWLVSYYTASSNNYSPAIRGRFTASKGASDFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V15 iglv emb|CEMB01004663.1| 11643 SFGQYVLTQPPSASVSLGQNAQISCSGNNIERKSVQWYQQKPGKAPVLIIYVDNRRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVWDSNA
Pogona vitticeps V16 ighv emb|CEMB01005058.1| 91 FSEIRFTESGGGARKPGASLRLTCAVSGYSITSGAGLHWVRQPPQKGLEWIGMIYYSSSTWKTNYGSAFQSRATLSADSSKNQYYLELRSLTAADTAVYYCTGE
Pogona vitticeps V19 igkv emb|CEMB01007043.1| 139 TRGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQSDRVP
Pogona vitticeps V20 igkv emb|CEMB01007043.1| 11432 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGHARQKDVPARFSSSGYGEDFTLTISSVEAEEEGYYHCQQSDRVP
Pogona vitticeps V21 iglv emb|CEMB01008496.1| 991 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYKDSSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V22 ighv emb|CEMB01009219.1| 4228 VHASVQLVESGPGTLKPGQTLRLSCAVTGDSVENSYWHWVRQAPGKGLEWVGRIDWSGSTWRIFYTSSLQSRATLSADSSKNEYYLELRSLTAADTGVYYCARE
Pogona vitticeps V23 ighv emb|CEMB01009219.1| 7399 VHASVQLVESRPGTLKPGQSLRLTCTISGDSVKSNYWHWVRQASGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSVTAADTAVYYCARE
Pogona vitticeps V24 ighv emb|CEMB01009219.1| 11208 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V25 ighv emb|CEMB01009219.1| 13801 VHASVRLVESGPGTLMPGRSLRLTCTISGASVKSKYWHWVRQAPRKGLEWVGQIVWIGITWGTIYAPSLQSRATLSADFSKNEYYLELRSLTAADTAVYYCA
Pogona vitticeps V26 ighv emb|CEMB01009219.1| 18433 VHANVQLVESGPGTLKPGQSLRLACKISGDSVKSNYWHWVRQAAGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARE
Pogona vitticeps V27 ighv emb|CEMB01009219.1| 50065 ARSEVLLVESGGDVKRPGDSLRLSCRASGFTFSSYAMGWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V28 ighv emb|CEMB01009219.1| 51045 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V30 iglv emb|CEMB01009691.1| 12475 VDSQPTVTQPASQSVSPGQTTTLSCSKSSGSWGSYVYWLQQKPGQPPRFVHCDGCSSRGAGIPDRFTASASGNSGSLRITNVEAGDEAIYYCYVWSSSARV
Pogona vitticeps V31 iglv emb|CEMB01009691.1| 17794 ATSQPTVAQPASQSVSPGRTTTLSCSKSSGNWNDGVYWLQQKHGQPPRFVHCNGCCSRGAGIPDRFTASASGNSGSLTITKVEDGDEAVYYCYAWS
Pogona vitticeps V32 iglv emb|CEMB01009691.1| 29035 SDGQFTMSQPPSVSAAIRETVQIPCRRSSGSVSSYYNSWYQQKPGSAPILLIFGDDATASGIPERFSGSIDESANTATLTISNVQAEDEADYYCLSSDSSGQ
Pogona vitticeps V33 iglv emb|CEMB01014241.1| 9696 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRYISWYQQKPGSAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSGKIGYLTISGALAEDKAVYYCAV
Pogona vitticeps V37 iglv emb|CEMB01019501.1| 8762 ANSQLTVSQPPSASVSLGNTVKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSRFSGSKDSSGSIGYLTISGALAEDEAVYYCAAGYNG
Pogona vitticeps V38 ighv emb|CEMB01021537.1| 547 CHPKPQLIETGGGVVAPGGSLRLSCKASGFTFTNYTMHWVRQAAGKGLEWVAGVSKPTGSSQWYNSKVQGRFNISRDNTQSSVYLQMANLKSEDSAVYYCAR
Pogona vitticeps V40 iglv emb|CEMB01021861.1| 6458 IHSQPTVSQPASASASPGQTVKLSCTRSSGGSWSSLYWYQQRPGQAPRFVHCQSCSRGEGIPGRLTASESGGNGLLTITNVEAGDEAVYYCAAWY
Pogona vitticeps V41 ighv emb|CEMB01022913.1| 816 CHSQVQLVETGGGVVSPGGSLLLSCKASGFTFSGYYMSWVRQAAGKGLEWVARITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKAEDSAMYYCAR
Pogona vitticeps V42 ighv emb|CEMB01022913.1| 13012 VVSQVVLTQPGPVLKKPGESHKLSCATSGFTLSSTWMGWIRQKPGKGLEWLAWYYGTASGQSFYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V43 ighv emb|CEMB01022913.1| 15086 VVSQVVLTQSGPVLKKPGESLKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYLGTSSGHSYYTPAIQGRFTASKDNSNLYLQMNNLKEEDTAVYYCAW
Pogona vitticeps V44 ighv emb|CEMB01022913.1| 20454 VVSQVVLTQSGPVSKKPGESHKLTCATSGFTLSSYGMSWVRQKPGKGLEWLVYYYNTASGNSHYTPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V45 ighv emb|CEMB01022913.1| 26349 CRSAVQLVETGGGVVSPGGSLRLTCKASGFPFSGYSMHWVRQAAGKGLEWVAGIRYDGADQWYNSKVQGRFTISRDNPQSSVDLRMGSLKPEDSGVYYCVR
Pogona vitticeps V46 ighv emb|CEMB01022913.1| 28751 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVHQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V47 ighv emb|CEMB01022913.1| 30725 VVSQVVLTQSGPVLKKPGESHKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V48 ighv emb|CEMB01022913.1| 32733 VVSQVVLTQSGLVLKKPGESHKLTCETSGFALSTAWMDWFRQKPGKDLEWLVHYYSTASGRNFYSPAIQARFTASKDSSNFYLQLNDLKEEDTAVYYCAR
Pogona vitticeps V49 ighv emb|CEMB01022913.1| 35660 CHSEVQLVETGGGVVAPGGSLHLSCKASGFTFSSYEMHWIRQAAGKGLEWVGGISGSGGSQWYNSKVRGRFTISRDNARSSADLRMASLKPEDSAMYYCTR
Pogona vitticeps V50 ighv emb|CEMB01022913.1| 39917 IHSQGQPSLEESGGGLKRPGEALRLSCRASGFTFSSYYMIWVRQAPGKALEWIAGIYTDGSQQQYAETVKGRFTISRNNPSNMLYLQMNNLKPEDTAVYYCAR
Pogona vitticeps V51 iglv emb|CEMB01023034.1| 1814 TNSQLTVTQPPSASVSLGNTVKLSCTISMTGRAISWYQQKPGSAPRYLLYYFSESYKHQGSGVPSRFSGSKDSSDKIGYLSISGAMAEDEAVYYCAAYDSSV
Pogona vitticeps V55 iglv emb|CEMB01025177.1| 3904 VTSQPTVTQPVSQSASPGQTTTLSCSKSSGSWSSYVSWVQQKPGQPPRFVHCNGCSRGAGISDRFTASASGNSGSLTITNVEAGDEAVYYCHAWS
Pogona vitticeps V57 iglv emb|CEMB01025177.1| 39715 VSSQASVTQPASASVSLGQTVKLSCTRSSGDSWNPFHWHQQKSGEALRFVLYGSSIRGEGIPDRFSGSASGNTGYLTITDVQAGDEGVYYCGAWYGAG
Pogona vitticeps V59 iglv emb|CEMB01025177.1| 50631 VDSQPTLTQPASQSVSPRETTTLNCLKGSGSWNSRVSWVQQKPGQPPRFVHCNGCSSRGAGIPDRFTASASGNTGSLTITNVEAGDEAIYYCAVWS
Pogona vitticeps V60 iglv emb|CEMB01025177.1| 54903 IRSEATVTQPASASVSLGETVKLSCTGSSDGTWSIFSWYQQKPGQAPQFVHCDDCNRGEGTPDRFTASESGDTGFLTITDSQAEDEANYYCAAWDYTSST
Pogona vitticeps V61 igkv emb|CEMB01025177.1| 71606 CDGQFTMSQLPSISAAMRETVQIPCRRSSENVGRFYNSWYQQKPGSAPILLLYKHSVRASGIPERFSGSIDISANTATLTISNVQAEDEAIYYCFSYDGRRQ
Pogona vitticeps V62 iglv emb|CEMB01025177.1| 76532 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYDRGEGIPNRFTASASGNSGSLTITNAEAGDEAVYYCVVWS
Pogona vitticeps V63 iglv emb|CEMB01025177.1| 82192 VTSQPTVTQPASQSASPGQTTTLSCSKSSGSWSGYVNWIQQKPGQAPRFVHCNICSRGPGIPDRFTASASGNTGSLTITNIEAGDEAIYYCAEWS
Pogona vitticeps V64 iglv emb|CEMB01025177.1| 101672 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYNRGEGIPNRFTASASGNSGSLTITNVEAGDEAVYYCYVWS
Pogona vitticeps V66 ighv emb|CEMB01025868.1| 114 IHSQGVVLTQGGSELKKPGESARLKCATSGFVLNDYYTAWIRQKPGEGLQWLVSYWKASQTNYYLPAIQNRFTASKDSSNFYLQMNNLTPEDTAVYYCAR
Pogona vitticeps V67 iglv emb|CEMB01027487.1| 3118 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKNVHWYQQKPGKAPVLIIYNDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDGNA
Pogona vitticeps V68 iglv emb|CEMB01028068.1| 4357 HCVSTTFGLSISVSLGDTVKLPCAISRNDRYIYWYQQKTGSSPRYLLYYGSESRKGQGSGVPSRFSGSKDSSGRIGYLTISGALAEDEAIYYCSAADSYA
Pogona vitticeps V69 iglv emb|CEMB01028068.1| 21669 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V70 iglv emb|CEMB01028068.1| 24175 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V71 iglv emb|CEMB01028068.1| 29351 ITSQATVTQPASISLSPGQTLKLSCTRSGGSSWGGFQWYRQRPGEAPHFVHRESYSRGEGISDRFTASQSGDAGQLTITNVQATDEAHYYCFISYDNGNQ
Pogona vitticeps V72 iglv emb|CEMB01028068.1| 33065 ANSQLTVSQPPSASVSLGSTTKLSCTISMDGRTIRWYQQKPGNAPRFLLYYYTESSKGQGSGVPSRFSGSKDSSGKIFYLTISGALAEDEAVYYCAAWYSDA
Pogona vitticeps V74 trav emb|CEMB01029335.1| 217 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASRL
Pogona vitticeps V75 iglv emb|CEMB01029607.1| 470 ANSQFTVSQPPSASVSPGNTAKLSCTISSSGKTVYWYQQKPGNAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSNTIGYLTISGALADEAVYYCTAWDGNA
Pogona vitticeps V76 iglv emb|CEMB01030482.1| 1072 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGTYVHWYQQKPGKAPVLIIYYNSRRSAGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVGDGNA
Pogona vitticeps V77 trav emb|CEMB01032697.1| 2273 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPHLFWYTQHLDDGSLQLLLQEHNAEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V78 trav emb|CEMB01032697.1| 3731 GTHADSVSQTEDLVTVREGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V79 trav emb|CEMB01032697.1| 7495 STTGQSVNQAEGTVLVTQGKNIFLHCSYKSSFTTAYPFWYVQYPGQPPRLFLREFGKEEGDRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVR
Pogona vitticeps V80 trav emb|CEMB01032697.1| 9791 SCVNAQKIVQPESAVSFAGASFNLPCNLSSVSTEMIQWYRQFPGQGPQYIAGAFPGRTGEGTNPKSTLRFAKEKTSSVLVLHRVTLADAAVYFCALSD
Pogona vitticeps V81 trav emb|CEMB01032697.1| 12864 FGLSDSIFQLLSVRSVSEGEDVVLYCNFSTFDSNPYLFWYNQFPSQPPKHITTIARYSTNVPGTLNLEKKTVSLKIETVSLRDQAVYFCALR
Pogona vitticeps V82 trav emb|CEMB01032697.1| 16331 STTGQSVNQIEGTVVVTQGKNIFLHCSYESSFTTNDPFWYVQYPGQRPRLFLKEYTKEEGNRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVS
Pogona vitticeps V83 trav emb|CEMB01032697.1| 18293 SLGRAQKIVQPESAIPVAGGSYDLPCNLSSVSSEKILWYRQFPGQGPQYIAGAYPGRTDEGTDPKSTLRVAKEKTSSVLFLHHVTLADAAVYFCALVL
Pogona vitticeps V84 trav emb|CEMB01032697.1| 23715 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V85 trav emb|CEMB01032697.1| 26076 MKGSPVNQPEGTMTITEGKQITIKCTYEKSIYYLFWYIQHPGQPPKLFLRDAEDPSDEGRARGFVAENEKPLSTFSLKKTAIQLEDSAIYFCAGS
Pogona vitticeps V86 trgv emb|CEMB01032697.1| 30541 VLWCKAQEIIQEPVMEASEGKTFNLTCSHPKATTETIFWYRQFPGQTLLYVTSGYSHNEEGTLHVPSGRKSNALTLTKVTLNDAAVYYCALS
Pogona vitticeps V88 trgv emb|CEMB01032697.1| 37330 ILLCKAEQITQEPLVEASVGKALNLSCSHPSAAKGDAIHWYQQLPNQAPHFIVSGYSGVVRSEKLKGASLLINEDKKSSYLSLTLVTLEEAAVYYCAVS
Pogona vitticeps V89 trav emb|CEMB01032697.1| 43621 FLGIAQKIEQQESTTAFSGKAHNLSCTLTSVSSVTKMIQWYRQFPGQGPQYIAGAYPGETVEGTDPKSTLHFAHDKKSSALALHHILLDDAAVYFCALAD
Pogona vitticeps V92 iglv emb|CEMB01034103.1| 692 ANSQPSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQRPGQAPRYVHCNGCSRGPGIPDRFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V93 trav emb|CEMB01035531.1| 34118 IDGQEKVEQHPPSLEVLRGNNATLTCTVSTGGLQWYRQHPGGKPIFLMFVYGGQRTKEGDHFVGEFNSKEKQGYLHIINAQLHHGENYFCAPD
Pogona vitticeps V94 trav emb|CEMB01035531.1| 37048 GTLGQSVDQTEGTVIVSQGSSVSIRCSYDLSGQVDPFWYIQLPGQPPKLFLRDLGKTDSDEGHLRGFMANHDKSSNKKQKTFHMEKSSVQLNDAALYFCAVR
Pogona vitticeps V95 trav emb|CEMB01035531.1| 40863 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNSVQWYQQNPDGQIVHIAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V96 trav emb|CEMB01035531.1| 45520 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNNLQWYQQNPDGHIVHVAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V97 trav emb|CEMB01035531.1| 49277 ARSQDAVEQEPLKVTREGENTTIACRYKTSNFYSLHWYRQYPGEGLEFLLQKVTDNPNLKDHMQGDLDKKKQLSRLSFRGARLRDDATYFCALA
Pogona vitticeps V98 trav emb|CEMB01035531.1| 91105 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDPKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V99 iglv emb|CEMB01035986.1| 6032 ATSQPTVTQPASQSVSPGRTTTLSCSKSSGSWNDGVYWLQQKHGQPPHFVHCNGCRSRGAGIPDRFTASTSGNSGSLTITNVEDGDEAVYYCAAWS
Pogona vitticeps V100 ighv emb|CEMB01036198.1| 2008 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTNSYYWNWIRQTPGKGLEWMGYWVGSTSYSPSFQNRITISVDSSQTKYFLRLTSGTAADTATYYCAR
Pogona vitticeps V101 ighv emb|CEMB01036198.1| 11157 LSSQLQLKESGPGMVKPGDILELTCMVTGGSVTSGPWWGWIRQAPGKGLEWMGLWNGNTYYSSSFQNRATISVHSSQTKYFLQLTSVTTADTGTYYCAR
Pogona vitticeps V102 ighv emb|CEMB01036198.1| 18124 LSFQLQLKESRPGTVRPGDALELTCTVTGGSVTSGNWWSWIRQAPGKGLEWIGMWDGSTYYSSSFQNRISISVHSSQTKYFLRLTSVTTADSSTYYCAR
Pogona vitticeps V103 ighv emb|CEMB01036198.1| 22116 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGPWWSWIRQAPGKSLEWIGSWTGSTYYSSSFQNRVTISVHSSQTKYSLRLTSMTTADTSTYYCAR
Pogona vitticeps V104 ighv emb|CEMB01036246.1| 142 THSQVVLTQEGPVVKKPGESHKLTCATSGLPLSSTWMTWIRQKPGKGLEWLLEYYDSGSNNYSPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCA
Pogona vitticeps V106 ighv emb|CEMB01036246.1| 4915 ARSQVVLTQDGPVVKKPGESHKLTCATSGLTLSSTIMQWIRQKPGKGLEWLVEYYSAGSNDYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAR
Pogona vitticeps V107 ighv emb|CEMB01036246.1| 8799 ARSQAVLTQEGPVVKKPGESHKLTCATSGLALSSTWMNWIRQKPGKGLEWLVHYYSAGNNYYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V108 ighv emb|CEMB01036246.1| 10296 TRSQAVLTQEGPVVKKPGESHKFTCATSGFTLRSTYMHWIRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V109 ighv emb|CEMB01036246.1| 20448 THSEVVLTQEGPVVKKPGESYKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V110 ighv emb|CEMB01036246.1| 21754 ARSQVVLTQDGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V111 ighv emb|CEMB01036246.1| 23058 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V112 ighv emb|CEMB01036246.1| 23575 ARSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLEWLVEYYSAGSNYYSPAIRGRFTASKGASDFYLQMNDLKAEDTAVYYCAR
Pogona vitticeps V113 ighv emb|CEMB01036246.1| 27139 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAKDTAVYYCAA
Pogona vitticeps V115 ighv emb|CEMB01036246.1| 46652 IFASLQLLESGPGVVKPGGSLKLTCVVSGVDVGDYYWNWIRQPPGKGLEWLGDIQDSDDGGGTAYNPRFISRMSISRDIAKNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V116 ighv emb|CEMB01036246.1| 53915 LSSQLQLKESGPGTVRPGDNLELTCTVTGGSITSSYIWNWIRQTPGKGLEWMGYWVGSPSYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V117 ighv emb|CEMB01036246.1| 56108 LSSQLHLKESGPGMVRPGDTLELTCTVTGGSVTSSWYWHWIRQTPGKGLEWMGYWTGSTSYSPSFQNRITISVDSSQTKYFLRLTSVTASDTAMYYCAG
Pogona vitticeps V118 ighv emb|CEMB01036246.1| 59553 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGYTWHWIRQTPGKGLEWMGWWSGSTRYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V119 trav emb|CEMB01534111.1| 54 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPRLFWYTQHLDDGSLQLLLQEHNTEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V121 ighv emb|CEMB01005252.1| 55426 FSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYDSAFQSRVSITADASKNEYYLELRSLTAADTAVYYCARR
Pogona vitticeps V122 ighv emb|CEMB01005252.1| 51630 FSENRLTESGGGAWKPGASLRLTCVVSGYSITSGAGLNWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARG
Pogona vitticeps V123 ighv emb|CEMB01005252.1| 48986 SSEIRLTQSGGETWKPGATLRLTCAVSGYAISSGYYWHWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARR
Pogona vitticeps V124 ighv emb|CEMB01005252.1| 42250 VQLEVQLLQSGGETKRPGESLRLSCRASGYPFGSHSAHWIRQAPRKALEWIAWIYDDGSRLSYADSVKGRFTISRDNSKNMLYLLMNSLRPDDTAMYYCAAE
Pogona vitticeps V125 ighv emb|CEMB01005252.1| 35499 FSEIRLTQSGGETWKPGATLRLTCAVSGYSMTSGYNWNWIRQPPQKGLEWIGRGYYSSSNWKTNYGSAFQSRISITADASKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V126 ighv emb|CEMB01005252.1| 32550 YSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYGSAFQSRVSITADASKNKYSLELRSLTAADTAVYYCARE
Pogona vitticeps V127 ighv emb|CEMB01005252.1| 29191 FSEIRLTQSGEGTWKPGASFRLTCKVSGYTMTSGAEWDWFRQPSKKALEWLGTGRYIRSTWKPGYSSAFQSRISITADASKNEYYLQLRSLTAADTAVYYCAR
Pogona vitticeps V128 ighv emb|CEMB01005252.1| 14190 AHSQVVLTQEGPVVKKPGESHKLTCATSGFSLSGSGMHWIRQKPGKGLEWLVYYYSASHNNYSPSIRGRFTASKGASDFYLQMNDLNAEDTTVYYCAR
Pogona vitticeps V129 ighv emb|CEMB01005252.1| 10761 ARSQVVLTQEGPIVKKPGESHKLTCATSGFPLSSRTMHWIGQKTGQGLEWLVRYYSAGDNQYSPSIRGRFTASKSASDLYLQMSDLNAEDTAVYYCARE
Pogona vitticeps V130 ighv emb|CEMB01005252.1| 8588 AHSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMSWIRQKPGKGLEWLLEYKDSGSNNYIPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCARF
Pogona vitticeps V132 iglv emb|CEMB01005754.1| 5399469 SFGQYVLTQPPSASVPLGQNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYYDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V135 igkv emb|CEMB01006509.1| 4682 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQNDRVP
Pogona vitticeps V136 iglv emb|CEMB01007033.1| 4231 LSVQQLQPLKDRESVAAGGTVTLSCRYSGGTIGDGNYPWWVQMKPGSRPWTVMYTTSTRPSGIPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V137 trgv emb|CEMB01010246.1| 61880 VNPQTILQSAESVVQWLGSSTSLSCFLEGSSDPNLYWYQQMPGGWLEQLSYSISQGSATTTGPGHIKGKRLDKRTFHLEITSLRRNDTATYYCAWS
Pogona vitticeps V139 ighv emb|CEMB01016747.1| 6591 VFSGPQLIETGPGVVKPGGSFKLTCSVTGVQVSDYYWSWVRQPLEKRLEWLGFIRSTAQGGTTQLSPAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V140 ighv emb|CEMB01016747.1| 4078 TSSSPQLIQSGLGVVKPGGSLKLTCTVTGVQVSDYYWGWIRQLQGKTLEWLGYIRDTADGGTPYYNSAFSSRVTVSRDTSRNEVYLQMSSMAAADTGMYYCAR
Pogona vitticeps V142 iglv emb|CEMB01021247.1| 764 ANSQLSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQKAGQTPHFVHCNGCSSRGAGIPARFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V143 iglv emb|CEMB01023034.1| 35372 VDSQPTVTQPASQSVSPGQTTTLNCMKGSGSWSSYIGWVQQKPGQAPRFVHCDGCSRGPGIPDRFTASASGNSGSLTITNVEAGDEAVYYCIGWSTSPQM
Pogona vitticeps V144 iglv emb|CEMB01023034.1| 32018 ISSQGTVTQPASASASLGQTVKLSCTRSSGGRWYNFHWYQQKPGEAPRYVHREGESRGEGISNRFTASQLGESGYLTITNIQAGDEAAYYCCALH
Pogona vitticeps V145 ighv emb|CEMB01024165.1| 812 ISSQVTLTESGEGVKKPGETLQLTCTVSGFSLTDSNYAVAWIRQLSGKTLEWIVEIWGSGSTYYNSALRNRITITKETSKRQVILQLSGLKPEDTAVYYCAR
Pogona vitticeps V146 ighv emb|CEMB01024411.1| 1780 VLSSPQLTESGPGVVKPGESFKLTCSISGIQVSNNYWSWIRQPPGKGLEYLGYIQSTAGGGSSYYNSAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V150 ighv emb|CEMB01025432.1| 5223 VVSQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMYWVRQKPGKGLEWLVSYYNTASGNSHYSPAIQGRFTASKGSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V151 ighv emb|CEMB01025432.1| 2012 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVRQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V152 trav emb|CEMB01026698.1| 13104 FTGLCRGVVVTQKEPFKIIWAGSQTSIDCEHNDNTYFTVLWYRQQSEQTDMQLIGSSVHGTDAKMEVLSYSIKRPSVTQASLLVPLGKPGDSAVYFCAVST
Pogona vitticeps V153 trbv emb|CEMB01026698.1| 5244 STECKIHQPRSLIVEKGKNVQLECRQLHQHDAMYWYQQAKGMELQLGYYSRTSLSGSEVKETTSNRFTAHRPEKERFQLNISSVEMKDSATYFCASS
Pogona vitticeps V154 trgv emb|CEMB01026698.1| 2163 SSNAEIKQPWSLVLEVGKPAWLECRQTFQHTSMLWYQQKAGKGLQFLYRFYNKREQEKGNVPNRFTADQPQADCSNLNISSVKQEDSAVYYCASSL
Pogona vitticeps V155 ighv emb|CEMB01026708.1| 25064 AQLEVVLVESGGDVKRPGDSLRLSCQASGFTFSSYRMSWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V156 ighv emb|CEMB01026708.1| 17600 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTGVYYCAR
Pogona vitticeps V157 ighv emb|CEMB01026708.1| 14848 AQSEVVLVESGGDVKRPGDSHQLSCQGSGFTFSSYHMSWIRQAPGKGLEWVAFISTSSGSIYYSDGVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V158 ighv emb|CEMB01026708.1| 11664 AQSEILLVESGGDVKRPGDSIHLSCQASGFTFSSYGMSWIRHAPGKGLEWVAYIGTSSTPIYYSNTVVKGRFTISRDDSNSQLYLQMNSLKSEDTGVYYCART
Pogona vitticeps V159 ighv emb|CEMB01026708.1| 8088 AQSEILLVESGGDVKRPGDSLRLSCQGSGYTFSDYAMNWIRQAPGKGLEWVAYINYNSATIYYSNTIKGRFTISRDNSNSLLYLQMNSLKSEDTGVYYCAR
Pogona vitticeps V160 ighv emb|CEMB01026708.1| 6251 VLSEIQLVESGGDMKRPGESLRLSCRASGFTFSSYWMHWIRQASGKGLEWVANIRGDGNNYFYADAAKGRFTISRDNPSSTLYLQMNRLTTEDSGLYYCAK
Pogona vitticeps V161 ighv emb|CEMB01026708.1| 4351 SFSQVILTQSDPVAKKPGEAHKLACAVTGFDINSYYMAWIRQKPGKGMEWLVSYHRPGSTSYYSSEIQGQFTASKEGSNFYLQMNSLKAEDTAVYYCAR
Pogona vitticeps V162 ighv emb|CEMB01026708.1| 378 CHSEVQLVETGGGVVSPGESLRLSCKASGFTFSSYYMSWIRQAAGKGLEWVATITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKTEDSAVYYCAR
Pogona vitticeps V163 trbv emb|CEMB01027004.1| 12966 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASSL
Pogona vitticeps V164 trav emb|CEMB01027004.1| 2893 CSNAKISQPWSLLKKEGESIVLLCRQNDGHNVMAWYRQSAGQNLQLLYSFYLKNEQAKGSNISVRFTVERPDNTDFNLNISPAKPEDSAVYFCASSIDT
Pogona vitticeps V165 ighv emb|CEMB01027208.1| 2475 CLSAVQLVEMGGGVVSPGGSIHLSCKGSGFDFSSYNMVWIQQATGKGLEWVAEIRYNSEKVWYNPRFQGRFTISRDNPQSLLHLRMESLKPEDSAVYYCAR
Pogona vitticeps V167 trav emb|CEMB01030083.1| 23088 AQRWVVSQVFQPSQLTVVEGKKINISCYQNVTSHNTMSWYKQPLDGQGSLTILGSSYSGVTTAGDLEINVDPKLRSATLTKEAAALSDSRVYYCAVR
Pogona vitticeps V168 iglv emb|CEMB01030482.1| 6159 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAVYYCAAWDSNA
Pogona vitticeps V169 iglv emb|CEMB01033196.1| 1420 ANSQLTVTQPPLASVSLGNTTKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSHFSGSKDSSGSIGYMTISGALAEDEAIYYCAAGYNG
Pogona vitticeps V170 iglv emb|CEMB01035986.1| 36996 FGSQAALTQSGPVSVALGETATVSCTLQEVEFISTTSPSWYQVKTGEAPQLLIYKSRERDSRVPERFSGDTHGKTATLTIARVQAEDEGDYYCAVWFNDR
Pogona vitticeps V172 iglv emb|CEMB01035986.1| 8642 LSVQQLQTLKDTESVAAGGTVTLSCRYSGGTIGDGNYPWWAQKKPGSKPRTMIYTTSTRPSDVPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V173 iglv emb|CEMB01037069.1| 1065 ISSQGTVTQPASASASLGQTVKLSCTRSSGSWYKFHWYQQKSGGAPRYVHCDVCNRGEGIPDRFTASQSGDSGHLTITDVQAGDEAVYYCAAWDRDGGA
Pogona vitticeps V174 ighv emb|CEMB01037313.1| 233599 CHSEVQLVETGGGVVSPGSSLRLSCRGSGFDFSSYNMHWIRQATGKGLEWVAQISSPSGSSQWYNSKVQGRFTISRDNSQSSADLRMENLKPEDSALYYCAR
Pogona vitticeps V178 ighv emb|CEMB01037313.1| 163168 ASSDIQLVSSGPETVRPGETLDLVCKLTGFSITTQYWHWIRQAPGKGLQWVALMYPSSGRKWFASSFQSRATISSDASKNEVYLQLRSVTVDDSAVYYCVGE
Pogona vitticeps V180 ighv emb|CEMB01037313.1| 144342 VNSQVTLGQDPSVQLKPSETLRLTCSISGFSLTEYATAVSWIRQPFGKGLEWLSLVFWDDDKRYSSTLKNRLTISRDVSKSEVYLEFRGMGTGDSGTYYCARR
Pogona vitticeps V181 iglv emb|CEMB01037582.1| 1978 VTSQPTVTQPASQSVSPGQTTTIPCSKSSGSSWDSYLGWFQQKPGQTPRFVHCNGCNSREPGIPDRFTASASGNSGSLTITNVEAGDEAIYYCYAWSSSASA
Pogona vitticeps V182 trav emb|CEMB01535857.1| 432 GTQADSVSQIEDLVTVQEGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V183 trav emb|CEMB01538122.1| 425 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V16 ighv CEMB01005058.1 91 FSEIRFTESGGGARKPGASLRLTCAVSGYSITSGAGLHWVRQPPQKGLEWIGMIYYSSSTWKTNYGSAFQSRATLSADSSKNQYYLELRSLTAADTAVYYCTGE
Pogona vitticeps V19 igkv CEMB01007043.1 139 TRGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQSDRVP
Pogona vitticeps V20 igkv CEMB01007043.1 11432 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGHARQKDVPARFSSSGYGEDFTLTISSVEAEEEGYYHCQQSDRVP
Pogona vitticeps V21 iglv CEMB01008496.1 991 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYKDSSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V22 ighv CEMB01009219.1 4228 VHASVQLVESGPGTLKPGQTLRLSCAVTGDSVENSYWHWVRQAPGKGLEWVGRIDWSGSTWRIFYTSSLQSRATLSADSSKNEYYLELRSLTAADTGVYYCARE
Pogona vitticeps V23 ighv CEMB01009219.1 7399 VHASVQLVESRPGTLKPGQSLRLTCTISGDSVKSNYWHWVRQASGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSVTAADTAVYYCARE
Pogona vitticeps V24 ighv CEMB01009219.1 11208 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V25 ighv CEMB01009219.1 13801 VHASVRLVESGPGTLMPGRSLRLTCTISGASVKSKYWHWVRQAPRKGLEWVGQIVWIGITWGTIYAPSLQSRATLSADFSKNEYYLELRSLTAADTAVYYCA
Pogona vitticeps V26 ighv CEMB01009219.1 18433 VHANVQLVESGPGTLKPGQSLRLACKISGDSVKSNYWHWVRQAAGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARE
Pogona vitticeps V27 ighv CEMB01009219.1 50065 ARSEVLLVESGGDVKRPGDSLRLSCRASGFTFSSYAMGWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V28 ighv CEMB01009219.1 51045 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V30 iglv CEMB01009691.1 12475 VDSQPTVTQPASQSVSPGQTTTLSCSKSSGSWGSYVYWLQQKPGQPPRFVHCDGCSSRGAGIPDRFTASASGNSGSLRITNVEAGDEAIYYCYVWSSSARV
Pogona vitticeps V31 iglv CEMB01009691.1 17794 ATSQPTVAQPASQSVSPGRTTTLSCSKSSGNWNDGVYWLQQKHGQPPRFVHCNGCCSRGAGIPDRFTASASGNSGSLTITKVEDGDEAVYYCYAWS
Pogona vitticeps V32 iglv CEMB01009691.1 29035 SDGQFTMSQPPSVSAAIRETVQIPCRRSSGSVSSYYNSWYQQKPGSAPILLIFGDDATASGIPERFSGSIDESANTATLTISNVQAEDEADYYCLSSDSSGQ
Pogona vitticeps V33 iglv CEMB01014241.1 9696 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRYISWYQQKPGSAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSGKIGYLTISGALAEDKAVYYCAV
Pogona vitticeps V37 iglv CEMB01019501.1 8762 ANSQLTVSQPPSASVSLGNTVKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSRFSGSKDSSGSIGYLTISGALAEDEAVYYCAAGYNG
Pogona vitticeps V38 ighv CEMB01021537.1 547 CHPKPQLIETGGGVVAPGGSLRLSCKASGFTFTNYTMHWVRQAAGKGLEWVAGVSKPTGSSQWYNSKVQGRFNISRDNTQSSVYLQMANLKSEDSAVYYCAR
Pogona vitticeps V40 iglv CEMB01021861.1 6458 IHSQPTVSQPASASASPGQTVKLSCTRSSGGSWSSLYWYQQRPGQAPRFVHCQSCSRGEGIPGRLTASESGGNGLLTITNVEAGDEAVYYCAAWY
Pogona vitticeps V41 ighv CEMB01022913.1 816 CHSQVQLVETGGGVVSPGGSLLLSCKASGFTFSGYYMSWVRQAAGKGLEWVARITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKAEDSAMYYCAR
Pogona vitticeps V42 ighv CEMB01022913.1 13012 VVSQVVLTQPGPVLKKPGESHKLSCATSGFTLSSTWMGWIRQKPGKGLEWLAWYYGTASGQSFYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V43 ighv CEMB01022913.1 15086 VVSQVVLTQSGPVLKKPGESLKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYLGTSSGHSYYTPAIQGRFTASKDNSNLYLQMNNLKEEDTAVYYCAW
Pogona vitticeps V44 ighv CEMB01022913.1 20454 VVSQVVLTQSGPVSKKPGESHKLTCATSGFTLSSYGMSWVRQKPGKGLEWLVYYYNTASGNSHYTPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V45 ighv CEMB01022913.1 26349 CRSAVQLVETGGGVVSPGGSLRLTCKASGFPFSGYSMHWVRQAAGKGLEWVAGIRYDGADQWYNSKVQGRFTISRDNPQSSVDLRMGSLKPEDSGVYYCVR
Pogona vitticeps V46 ighv CEMB01022913.1 28751 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVHQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V47 ighv CEMB01022913.1 30725 VVSQVVLTQSGPVLKKPGESHKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V48 ighv CEMB01022913.1 32733 VVSQVVLTQSGLVLKKPGESHKLTCETSGFALSTAWMDWFRQKPGKDLEWLVHYYSTASGRNFYSPAIQARFTASKDSSNFYLQLNDLKEEDTAVYYCAR
Pogona vitticeps V49 ighv CEMB01022913.1 35660 CHSEVQLVETGGGVVAPGGSLHLSCKASGFTFSSYEMHWIRQAAGKGLEWVGGISGSGGSQWYNSKVRGRFTISRDNARSSADLRMASLKPEDSAMYYCTR
Pogona vitticeps V0 trbv emb|CEMB01002966.1| 576109 PADSQSNVKVIQQPPSENLLQGKALELRCSVNQENYYFYWYRQVPGETKLQSLGTFRTFESTLQEPADELKERLSGERKNNECSLNLASLQSSDSGLYLCAAK
Pogona vitticeps V3 ighv emb|CEMB01002971.1| 49406 AQSQIQLVQSGPEIKKPGESVRFTCKASGYTFNQYSLSWIRQAPGKGLEWVGRIRTDNFDTFYPESLKTRVTITVDVSISTLYLQLTGLKTEDTAVYYCA
Pogona vitticeps V5 ighv emb|CEMB01002971.1| 88133 ILSQISLRESGGGVKKPGETLQLTCTVSGFPLTSYGVHWIRQPPGKGLEWAGVIWGDGSNNYNSALQSRISITRDVSKSQVFLQLRNLKPEDSAMYYCAR
Pogona vitticeps V6 ighv emb|CEMB01002971.1| 90592 ILSQISLRESGGGVKKPGETLQLTCTVSGFSVASKAVHWIRQPPGKGLEWAGVIWSSGGNSYNSALQSRISITRDPSKSQVSLQLRNLKPEDSATYYCAR
Pogona vitticeps V7 ighv emb|CEMB01002971.1| 120112 ISSQVTLTESDGGLKKPGETLHLICTVAGYSLTDSTYATDWVRQPLGKGLEWSGAIWHDGTARYNSALQNRATITRDISKSQVLFQLSAVKTEDSAVYYCA
Pogona vitticeps V8 ighv emb|CEMB01002971.1| 122484 ISSQVTLTESGGGLKKPGETLHLTCTVAGYSLTDSSYATNWVRQPSGKGLEWVGIMWHNGGTAHNSVLQNRATITRDTSKSQVFLQLSALKPEDSAVYYCAR
Pogona vitticeps V9 ighv emb|CEMB01002971.1| 128357 VSSQVTLTESGGGLKKPGETVHLTCMVTGYSLTDSSYATHWVRQPLGKGLEWTGGIWYDGTARYNSALQNRATITRDISKSQVFFQLSDVKPEDSAVYYCARE
Pogona vitticeps V10 ighv emb|CEMB01002971.1| 130919 ISSQVTHTESGGAPNKPGEALHLTCIVTGYSLTDASYATGWVRQPFGKGLEWIGIIWSHGPSVYNTALQNRAIITRDTSKSRVFLQLNALKPEDSAVYYCIR
Pogona vitticeps V11 ighv emb|CEMB01002971.1| 145823 VQSQGRLEQSEGGIRKPGESLRLSCRGSGFAFGSTGMHWVRQATGKGLEWIAVIWYDASKQYYADSVKGRFIISRDNPSSVAYLQMNDLKAEDTAVYYCA
Pogona vitticeps V12 ighv emb|CEMB01002971.1| 148247 VHASVRLVESGPGMLKPGQSLRLSCAITGDSVKSSYWHWVRQAPGKRLEWVGRIDWSSSTWRILYAPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V13 ighv emb|CEMB01002971.1| 152900 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V14 ighv emb|CEMB01003547.1| 637 VISQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMHWVRQKPGKGLEWLVSYYTASSNNYSPAIRGRFTASKGASDFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V15 iglv emb|CEMB01004663.1| 11643 SFGQYVLTQPPSASVSLGQNAQISCSGNNIERKSVQWYQQKPGKAPVLIIYVDNRRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVWDSNA
Pogona vitticeps V16 ighv emb|CEMB01005058.1| 91 FSEIRFTESGGGARKPGASLRLTCAVSGYSITSGAGLHWVRQPPQKGLEWIGMIYYSSSTWKTNYGSAFQSRATLSADSSKNQYYLELRSLTAADTAVYYCTGE
Pogona vitticeps V19 igkv emb|CEMB01007043.1| 139 TRGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQSDRVP
Pogona vitticeps V20 igkv emb|CEMB01007043.1| 11432 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGHARQKDVPARFSSSGYGEDFTLTISSVEAEEEGYYHCQQSDRVP
Pogona vitticeps V21 iglv emb|CEMB01008496.1| 991 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYKDSSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V22 ighv emb|CEMB01009219.1| 4228 VHASVQLVESGPGTLKPGQTLRLSCAVTGDSVENSYWHWVRQAPGKGLEWVGRIDWSGSTWRIFYTSSLQSRATLSADSSKNEYYLELRSLTAADTGVYYCARE
Pogona vitticeps V23 ighv emb|CEMB01009219.1| 7399 VHASVQLVESRPGTLKPGQSLRLTCTISGDSVKSNYWHWVRQASGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSVTAADTAVYYCARE
Pogona vitticeps V24 ighv emb|CEMB01009219.1| 11208 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V25 ighv emb|CEMB01009219.1| 13801 VHASVRLVESGPGTLMPGRSLRLTCTISGASVKSKYWHWVRQAPRKGLEWVGQIVWIGITWGTIYAPSLQSRATLSADFSKNEYYLELRSLTAADTAVYYCA
Pogona vitticeps V26 ighv emb|CEMB01009219.1| 18433 VHANVQLVESGPGTLKPGQSLRLACKISGDSVKSNYWHWVRQAAGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARE
Pogona vitticeps V27 ighv emb|CEMB01009219.1| 50065 ARSEVLLVESGGDVKRPGDSLRLSCRASGFTFSSYAMGWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V28 ighv emb|CEMB01009219.1| 51045 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V30 iglv emb|CEMB01009691.1| 12475 VDSQPTVTQPASQSVSPGQTTTLSCSKSSGSWGSYVYWLQQKPGQPPRFVHCDGCSSRGAGIPDRFTASASGNSGSLRITNVEAGDEAIYYCYVWSSSARV
Pogona vitticeps V31 iglv emb|CEMB01009691.1| 17794 ATSQPTVAQPASQSVSPGRTTTLSCSKSSGNWNDGVYWLQQKHGQPPRFVHCNGCCSRGAGIPDRFTASASGNSGSLTITKVEDGDEAVYYCYAWS
Pogona vitticeps V32 iglv emb|CEMB01009691.1| 29035 SDGQFTMSQPPSVSAAIRETVQIPCRRSSGSVSSYYNSWYQQKPGSAPILLIFGDDATASGIPERFSGSIDESANTATLTISNVQAEDEADYYCLSSDSSGQ
Pogona vitticeps V33 iglv emb|CEMB01014241.1| 9696 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRYISWYQQKPGSAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSGKIGYLTISGALAEDKAVYYCAV
Pogona vitticeps V37 iglv emb|CEMB01019501.1| 8762 ANSQLTVSQPPSASVSLGNTVKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSRFSGSKDSSGSIGYLTISGALAEDEAVYYCAAGYNG
Pogona vitticeps V38 ighv emb|CEMB01021537.1| 547 CHPKPQLIETGGGVVAPGGSLRLSCKASGFTFTNYTMHWVRQAAGKGLEWVAGVSKPTGSSQWYNSKVQGRFNISRDNTQSSVYLQMANLKSEDSAVYYCAR
Pogona vitticeps V40 iglv emb|CEMB01021861.1| 6458 IHSQPTVSQPASASASPGQTVKLSCTRSSGGSWSSLYWYQQRPGQAPRFVHCQSCSRGEGIPGRLTASESGGNGLLTITNVEAGDEAVYYCAAWY
Pogona vitticeps V41 ighv emb|CEMB01022913.1| 816 CHSQVQLVETGGGVVSPGGSLLLSCKASGFTFSGYYMSWVRQAAGKGLEWVARITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKAEDSAMYYCAR
Pogona vitticeps V42 ighv emb|CEMB01022913.1| 13012 VVSQVVLTQPGPVLKKPGESHKLSCATSGFTLSSTWMGWIRQKPGKGLEWLAWYYGTASGQSFYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V43 ighv emb|CEMB01022913.1| 15086 VVSQVVLTQSGPVLKKPGESLKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYLGTSSGHSYYTPAIQGRFTASKDNSNLYLQMNNLKEEDTAVYYCAW
Pogona vitticeps V44 ighv emb|CEMB01022913.1| 20454 VVSQVVLTQSGPVSKKPGESHKLTCATSGFTLSSYGMSWVRQKPGKGLEWLVYYYNTASGNSHYTPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V45 ighv emb|CEMB01022913.1| 26349 CRSAVQLVETGGGVVSPGGSLRLTCKASGFPFSGYSMHWVRQAAGKGLEWVAGIRYDGADQWYNSKVQGRFTISRDNPQSSVDLRMGSLKPEDSGVYYCVR
Pogona vitticeps V46 ighv emb|CEMB01022913.1| 28751 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVHQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V47 ighv emb|CEMB01022913.1| 30725 VVSQVVLTQSGPVLKKPGESHKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V48 ighv emb|CEMB01022913.1| 32733 VVSQVVLTQSGLVLKKPGESHKLTCETSGFALSTAWMDWFRQKPGKDLEWLVHYYSTASGRNFYSPAIQARFTASKDSSNFYLQLNDLKEEDTAVYYCAR
Pogona vitticeps V49 ighv emb|CEMB01022913.1| 35660 CHSEVQLVETGGGVVAPGGSLHLSCKASGFTFSSYEMHWIRQAAGKGLEWVGGISGSGGSQWYNSKVRGRFTISRDNARSSADLRMASLKPEDSAMYYCTR
Pogona vitticeps V50 ighv emb|CEMB01022913.1| 39917 IHSQGQPSLEESGGGLKRPGEALRLSCRASGFTFSSYYMIWVRQAPGKALEWIAGIYTDGSQQQYAETVKGRFTISRNNPSNMLYLQMNNLKPEDTAVYYCAR
Pogona vitticeps V51 iglv emb|CEMB01023034.1| 1814 TNSQLTVTQPPSASVSLGNTVKLSCTISMTGRAISWYQQKPGSAPRYLLYYFSESYKHQGSGVPSRFSGSKDSSDKIGYLSISGAMAEDEAVYYCAAYDSSV
Pogona vitticeps V55 iglv emb|CEMB01025177.1| 3904 VTSQPTVTQPVSQSASPGQTTTLSCSKSSGSWSSYVSWVQQKPGQPPRFVHCNGCSRGAGISDRFTASASGNSGSLTITNVEAGDEAVYYCHAWS
Pogona vitticeps V57 iglv emb|CEMB01025177.1| 39715 VSSQASVTQPASASVSLGQTVKLSCTRSSGDSWNPFHWHQQKSGEALRFVLYGSSIRGEGIPDRFSGSASGNTGYLTITDVQAGDEGVYYCGAWYGAG
Pogona vitticeps V59 iglv emb|CEMB01025177.1| 50631 VDSQPTLTQPASQSVSPRETTTLNCLKGSGSWNSRVSWVQQKPGQPPRFVHCNGCSSRGAGIPDRFTASASGNTGSLTITNVEAGDEAIYYCAVWS
Pogona vitticeps V60 iglv emb|CEMB01025177.1| 54903 IRSEATVTQPASASVSLGETVKLSCTGSSDGTWSIFSWYQQKPGQAPQFVHCDDCNRGEGTPDRFTASESGDTGFLTITDSQAEDEANYYCAAWDYTSST
Pogona vitticeps V61 igkv emb|CEMB01025177.1| 71606 CDGQFTMSQLPSISAAMRETVQIPCRRSSENVGRFYNSWYQQKPGSAPILLLYKHSVRASGIPERFSGSIDISANTATLTISNVQAEDEAIYYCFSYDGRRQ
Pogona vitticeps V62 iglv emb|CEMB01025177.1| 76532 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYDRGEGIPNRFTASASGNSGSLTITNAEAGDEAVYYCVVWS
Pogona vitticeps V63 iglv emb|CEMB01025177.1| 82192 VTSQPTVTQPASQSASPGQTTTLSCSKSSGSWSGYVNWIQQKPGQAPRFVHCNICSRGPGIPDRFTASASGNTGSLTITNIEAGDEAIYYCAEWS
Pogona vitticeps V64 iglv emb|CEMB01025177.1| 101672 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYNRGEGIPNRFTASASGNSGSLTITNVEAGDEAVYYCYVWS
Pogona vitticeps V66 ighv emb|CEMB01025868.1| 114 IHSQGVVLTQGGSELKKPGESARLKCATSGFVLNDYYTAWIRQKPGEGLQWLVSYWKASQTNYYLPAIQNRFTASKDSSNFYLQMNNLTPEDTAVYYCAR
Pogona vitticeps V67 iglv emb|CEMB01027487.1| 3118 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKNVHWYQQKPGKAPVLIIYNDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDGNA
Pogona vitticeps V68 iglv emb|CEMB01028068.1| 4357 HCVSTTFGLSISVSLGDTVKLPCAISRNDRYIYWYQQKTGSSPRYLLYYGSESRKGQGSGVPSRFSGSKDSSGRIGYLTISGALAEDEAIYYCSAADSYA
Pogona vitticeps V69 iglv emb|CEMB01028068.1| 21669 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V70 iglv emb|CEMB01028068.1| 24175 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V71 iglv emb|CEMB01028068.1| 29351 ITSQATVTQPASISLSPGQTLKLSCTRSGGSSWGGFQWYRQRPGEAPHFVHRESYSRGEGISDRFTASQSGDAGQLTITNVQATDEAHYYCFISYDNGNQ
Pogona vitticeps V72 iglv emb|CEMB01028068.1| 33065 ANSQLTVSQPPSASVSLGSTTKLSCTISMDGRTIRWYQQKPGNAPRFLLYYYTESSKGQGSGVPSRFSGSKDSSGKIFYLTISGALAEDEAVYYCAAWYSDA
Pogona vitticeps V74 trav emb|CEMB01029335.1| 217 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASRL
Pogona vitticeps V75 iglv emb|CEMB01029607.1| 470 ANSQFTVSQPPSASVSPGNTAKLSCTISSSGKTVYWYQQKPGNAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSNTIGYLTISGALADEAVYYCTAWDGNA
Pogona vitticeps V76 iglv emb|CEMB01030482.1| 1072 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGTYVHWYQQKPGKAPVLIIYYNSRRSAGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVGDGNA
Pogona vitticeps V77 trav emb|CEMB01032697.1| 2273 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPHLFWYTQHLDDGSLQLLLQEHNAEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V78 trav emb|CEMB01032697.1| 3731 GTHADSVSQTEDLVTVREGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V79 trav emb|CEMB01032697.1| 7495 STTGQSVNQAEGTVLVTQGKNIFLHCSYKSSFTTAYPFWYVQYPGQPPRLFLREFGKEEGDRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVR
Pogona vitticeps V80 trav emb|CEMB01032697.1| 9791 SCVNAQKIVQPESAVSFAGASFNLPCNLSSVSTEMIQWYRQFPGQGPQYIAGAFPGRTGEGTNPKSTLRFAKEKTSSVLVLHRVTLADAAVYFCALSD
Pogona vitticeps V81 trav emb|CEMB01032697.1| 12864 FGLSDSIFQLLSVRSVSEGEDVVLYCNFSTFDSNPYLFWYNQFPSQPPKHITTIARYSTNVPGTLNLEKKTVSLKIETVSLRDQAVYFCALR
Pogona vitticeps V82 trav emb|CEMB01032697.1| 16331 STTGQSVNQIEGTVVVTQGKNIFLHCSYESSFTTNDPFWYVQYPGQRPRLFLKEYTKEEGNRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVS
Pogona vitticeps V83 trav emb|CEMB01032697.1| 18293 SLGRAQKIVQPESAIPVAGGSYDLPCNLSSVSSEKILWYRQFPGQGPQYIAGAYPGRTDEGTDPKSTLRVAKEKTSSVLFLHHVTLADAAVYFCALVL
Pogona vitticeps V84 trav emb|CEMB01032697.1| 23715 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V85 trav emb|CEMB01032697.1| 26076 MKGSPVNQPEGTMTITEGKQITIKCTYEKSIYYLFWYIQHPGQPPKLFLRDAEDPSDEGRARGFVAENEKPLSTFSLKKTAIQLEDSAIYFCAGS
Pogona vitticeps V86 trgv emb|CEMB01032697.1| 30541 VLWCKAQEIIQEPVMEASEGKTFNLTCSHPKATTETIFWYRQFPGQTLLYVTSGYSHNEEGTLHVPSGRKSNALTLTKVTLNDAAVYYCALS
Pogona vitticeps V88 trgv emb|CEMB01032697.1| 37330 ILLCKAEQITQEPLVEASVGKALNLSCSHPSAAKGDAIHWYQQLPNQAPHFIVSGYSGVVRSEKLKGASLLINEDKKSSYLSLTLVTLEEAAVYYCAVS
Pogona vitticeps V89 trav emb|CEMB01032697.1| 43621 FLGIAQKIEQQESTTAFSGKAHNLSCTLTSVSSVTKMIQWYRQFPGQGPQYIAGAYPGETVEGTDPKSTLHFAHDKKSSALALHHILLDDAAVYFCALAD
Pogona vitticeps V92 iglv emb|CEMB01034103.1| 692 ANSQPSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQRPGQAPRYVHCNGCSRGPGIPDRFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V93 trav emb|CEMB01035531.1| 34118 IDGQEKVEQHPPSLEVLRGNNATLTCTVSTGGLQWYRQHPGGKPIFLMFVYGGQRTKEGDHFVGEFNSKEKQGYLHIINAQLHHGENYFCAPD
Pogona vitticeps V94 trav emb|CEMB01035531.1| 37048 GTLGQSVDQTEGTVIVSQGSSVSIRCSYDLSGQVDPFWYIQLPGQPPKLFLRDLGKTDSDEGHLRGFMANHDKSSNKKQKTFHMEKSSVQLNDAALYFCAVR
Pogona vitticeps V95 trav emb|CEMB01035531.1| 40863 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNSVQWYQQNPDGQIVHIAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V96 trav emb|CEMB01035531.1| 45520 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNNLQWYQQNPDGHIVHVAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V97 trav emb|CEMB01035531.1| 49277 ARSQDAVEQEPLKVTREGENTTIACRYKTSNFYSLHWYRQYPGEGLEFLLQKVTDNPNLKDHMQGDLDKKKQLSRLSFRGARLRDDATYFCALA
Pogona vitticeps V98 trav emb|CEMB01035531.1| 91105 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDPKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V99 iglv emb|CEMB01035986.1| 6032 ATSQPTVTQPASQSVSPGRTTTLSCSKSSGSWNDGVYWLQQKHGQPPHFVHCNGCRSRGAGIPDRFTASTSGNSGSLTITNVEDGDEAVYYCAAWS
Pogona vitticeps V100 ighv emb|CEMB01036198.1| 2008 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTNSYYWNWIRQTPGKGLEWMGYWVGSTSYSPSFQNRITISVDSSQTKYFLRLTSGTAADTATYYCAR
Pogona vitticeps V101 ighv emb|CEMB01036198.1| 11157 LSSQLQLKESGPGMVKPGDILELTCMVTGGSVTSGPWWGWIRQAPGKGLEWMGLWNGNTYYSSSFQNRATISVHSSQTKYFLQLTSVTTADTGTYYCAR
Pogona vitticeps V102 ighv emb|CEMB01036198.1| 18124 LSFQLQLKESRPGTVRPGDALELTCTVTGGSVTSGNWWSWIRQAPGKGLEWIGMWDGSTYYSSSFQNRISISVHSSQTKYFLRLTSVTTADSSTYYCAR
Pogona vitticeps V103 ighv emb|CEMB01036198.1| 22116 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGPWWSWIRQAPGKSLEWIGSWTGSTYYSSSFQNRVTISVHSSQTKYSLRLTSMTTADTSTYYCAR
Pogona vitticeps V104 ighv emb|CEMB01036246.1| 142 THSQVVLTQEGPVVKKPGESHKLTCATSGLPLSSTWMTWIRQKPGKGLEWLLEYYDSGSNNYSPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCA
Pogona vitticeps V106 ighv emb|CEMB01036246.1| 4915 ARSQVVLTQDGPVVKKPGESHKLTCATSGLTLSSTIMQWIRQKPGKGLEWLVEYYSAGSNDYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAR
Pogona vitticeps V107 ighv emb|CEMB01036246.1| 8799 ARSQAVLTQEGPVVKKPGESHKLTCATSGLALSSTWMNWIRQKPGKGLEWLVHYYSAGNNYYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V108 ighv emb|CEMB01036246.1| 10296 TRSQAVLTQEGPVVKKPGESHKFTCATSGFTLRSTYMHWIRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V109 ighv emb|CEMB01036246.1| 20448 THSEVVLTQEGPVVKKPGESYKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V110 ighv emb|CEMB01036246.1| 21754 ARSQVVLTQDGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V111 ighv emb|CEMB01036246.1| 23058 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V112 ighv emb|CEMB01036246.1| 23575 ARSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLEWLVEYYSAGSNYYSPAIRGRFTASKGASDFYLQMNDLKAEDTAVYYCAR
Pogona vitticeps V113 ighv emb|CEMB01036246.1| 27139 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAKDTAVYYCAA
Pogona vitticeps V115 ighv emb|CEMB01036246.1| 46652 IFASLQLLESGPGVVKPGGSLKLTCVVSGVDVGDYYWNWIRQPPGKGLEWLGDIQDSDDGGGTAYNPRFISRMSISRDIAKNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V116 ighv emb|CEMB01036246.1| 53915 LSSQLQLKESGPGTVRPGDNLELTCTVTGGSITSSYIWNWIRQTPGKGLEWMGYWVGSPSYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V117 ighv emb|CEMB01036246.1| 56108 LSSQLHLKESGPGMVRPGDTLELTCTVTGGSVTSSWYWHWIRQTPGKGLEWMGYWTGSTSYSPSFQNRITISVDSSQTKYFLRLTSVTASDTAMYYCAG
Pogona vitticeps V118 ighv emb|CEMB01036246.1| 59553 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGYTWHWIRQTPGKGLEWMGWWSGSTRYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V119 trav emb|CEMB01534111.1| 54 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPRLFWYTQHLDDGSLQLLLQEHNTEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V121 ighv emb|CEMB01005252.1| 55426 FSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYDSAFQSRVSITADASKNEYYLELRSLTAADTAVYYCARR
Pogona vitticeps V122 ighv emb|CEMB01005252.1| 51630 FSENRLTESGGGAWKPGASLRLTCVVSGYSITSGAGLNWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARG
Pogona vitticeps V123 ighv emb|CEMB01005252.1| 48986 SSEIRLTQSGGETWKPGATLRLTCAVSGYAISSGYYWHWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARR
Pogona vitticeps V124 ighv emb|CEMB01005252.1| 42250 VQLEVQLLQSGGETKRPGESLRLSCRASGYPFGSHSAHWIRQAPRKALEWIAWIYDDGSRLSYADSVKGRFTISRDNSKNMLYLLMNSLRPDDTAMYYCAAE
Pogona vitticeps V125 ighv emb|CEMB01005252.1| 35499 FSEIRLTQSGGETWKPGATLRLTCAVSGYSMTSGYNWNWIRQPPQKGLEWIGRGYYSSSNWKTNYGSAFQSRISITADASKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V126 ighv emb|CEMB01005252.1| 32550 YSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYGSAFQSRVSITADASKNKYSLELRSLTAADTAVYYCARE
Pogona vitticeps V127 ighv emb|CEMB01005252.1| 29191 FSEIRLTQSGEGTWKPGASFRLTCKVSGYTMTSGAEWDWFRQPSKKALEWLGTGRYIRSTWKPGYSSAFQSRISITADASKNEYYLQLRSLTAADTAVYYCAR
Pogona vitticeps V128 ighv emb|CEMB01005252.1| 14190 AHSQVVLTQEGPVVKKPGESHKLTCATSGFSLSGSGMHWIRQKPGKGLEWLVYYYSASHNNYSPSIRGRFTASKGASDFYLQMNDLNAEDTTVYYCAR
Pogona vitticeps V129 ighv emb|CEMB01005252.1| 10761 ARSQVVLTQEGPIVKKPGESHKLTCATSGFPLSSRTMHWIGQKTGQGLEWLVRYYSAGDNQYSPSIRGRFTASKSASDLYLQMSDLNAEDTAVYYCARE
Pogona vitticeps V130 ighv emb|CEMB01005252.1| 8588 AHSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMSWIRQKPGKGLEWLLEYKDSGSNNYIPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCARF
Pogona vitticeps V132 iglv emb|CEMB01005754.1| 5399469 SFGQYVLTQPPSASVPLGQNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYYDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V135 igkv emb|CEMB01006509.1| 4682 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQNDRVP
Pogona vitticeps V136 iglv emb|CEMB01007033.1| 4231 LSVQQLQPLKDRESVAAGGTVTLSCRYSGGTIGDGNYPWWVQMKPGSRPWTVMYTTSTRPSGIPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V137 trgv emb|CEMB01010246.1| 61880 VNPQTILQSAESVVQWLGSSTSLSCFLEGSSDPNLYWYQQMPGGWLEQLSYSISQGSATTTGPGHIKGKRLDKRTFHLEITSLRRNDTATYYCAWS
Pogona vitticeps V139 ighv emb|CEMB01016747.1| 6591 VFSGPQLIETGPGVVKPGGSFKLTCSVTGVQVSDYYWSWVRQPLEKRLEWLGFIRSTAQGGTTQLSPAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V140 ighv emb|CEMB01016747.1| 4078 TSSSPQLIQSGLGVVKPGGSLKLTCTVTGVQVSDYYWGWIRQLQGKTLEWLGYIRDTADGGTPYYNSAFSSRVTVSRDTSRNEVYLQMSSMAAADTGMYYCAR
Pogona vitticeps V142 iglv emb|CEMB01021247.1| 764 ANSQLSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQKAGQTPHFVHCNGCSSRGAGIPARFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V143 iglv emb|CEMB01023034.1| 35372 VDSQPTVTQPASQSVSPGQTTTLNCMKGSGSWSSYIGWVQQKPGQAPRFVHCDGCSRGPGIPDRFTASASGNSGSLTITNVEAGDEAVYYCIGWSTSPQM
Pogona vitticeps V144 iglv emb|CEMB01023034.1| 32018 ISSQGTVTQPASASASLGQTVKLSCTRSSGGRWYNFHWYQQKPGEAPRYVHREGESRGEGISNRFTASQLGESGYLTITNIQAGDEAAYYCCALH
Pogona vitticeps V145 ighv emb|CEMB01024165.1| 812 ISSQVTLTESGEGVKKPGETLQLTCTVSGFSLTDSNYAVAWIRQLSGKTLEWIVEIWGSGSTYYNSALRNRITITKETSKRQVILQLSGLKPEDTAVYYCAR
Pogona vitticeps V146 ighv emb|CEMB01024411.1| 1780 VLSSPQLTESGPGVVKPGESFKLTCSISGIQVSNNYWSWIRQPPGKGLEYLGYIQSTAGGGSSYYNSAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V150 ighv emb|CEMB01025432.1| 5223 VVSQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMYWVRQKPGKGLEWLVSYYNTASGNSHYSPAIQGRFTASKGSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V151 ighv emb|CEMB01025432.1| 2012 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVRQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V152 trav emb|CEMB01026698.1| 13104 FTGLCRGVVVTQKEPFKIIWAGSQTSIDCEHNDNTYFTVLWYRQQSEQTDMQLIGSSVHGTDAKMEVLSYSIKRPSVTQASLLVPLGKPGDSAVYFCAVST
Pogona vitticeps V153 trbv emb|CEMB01026698.1| 5244 STECKIHQPRSLIVEKGKNVQLECRQLHQHDAMYWYQQAKGMELQLGYYSRTSLSGSEVKETTSNRFTAHRPEKERFQLNISSVEMKDSATYFCASS
Pogona vitticeps V154 trgv emb|CEMB01026698.1| 2163 SSNAEIKQPWSLVLEVGKPAWLECRQTFQHTSMLWYQQKAGKGLQFLYRFYNKREQEKGNVPNRFTADQPQADCSNLNISSVKQEDSAVYYCASSL
Pogona vitticeps V155 ighv emb|CEMB01026708.1| 25064 AQLEVVLVESGGDVKRPGDSLRLSCQASGFTFSSYRMSWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V156 ighv emb|CEMB01026708.1| 17600 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTGVYYCAR
Pogona vitticeps V157 ighv emb|CEMB01026708.1| 14848 AQSEVVLVESGGDVKRPGDSHQLSCQGSGFTFSSYHMSWIRQAPGKGLEWVAFISTSSGSIYYSDGVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V158 ighv emb|CEMB01026708.1| 11664 AQSEILLVESGGDVKRPGDSIHLSCQASGFTFSSYGMSWIRHAPGKGLEWVAYIGTSSTPIYYSNTVVKGRFTISRDDSNSQLYLQMNSLKSEDTGVYYCART
Pogona vitticeps V159 ighv emb|CEMB01026708.1| 8088 AQSEILLVESGGDVKRPGDSLRLSCQGSGYTFSDYAMNWIRQAPGKGLEWVAYINYNSATIYYSNTIKGRFTISRDNSNSLLYLQMNSLKSEDTGVYYCAR
Pogona vitticeps V160 ighv emb|CEMB01026708.1| 6251 VLSEIQLVESGGDMKRPGESLRLSCRASGFTFSSYWMHWIRQASGKGLEWVANIRGDGNNYFYADAAKGRFTISRDNPSSTLYLQMNRLTTEDSGLYYCAK
Pogona vitticeps V161 ighv emb|CEMB01026708.1| 4351 SFSQVILTQSDPVAKKPGEAHKLACAVTGFDINSYYMAWIRQKPGKGMEWLVSYHRPGSTSYYSSEIQGQFTASKEGSNFYLQMNSLKAEDTAVYYCAR
Pogona vitticeps V162 ighv emb|CEMB01026708.1| 378 CHSEVQLVETGGGVVSPGESLRLSCKASGFTFSSYYMSWIRQAAGKGLEWVATITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKTEDSAVYYCAR
Pogona vitticeps V163 trbv emb|CEMB01027004.1| 12966 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASSL
Pogona vitticeps V164 trav emb|CEMB01027004.1| 2893 CSNAKISQPWSLLKKEGESIVLLCRQNDGHNVMAWYRQSAGQNLQLLYSFYLKNEQAKGSNISVRFTVERPDNTDFNLNISPAKPEDSAVYFCASSIDT
Pogona vitticeps V165 ighv emb|CEMB01027208.1| 2475 CLSAVQLVEMGGGVVSPGGSIHLSCKGSGFDFSSYNMVWIQQATGKGLEWVAEIRYNSEKVWYNPRFQGRFTISRDNPQSLLHLRMESLKPEDSAVYYCAR
Pogona vitticeps V167 trav emb|CEMB01030083.1| 23088 AQRWVVSQVFQPSQLTVVEGKKINISCYQNVTSHNTMSWYKQPLDGQGSLTILGSSYSGVTTAGDLEINVDPKLRSATLTKEAAALSDSRVYYCAVR
Pogona vitticeps V168 iglv emb|CEMB01030482.1| 6159 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAVYYCAAWDSNA
Pogona vitticeps V169 iglv emb|CEMB01033196.1| 1420 ANSQLTVTQPPLASVSLGNTTKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSHFSGSKDSSGSIGYMTISGALAEDEAIYYCAAGYNG
Pogona vitticeps V170 iglv emb|CEMB01035986.1| 36996 FGSQAALTQSGPVSVALGETATVSCTLQEVEFISTTSPSWYQVKTGEAPQLLIYKSRERDSRVPERFSGDTHGKTATLTIARVQAEDEGDYYCAVWFNDR
Pogona vitticeps V172 iglv emb|CEMB01035986.1| 8642 LSVQQLQTLKDTESVAAGGTVTLSCRYSGGTIGDGNYPWWAQKKPGSKPRTMIYTTSTRPSDVPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V173 iglv emb|CEMB01037069.1| 1065 ISSQGTVTQPASASASLGQTVKLSCTRSSGSWYKFHWYQQKSGGAPRYVHCDVCNRGEGIPDRFTASQSGDSGHLTITDVQAGDEAVYYCAAWDRDGGA
Pogona vitticeps V174 ighv emb|CEMB01037313.1| 233599 CHSEVQLVETGGGVVSPGSSLRLSCRGSGFDFSSYNMHWIRQATGKGLEWVAQISSPSGSSQWYNSKVQGRFTISRDNSQSSADLRMENLKPEDSALYYCAR
Pogona vitticeps V178 ighv emb|CEMB01037313.1| 163168 ASSDIQLVSSGPETVRPGETLDLVCKLTGFSITTQYWHWIRQAPGKGLQWVALMYPSSGRKWFASSFQSRATISSDASKNEVYLQLRSVTVDDSAVYYCVGE
Pogona vitticeps V180 ighv emb|CEMB01037313.1| 144342 VNSQVTLGQDPSVQLKPSETLRLTCSISGFSLTEYATAVSWIRQPFGKGLEWLSLVFWDDDKRYSSTLKNRLTISRDVSKSEVYLEFRGMGTGDSGTYYCARR
Pogona vitticeps V181 iglv emb|CEMB01037582.1| 1978 VTSQPTVTQPASQSVSPGQTTTIPCSKSSGSSWDSYLGWFQQKPGQTPRFVHCNGCNSREPGIPDRFTASASGNSGSLTITNVEAGDEAIYYCYAWSSSASA
Pogona vitticeps V182 trav emb|CEMB01535857.1| 432 GTQADSVSQIEDLVTVQEGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V183 trav emb|CEMB01538122.1| 425 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V50 ighv CEMB01022913.1 39917 IHSQGQPSLEESGGGLKRPGEALRLSCRASGFTFSSYYMIWVRQAPGKALEWIAGIYTDGSQQQYAETVKGRFTISRNNPSNMLYLQMNNLKPEDTAVYYCAR
Pogona vitticeps V51 iglv CEMB01023034.1 1814 TNSQLTVTQPPSASVSLGNTVKLSCTISMTGRAISWYQQKPGSAPRYLLYYFSESYKHQGSGVPSRFSGSKDSSDKIGYLSISGAMAEDEAVYYCAAYDSSV
Pogona vitticeps V55 iglv CEMB01025177.1 3904 VTSQPTVTQPVSQSASPGQTTTLSCSKSSGSWSSYVSWVQQKPGQPPRFVHCNGCSRGAGISDRFTASASGNSGSLTITNVEAGDEAVYYCHAWS
Pogona vitticeps V57 iglv CEMB01025177.1 39715 VSSQASVTQPASASVSLGQTVKLSCTRSSGDSWNPFHWHQQKSGEALRFVLYGSSIRGEGIPDRFSGSASGNTGYLTITDVQAGDEGVYYCGAWYGAG
Pogona vitticeps V59 iglv CEMB01025177.1 50631 VDSQPTLTQPASQSVSPRETTTLNCLKGSGSWNSRVSWVQQKPGQPPRFVHCNGCSSRGAGIPDRFTASASGNTGSLTITNVEAGDEAIYYCAVWS
Pogona vitticeps V60 iglv CEMB01025177.1 54903 IRSEATVTQPASASVSLGETVKLSCTGSSDGTWSIFSWYQQKPGQAPQFVHCDDCNRGEGTPDRFTASESGDTGFLTITDSQAEDEANYYCAAWDYTSST
Pogona vitticeps V61 igkv CEMB01025177.1 71606 CDGQFTMSQLPSISAAMRETVQIPCRRSSENVGRFYNSWYQQKPGSAPILLLYKHSVRASGIPERFSGSIDISANTATLTISNVQAEDEAIYYCFSYDGRRQ
Pogona vitticeps V62 iglv CEMB01025177.1 76532 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYDRGEGIPNRFTASASGNSGSLTITNAEAGDEAVYYCVVWS
Pogona vitticeps V63 iglv CEMB01025177.1 82192 VTSQPTVTQPASQSASPGQTTTLSCSKSSGSWSGYVNWIQQKPGQAPRFVHCNICSRGPGIPDRFTASASGNTGSLTITNIEAGDEAIYYCAEWS
Pogona vitticeps V64 iglv CEMB01025177.1 101672 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYNRGEGIPNRFTASASGNSGSLTITNVEAGDEAVYYCYVWS
Pogona vitticeps V66 ighv CEMB01025868.1 114 IHSQGVVLTQGGSELKKPGESARLKCATSGFVLNDYYTAWIRQKPGEGLQWLVSYWKASQTNYYLPAIQNRFTASKDSSNFYLQMNNLTPEDTAVYYCAR
Pogona vitticeps V67 iglv CEMB01027487.1 3118 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKNVHWYQQKPGKAPVLIIYNDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDGNA
Pogona vitticeps V68 iglv CEMB01028068.1 4357 HCVSTTFGLSISVSLGDTVKLPCAISRNDRYIYWYQQKTGSSPRYLLYYGSESRKGQGSGVPSRFSGSKDSSGRIGYLTISGALAEDEAIYYCSAADSYA
Pogona vitticeps V69 iglv CEMB01028068.1 21669 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V70 iglv CEMB01028068.1 24175 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V71 iglv CEMB01028068.1 29351 ITSQATVTQPASISLSPGQTLKLSCTRSGGSSWGGFQWYRQRPGEAPHFVHRESYSRGEGISDRFTASQSGDAGQLTITNVQATDEAHYYCFISYDNGNQ
Pogona vitticeps V72 iglv CEMB01028068.1 33065 ANSQLTVSQPPSASVSLGSTTKLSCTISMDGRTIRWYQQKPGNAPRFLLYYYTESSKGQGSGVPSRFSGSKDSSGKIFYLTISGALAEDEAVYYCAAWYSDA
Pogona vitticeps V74 trav CEMB01029335.1 217 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASRL
Pogona vitticeps V75 iglv CEMB01029607.1 470 ANSQFTVSQPPSASVSPGNTAKLSCTISSSGKTVYWYQQKPGNAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSNTIGYLTISGALADEAVYYCTAWDGNA
Pogona vitticeps V76 iglv CEMB01030482.1 1072 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGTYVHWYQQKPGKAPVLIIYYNSRRSAGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVGDGNA
Pogona vitticeps V77 trav CEMB01032697.1 2273 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPHLFWYTQHLDDGSLQLLLQEHNAEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V78 trav CEMB01032697.1 3731 GTHADSVSQTEDLVTVREGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V79 trav CEMB01032697.1 7495 STTGQSVNQAEGTVLVTQGKNIFLHCSYKSSFTTAYPFWYVQYPGQPPRLFLREFGKEEGDRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVR
Pogona vitticeps V80 trav CEMB01032697.1 9791 SCVNAQKIVQPESAVSFAGASFNLPCNLSSVSTEMIQWYRQFPGQGPQYIAGAFPGRTGEGTNPKSTLRFAKEKTSSVLVLHRVTLADAAVYFCALSD
Pogona vitticeps V81 trav CEMB01032697.1 12864 FGLSDSIFQLLSVRSVSEGEDVVLYCNFSTFDSNPYLFWYNQFPSQPPKHITTIARYSTNVPGTLNLEKKTVSLKIETVSLRDQAVYFCALR
Pogona vitticeps V82 trav CEMB01032697.1 16331 STTGQSVNQIEGTVVVTQGKNIFLHCSYESSFTTNDPFWYVQYPGQRPRLFLKEYTKEEGNRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVS
Pogona vitticeps V83 trav CEMB01032697.1 18293 SLGRAQKIVQPESAIPVAGGSYDLPCNLSSVSSEKILWYRQFPGQGPQYIAGAYPGRTDEGTDPKSTLRVAKEKTSSVLFLHHVTLADAAVYFCALVL
Pogona vitticeps V84 trav CEMB01032697.1 23715 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V85 trav CEMB01032697.1 26076 MKGSPVNQPEGTMTITEGKQITIKCTYEKSIYYLFWYIQHPGQPPKLFLRDAEDPSDEGRARGFVAENEKPLSTFSLKKTAIQLEDSAIYFCAGS
Pogona vitticeps V86 trgv CEMB01032697.1 30541 VLWCKAQEIIQEPVMEASEGKTFNLTCSHPKATTETIFWYRQFPGQTLLYVTSGYSHNEEGTLHVPSGRKSNALTLTKVTLNDAAVYYCALS
Pogona vitticeps V88 trgv CEMB01032697.1 37330 ILLCKAEQITQEPLVEASVGKALNLSCSHPSAAKGDAIHWYQQLPNQAPHFIVSGYSGVVRSEKLKGASLLINEDKKSSYLSLTLVTLEEAAVYYCAVS
Pogona vitticeps V89 trav CEMB01032697.1 43621 FLGIAQKIEQQESTTAFSGKAHNLSCTLTSVSSVTKMIQWYRQFPGQGPQYIAGAYPGETVEGTDPKSTLHFAHDKKSSALALHHILLDDAAVYFCALAD
Pogona vitticeps V92 iglv CEMB01034103.1 692 ANSQPSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQRPGQAPRYVHCNGCSRGPGIPDRFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V93 trav CEMB01035531.1 34118 IDGQEKVEQHPPSLEVLRGNNATLTCTVSTGGLQWYRQHPGGKPIFLMFVYGGQRTKEGDHFVGEFNSKEKQGYLHIINAQLHHGENYFCAPD
Pogona vitticeps V94 trav CEMB01035531.1 37048 GTLGQSVDQTEGTVIVSQGSSVSIRCSYDLSGQVDPFWYIQLPGQPPKLFLRDLGKTDSDEGHLRGFMANHDKSSNKKQKTFHMEKSSVQLNDAALYFCAVR
Pogona vitticeps V95 trav CEMB01035531.1 40863 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNSVQWYQQNPDGQIVHIAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V96 trav CEMB01035531.1 45520 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNNLQWYQQNPDGHIVHVAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V97 trav CEMB01035531.1 49277 ARSQDAVEQEPLKVTREGENTTIACRYKTSNFYSLHWYRQYPGEGLEFLLQKVTDNPNLKDHMQGDLDKKKQLSRLSFRGARLRDDATYFCALA
Pogona vitticeps V98 trav CEMB01035531.1 91105 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDPKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V99 iglv CEMB01035986.1 6032 ATSQPTVTQPASQSVSPGRTTTLSCSKSSGSWNDGVYWLQQKHGQPPHFVHCNGCRSRGAGIPDRFTASTSGNSGSLTITNVEDGDEAVYYCAAWS
Pogona vitticeps V100 ighv CEMB01036198.1 2008 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTNSYYWNWIRQTPGKGLEWMGYWVGSTSYSPSFQNRITISVDSSQTKYFLRLTSGTAADTATYYCAR
Pogona vitticeps V101 ighv CEMB01036198.1 11157 LSSQLQLKESGPGMVKPGDILELTCMVTGGSVTSGPWWGWIRQAPGKGLEWMGLWNGNTYYSSSFQNRATISVHSSQTKYFLQLTSVTTADTGTYYCAR
Pogona vitticeps V102 ighv CEMB01036198.1 18124 LSFQLQLKESRPGTVRPGDALELTCTVTGGSVTSGNWWSWIRQAPGKGLEWIGMWDGSTYYSSSFQNRISISVHSSQTKYFLRLTSVTTADSSTYYCAR
Pogona vitticeps V103 ighv CEMB01036198.1 22116 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGPWWSWIRQAPGKSLEWIGSWTGSTYYSSSFQNRVTISVHSSQTKYSLRLTSMTTADTSTYYCAR
Pogona vitticeps V104 ighv CEMB01036246.1 142 THSQVVLTQEGPVVKKPGESHKLTCATSGLPLSSTWMTWIRQKPGKGLEWLLEYYDSGSNNYSPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCA
Pogona vitticeps V106 ighv CEMB01036246.1 4915 ARSQVVLTQDGPVVKKPGESHKLTCATSGLTLSSTIMQWIRQKPGKGLEWLVEYYSAGSNDYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAR
Pogona vitticeps V107 ighv CEMB01036246.1 8799 ARSQAVLTQEGPVVKKPGESHKLTCATSGLALSSTWMNWIRQKPGKGLEWLVHYYSAGNNYYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V108 ighv CEMB01036246.1 10296 TRSQAVLTQEGPVVKKPGESHKFTCATSGFTLRSTYMHWIRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V109 ighv CEMB01036246.1 20448 THSEVVLTQEGPVVKKPGESYKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V110 ighv CEMB01036246.1 21754 ARSQVVLTQDGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V111 ighv CEMB01036246.1 23058 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V112 ighv CEMB01036246.1 23575 ARSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLEWLVEYYSAGSNYYSPAIRGRFTASKGASDFYLQMNDLKAEDTAVYYCAR
Pogona vitticeps V113 ighv CEMB01036246.1 27139 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAKDTAVYYCAA
Pogona vitticeps V115 ighv CEMB01036246.1 46652 IFASLQLLESGPGVVKPGGSLKLTCVVSGVDVGDYYWNWIRQPPGKGLEWLGDIQDSDDGGGTAYNPRFISRMSISRDIAKNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V116 ighv CEMB01036246.1 53915 LSSQLQLKESGPGTVRPGDNLELTCTVTGGSITSSYIWNWIRQTPGKGLEWMGYWVGSPSYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V117 ighv CEMB01036246.1 56108 LSSQLHLKESGPGMVRPGDTLELTCTVTGGSVTSSWYWHWIRQTPGKGLEWMGYWTGSTSYSPSFQNRITISVDSSQTKYFLRLTSVTASDTAMYYCAG
Pogona vitticeps V118 ighv CEMB01036246.1 59553 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGYTWHWIRQTPGKGLEWMGWWSGSTRYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V119 trav CEMB01534111.1 54 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPRLFWYTQHLDDGSLQLLLQEHNTEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V121 ighv CEMB01005252.1 55426 FSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYDSAFQSRVSITADASKNEYYLELRSLTAADTAVYYCARR
Pogona vitticeps V122 ighv CEMB01005252.1 51630 FSENRLTESGGGAWKPGASLRLTCVVSGYSITSGAGLNWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARG
Pogona vitticeps V123 ighv CEMB01005252.1 48986 SSEIRLTQSGGETWKPGATLRLTCAVSGYAISSGYYWHWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARR
Pogona vitticeps V124 ighv CEMB01005252.1 42250 VQLEVQLLQSGGETKRPGESLRLSCRASGYPFGSHSAHWIRQAPRKALEWIAWIYDDGSRLSYADSVKGRFTISRDNSKNMLYLLMNSLRPDDTAMYYCAAE
Pogona vitticeps V125 ighv CEMB01005252.1 35499 FSEIRLTQSGGETWKPGATLRLTCAVSGYSMTSGYNWNWIRQPPQKGLEWIGRGYYSSSNWKTNYGSAFQSRISITADASKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V126 ighv CEMB01005252.1 32550 YSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYGSAFQSRVSITADASKNKYSLELRSLTAADTAVYYCARE
Pogona vitticeps V127 ighv CEMB01005252.1 29191 FSEIRLTQSGEGTWKPGASFRLTCKVSGYTMTSGAEWDWFRQPSKKALEWLGTGRYIRSTWKPGYSSAFQSRISITADASKNEYYLQLRSLTAADTAVYYCAR
Pogona vitticeps V128 ighv CEMB01005252.1 14190 AHSQVVLTQEGPVVKKPGESHKLTCATSGFSLSGSGMHWIRQKPGKGLEWLVYYYSASHNNYSPSIRGRFTASKGASDFYLQMNDLNAEDTTVYYCAR
Pogona vitticeps V129 ighv CEMB01005252.1 10761 ARSQVVLTQEGPIVKKPGESHKLTCATSGFPLSSRTMHWIGQKTGQGLEWLVRYYSAGDNQYSPSIRGRFTASKSASDLYLQMSDLNAEDTAVYYCARE
Pogona vitticeps V130 ighv CEMB01005252.1 8588 AHSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMSWIRQKPGKGLEWLLEYKDSGSNNYIPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCARF
Pogona vitticeps V132 iglv CEMB01005754.1 5399469 SFGQYVLTQPPSASVPLGQNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYYDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V135 igkv CEMB01006509.1 4682 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQNDRVP
Pogona vitticeps V136 iglv CEMB01007033.1 4231 LSVQQLQPLKDRESVAAGGTVTLSCRYSGGTIGDGNYPWWVQMKPGSRPWTVMYTTSTRPSGIPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V137 trgv CEMB01010246.1 61880 VNPQTILQSAESVVQWLGSSTSLSCFLEGSSDPNLYWYQQMPGGWLEQLSYSISQGSATTTGPGHIKGKRLDKRTFHLEITSLRRNDTATYYCAWS
Pogona vitticeps V139 ighv CEMB01016747.1 6591 VFSGPQLIETGPGVVKPGGSFKLTCSVTGVQVSDYYWSWVRQPLEKRLEWLGFIRSTAQGGTTQLSPAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V140 ighv CEMB01016747.1 4078 TSSSPQLIQSGLGVVKPGGSLKLTCTVTGVQVSDYYWGWIRQLQGKTLEWLGYIRDTADGGTPYYNSAFSSRVTVSRDTSRNEVYLQMSSMAAADTGMYYCAR
Pogona vitticeps V142 iglv CEMB01021247.1 764 ANSQLSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQKAGQTPHFVHCNGCSSRGAGIPARFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V143 iglv CEMB01023034.1 35372 VDSQPTVTQPASQSVSPGQTTTLNCMKGSGSWSSYIGWVQQKPGQAPRFVHCDGCSRGPGIPDRFTASASGNSGSLTITNVEAGDEAVYYCIGWSTSPQM
Pogona vitticeps V144 iglv CEMB01023034.1 32018 ISSQGTVTQPASASASLGQTVKLSCTRSSGGRWYNFHWYQQKPGEAPRYVHREGESRGEGISNRFTASQLGESGYLTITNIQAGDEAAYYCCALH
Pogona vitticeps V145 ighv CEMB01024165.1 812 ISSQVTLTESGEGVKKPGETLQLTCTVSGFSLTDSNYAVAWIRQLSGKTLEWIVEIWGSGSTYYNSALRNRITITKETSKRQVILQLSGLKPEDTAVYYCAR
Pogona vitticeps V146 ighv CEMB01024411.1 1780 VLSSPQLTESGPGVVKPGESFKLTCSISGIQVSNNYWSWIRQPPGKGLEYLGYIQSTAGGGSSYYNSAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V150 ighv CEMB01025432.1 5223 VVSQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMYWVRQKPGKGLEWLVSYYNTASGNSHYSPAIQGRFTASKGSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V151 ighv CEMB01025432.1 2012 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVRQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V152 trav CEMB01026698.1 13104 FTGLCRGVVVTQKEPFKIIWAGSQTSIDCEHNDNTYFTVLWYRQQSEQTDMQLIGSSVHGTDAKMEVLSYSIKRPSVTQASLLVPLGKPGDSAVYFCAVST
Pogona vitticeps V153 trbv CEMB01026698.1 5244 STECKIHQPRSLIVEKGKNVQLECRQLHQHDAMYWYQQAKGMELQLGYYSRTSLSGSEVKETTSNRFTAHRPEKERFQLNISSVEMKDSATYFCASS
Pogona vitticeps V154 trgv CEMB01026698.1 2163 SSNAEIKQPWSLVLEVGKPAWLECRQTFQHTSMLWYQQKAGKGLQFLYRFYNKREQEKGNVPNRFTADQPQADCSNLNISSVKQEDSAVYYCASSL
Pogona vitticeps V155 ighv CEMB01026708.1 25064 AQLEVVLVESGGDVKRPGDSLRLSCQASGFTFSSYRMSWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V156 ighv CEMB01026708.1 17600 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTGVYYCAR
Pogona vitticeps V157 ighv CEMB01026708.1 14848 AQSEVVLVESGGDVKRPGDSHQLSCQGSGFTFSSYHMSWIRQAPGKGLEWVAFISTSSGSIYYSDGVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V158 ighv CEMB01026708.1 11664 AQSEILLVESGGDVKRPGDSIHLSCQASGFTFSSYGMSWIRHAPGKGLEWVAYIGTSSTPIYYSNTVVKGRFTISRDDSNSQLYLQMNSLKSEDTGVYYCART
Pogona vitticeps V159 ighv CEMB01026708.1 8088 AQSEILLVESGGDVKRPGDSLRLSCQGSGYTFSDYAMNWIRQAPGKGLEWVAYINYNSATIYYSNTIKGRFTISRDNSNSLLYLQMNSLKSEDTGVYYCAR
Pogona vitticeps V160 ighv CEMB01026708.1 6251 VLSEIQLVESGGDMKRPGESLRLSCRASGFTFSSYWMHWIRQASGKGLEWVANIRGDGNNYFYADAAKGRFTISRDNPSSTLYLQMNRLTTEDSGLYYCAK
Pogona vitticeps V161 ighv CEMB01026708.1 4351 SFSQVILTQSDPVAKKPGEAHKLACAVTGFDINSYYMAWIRQKPGKGMEWLVSYHRPGSTSYYSSEIQGQFTASKEGSNFYLQMNSLKAEDTAVYYCAR
Pogona vitticeps V162 ighv CEMB01026708.1 378 CHSEVQLVETGGGVVSPGESLRLSCKASGFTFSSYYMSWIRQAAGKGLEWVATITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKTEDSAVYYCAR
Pogona vitticeps V163 trbv CEMB01027004.1 12966 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASSL
Pogona vitticeps V164 trav CEMB01027004.1 2893 CSNAKISQPWSLLKKEGESIVLLCRQNDGHNVMAWYRQSAGQNLQLLYSFYLKNEQAKGSNISVRFTVERPDNTDFNLNISPAKPEDSAVYFCASSIDT
Pogona vitticeps V165 ighv CEMB01027208.1 2475 CLSAVQLVEMGGGVVSPGGSIHLSCKGSGFDFSSYNMVWIQQATGKGLEWVAEIRYNSEKVWYNPRFQGRFTISRDNPQSLLHLRMESLKPEDSAVYYCAR
Pogona vitticeps V167 trav CEMB01030083.1 23088 AQRWVVSQVFQPSQLTVVEGKKINISCYQNVTSHNTMSWYKQPLDGQGSLTILGSSYSGVTTAGDLEINVDPKLRSATLTKEAAALSDSRVYYCAVR
Pogona vitticeps V168 iglv CEMB01030482.1 6159 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAVYYCAAWDSNA
Pogona vitticeps V169 iglv CEMB01033196.1 1420 ANSQLTVTQPPLASVSLGNTTKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSHFSGSKDSSGSIGYMTISGALAEDEAIYYCAAGYNG
Pogona vitticeps V170 iglv CEMB01035986.1 36996 FGSQAALTQSGPVSVALGETATVSCTLQEVEFISTTSPSWYQVKTGEAPQLLIYKSRERDSRVPERFSGDTHGKTATLTIARVQAEDEGDYYCAVWFNDR
Pogona vitticeps V172 iglv CEMB01035986.1 8642 LSVQQLQTLKDTESVAAGGTVTLSCRYSGGTIGDGNYPWWAQKKPGSKPRTMIYTTSTRPSDVPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V173 iglv CEMB01037069.1 1065 ISSQGTVTQPASASASLGQTVKLSCTRSSGSWYKFHWYQQKSGGAPRYVHCDVCNRGEGIPDRFTASQSGDSGHLTITDVQAGDEAVYYCAAWDRDGGA
Pogona vitticeps V174 ighv CEMB01037313.1 233599 CHSEVQLVETGGGVVSPGSSLRLSCRGSGFDFSSYNMHWIRQATGKGLEWVAQISSPSGSSQWYNSKVQGRFTISRDNSQSSADLRMENLKPEDSALYYCAR
Pogona vitticeps V178 ighv CEMB01037313.1 163168 ASSDIQLVSSGPETVRPGETLDLVCKLTGFSITTQYWHWIRQAPGKGLQWVALMYPSSGRKWFASSFQSRATISSDASKNEVYLQLRSVTVDDSAVYYCVGE
Pogona vitticeps V180 ighv CEMB01037313.1 144342 VNSQVTLGQDPSVQLKPSETLRLTCSISGFSLTEYATAVSWIRQPFGKGLEWLSLVFWDDDKRYSSTLKNRLTISRDVSKSEVYLEFRGMGTGDSGTYYCARR
Pogona vitticeps V181 iglv CEMB01037582.1 1978 VTSQPTVTQPASQSVSPGQTTTIPCSKSSGSSWDSYLGWFQQKPGQTPRFVHCNGCNSREPGIPDRFTASASGNSGSLTITNVEAGDEAIYYCYAWSSSASA
Pogona vitticeps V182 trav CEMB01535857.1 432 GTQADSVSQIEDLVTVQEGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V183 trav CEMB01538122.1 425 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V0 trbv emb|CEMB01002966.1| 576109 PADSQSNVKVIQQPPSENLLQGKALELRCSVNQENYYFYWYRQVPGETKLQSLGTFRTFESTLQEPADELKERLSGERKNNECSLNLASLQSSDSGLYLCAAK
Pogona vitticeps V3 ighv emb|CEMB01002971.1| 49406 AQSQIQLVQSGPEIKKPGESVRFTCKASGYTFNQYSLSWIRQAPGKGLEWVGRIRTDNFDTFYPESLKTRVTITVDVSISTLYLQLTGLKTEDTAVYYCA
Pogona vitticeps V5 ighv emb|CEMB01002971.1| 88133 ILSQISLRESGGGVKKPGETLQLTCTVSGFPLTSYGVHWIRQPPGKGLEWAGVIWGDGSNNYNSALQSRISITRDVSKSQVFLQLRNLKPEDSAMYYCAR
Pogona vitticeps V6 ighv emb|CEMB01002971.1| 90592 ILSQISLRESGGGVKKPGETLQLTCTVSGFSVASKAVHWIRQPPGKGLEWAGVIWSSGGNSYNSALQSRISITRDPSKSQVSLQLRNLKPEDSATYYCAR
Pogona vitticeps V7 ighv emb|CEMB01002971.1| 120112 ISSQVTLTESDGGLKKPGETLHLICTVAGYSLTDSTYATDWVRQPLGKGLEWSGAIWHDGTARYNSALQNRATITRDISKSQVLFQLSAVKTEDSAVYYCA
Pogona vitticeps V8 ighv emb|CEMB01002971.1| 122484 ISSQVTLTESGGGLKKPGETLHLTCTVAGYSLTDSSYATNWVRQPSGKGLEWVGIMWHNGGTAHNSVLQNRATITRDTSKSQVFLQLSALKPEDSAVYYCAR
Pogona vitticeps V9 ighv emb|CEMB01002971.1| 128357 VSSQVTLTESGGGLKKPGETVHLTCMVTGYSLTDSSYATHWVRQPLGKGLEWTGGIWYDGTARYNSALQNRATITRDISKSQVFFQLSDVKPEDSAVYYCARE
Pogona vitticeps V10 ighv emb|CEMB01002971.1| 130919 ISSQVTHTESGGAPNKPGEALHLTCIVTGYSLTDASYATGWVRQPFGKGLEWIGIIWSHGPSVYNTALQNRAIITRDTSKSRVFLQLNALKPEDSAVYYCIR
Pogona vitticeps V11 ighv emb|CEMB01002971.1| 145823 VQSQGRLEQSEGGIRKPGESLRLSCRGSGFAFGSTGMHWVRQATGKGLEWIAVIWYDASKQYYADSVKGRFIISRDNPSSVAYLQMNDLKAEDTAVYYCA
Pogona vitticeps V12 ighv emb|CEMB01002971.1| 148247 VHASVRLVESGPGMLKPGQSLRLSCAITGDSVKSSYWHWVRQAPGKRLEWVGRIDWSSSTWRILYAPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V13 ighv emb|CEMB01002971.1| 152900 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V14 ighv emb|CEMB01003547.1| 637 VISQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMHWVRQKPGKGLEWLVSYYTASSNNYSPAIRGRFTASKGASDFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V15 iglv emb|CEMB01004663.1| 11643 SFGQYVLTQPPSASVSLGQNAQISCSGNNIERKSVQWYQQKPGKAPVLIIYVDNRRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVWDSNA
Pogona vitticeps V16 ighv emb|CEMB01005058.1| 91 FSEIRFTESGGGARKPGASLRLTCAVSGYSITSGAGLHWVRQPPQKGLEWIGMIYYSSSTWKTNYGSAFQSRATLSADSSKNQYYLELRSLTAADTAVYYCTGE
Pogona vitticeps V19 igkv emb|CEMB01007043.1| 139 TRGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQSDRVP
Pogona vitticeps V20 igkv emb|CEMB01007043.1| 11432 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGHARQKDVPARFSSSGYGEDFTLTISSVEAEEEGYYHCQQSDRVP
Pogona vitticeps V21 iglv emb|CEMB01008496.1| 991 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYKDSSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V22 ighv emb|CEMB01009219.1| 4228 VHASVQLVESGPGTLKPGQTLRLSCAVTGDSVENSYWHWVRQAPGKGLEWVGRIDWSGSTWRIFYTSSLQSRATLSADSSKNEYYLELRSLTAADTGVYYCARE
Pogona vitticeps V23 ighv emb|CEMB01009219.1| 7399 VHASVQLVESRPGTLKPGQSLRLTCTISGDSVKSNYWHWVRQASGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSVTAADTAVYYCARE
Pogona vitticeps V24 ighv emb|CEMB01009219.1| 11208 AFTQVVLTQSEPAVKNPGQSHKLSCRATGFDVNGYWMEWVRQKPGQGLEWLAHYLNPSSNYYSSAIQGRFTASKDSSSFYLQMNNLKDEDTAVYYCAR
Pogona vitticeps V25 ighv emb|CEMB01009219.1| 13801 VHASVRLVESGPGTLMPGRSLRLTCTISGASVKSKYWHWVRQAPRKGLEWVGQIVWIGITWGTIYAPSLQSRATLSADFSKNEYYLELRSLTAADTAVYYCA
Pogona vitticeps V26 ighv emb|CEMB01009219.1| 18433 VHANVQLVESGPGTLKPGQSLRLACKISGDSVKSNYWHWVRQAAGKGLEWVGRIVWSSNTWHIFYLPSLQSRATLSADSSKNEYYLELRSLTAADTAVYYCARE
Pogona vitticeps V27 ighv emb|CEMB01009219.1| 50065 ARSEVLLVESGGDVKRPGDSLRLSCRASGFTFSSYAMGWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V28 ighv emb|CEMB01009219.1| 51045 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V30 iglv emb|CEMB01009691.1| 12475 VDSQPTVTQPASQSVSPGQTTTLSCSKSSGSWGSYVYWLQQKPGQPPRFVHCDGCSSRGAGIPDRFTASASGNSGSLRITNVEAGDEAIYYCYVWSSSARV
Pogona vitticeps V31 iglv emb|CEMB01009691.1| 17794 ATSQPTVAQPASQSVSPGRTTTLSCSKSSGNWNDGVYWLQQKHGQPPRFVHCNGCCSRGAGIPDRFTASASGNSGSLTITKVEDGDEAVYYCYAWS
Pogona vitticeps V32 iglv emb|CEMB01009691.1| 29035 SDGQFTMSQPPSVSAAIRETVQIPCRRSSGSVSSYYNSWYQQKPGSAPILLIFGDDATASGIPERFSGSIDESANTATLTISNVQAEDEADYYCLSSDSSGQ
Pogona vitticeps V33 iglv emb|CEMB01014241.1| 9696 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRYISWYQQKPGSAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSGKIGYLTISGALAEDKAVYYCAV
Pogona vitticeps V37 iglv emb|CEMB01019501.1| 8762 ANSQLTVSQPPSASVSLGNTVKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSRFSGSKDSSGSIGYLTISGALAEDEAVYYCAAGYNG
Pogona vitticeps V38 ighv emb|CEMB01021537.1| 547 CHPKPQLIETGGGVVAPGGSLRLSCKASGFTFTNYTMHWVRQAAGKGLEWVAGVSKPTGSSQWYNSKVQGRFNISRDNTQSSVYLQMANLKSEDSAVYYCAR
Pogona vitticeps V40 iglv emb|CEMB01021861.1| 6458 IHSQPTVSQPASASASPGQTVKLSCTRSSGGSWSSLYWYQQRPGQAPRFVHCQSCSRGEGIPGRLTASESGGNGLLTITNVEAGDEAVYYCAAWY
Pogona vitticeps V41 ighv emb|CEMB01022913.1| 816 CHSQVQLVETGGGVVSPGGSLLLSCKASGFTFSGYYMSWVRQAAGKGLEWVARITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKAEDSAMYYCAR
Pogona vitticeps V42 ighv emb|CEMB01022913.1| 13012 VVSQVVLTQPGPVLKKPGESHKLSCATSGFTLSSTWMGWIRQKPGKGLEWLAWYYGTASGQSFYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V43 ighv emb|CEMB01022913.1| 15086 VVSQVVLTQSGPVLKKPGESLKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYLGTSSGHSYYTPAIQGRFTASKDNSNLYLQMNNLKEEDTAVYYCAW
Pogona vitticeps V44 ighv emb|CEMB01022913.1| 20454 VVSQVVLTQSGPVSKKPGESHKLTCATSGFTLSSYGMSWVRQKPGKGLEWLVYYYNTASGNSHYTPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V45 ighv emb|CEMB01022913.1| 26349 CRSAVQLVETGGGVVSPGGSLRLTCKASGFPFSGYSMHWVRQAAGKGLEWVAGIRYDGADQWYNSKVQGRFTISRDNPQSSVDLRMGSLKPEDSGVYYCVR
Pogona vitticeps V46 ighv emb|CEMB01022913.1| 28751 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVHQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V47 ighv emb|CEMB01022913.1| 30725 VVSQVVLTQSGPVLKKPGESHKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V48 ighv emb|CEMB01022913.1| 32733 VVSQVVLTQSGLVLKKPGESHKLTCETSGFALSTAWMDWFRQKPGKDLEWLVHYYSTASGRNFYSPAIQARFTASKDSSNFYLQLNDLKEEDTAVYYCAR
Pogona vitticeps V49 ighv emb|CEMB01022913.1| 35660 CHSEVQLVETGGGVVAPGGSLHLSCKASGFTFSSYEMHWIRQAAGKGLEWVGGISGSGGSQWYNSKVRGRFTISRDNARSSADLRMASLKPEDSAMYYCTR
Pogona vitticeps V50 ighv emb|CEMB01022913.1| 39917 IHSQGQPSLEESGGGLKRPGEALRLSCRASGFTFSSYYMIWVRQAPGKALEWIAGIYTDGSQQQYAETVKGRFTISRNNPSNMLYLQMNNLKPEDTAVYYCAR
Pogona vitticeps V51 iglv emb|CEMB01023034.1| 1814 TNSQLTVTQPPSASVSLGNTVKLSCTISMTGRAISWYQQKPGSAPRYLLYYFSESYKHQGSGVPSRFSGSKDSSDKIGYLSISGAMAEDEAVYYCAAYDSSV
Pogona vitticeps V55 iglv emb|CEMB01025177.1| 3904 VTSQPTVTQPVSQSASPGQTTTLSCSKSSGSWSSYVSWVQQKPGQPPRFVHCNGCSRGAGISDRFTASASGNSGSLTITNVEAGDEAVYYCHAWS
Pogona vitticeps V57 iglv emb|CEMB01025177.1| 39715 VSSQASVTQPASASVSLGQTVKLSCTRSSGDSWNPFHWHQQKSGEALRFVLYGSSIRGEGIPDRFSGSASGNTGYLTITDVQAGDEGVYYCGAWYGAG
Pogona vitticeps V59 iglv emb|CEMB01025177.1| 50631 VDSQPTLTQPASQSVSPRETTTLNCLKGSGSWNSRVSWVQQKPGQPPRFVHCNGCSSRGAGIPDRFTASASGNTGSLTITNVEAGDEAIYYCAVWS
Pogona vitticeps V60 iglv emb|CEMB01025177.1| 54903 IRSEATVTQPASASVSLGETVKLSCTGSSDGTWSIFSWYQQKPGQAPQFVHCDDCNRGEGTPDRFTASESGDTGFLTITDSQAEDEANYYCAAWDYTSST
Pogona vitticeps V61 igkv emb|CEMB01025177.1| 71606 CDGQFTMSQLPSISAAMRETVQIPCRRSSENVGRFYNSWYQQKPGSAPILLLYKHSVRASGIPERFSGSIDISANTATLTISNVQAEDEAIYYCFSYDGRRQ
Pogona vitticeps V62 iglv emb|CEMB01025177.1| 76532 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYDRGEGIPNRFTASASGNSGSLTITNAEAGDEAVYYCVVWS
Pogona vitticeps V63 iglv emb|CEMB01025177.1| 82192 VTSQPTVTQPASQSASPGQTTTLSCSKSSGSWSGYVNWIQQKPGQAPRFVHCNICSRGPGIPDRFTASASGNTGSLTITNIEAGDEAIYYCAEWS
Pogona vitticeps V64 iglv emb|CEMB01025177.1| 101672 VDSQPTLTQPASQSVSPGQTTTLNCLKGSGSWSSYVCWVQQKPGQAPRYVHCNGYNRGEGIPNRFTASASGNSGSLTITNVEAGDEAVYYCYVWS
Pogona vitticeps V66 ighv emb|CEMB01025868.1| 114 IHSQGVVLTQGGSELKKPGESARLKCATSGFVLNDYYTAWIRQKPGEGLQWLVSYWKASQTNYYLPAIQNRFTASKDSSNFYLQMNNLTPEDTAVYYCAR
Pogona vitticeps V67 iglv emb|CEMB01027487.1| 3118 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGKNVHWYQQKPGKAPVLIIYNDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDGNA
Pogona vitticeps V68 iglv emb|CEMB01028068.1| 4357 HCVSTTFGLSISVSLGDTVKLPCAISRNDRYIYWYQQKTGSSPRYLLYYGSESRKGQGSGVPSRFSGSKDSSGRIGYLTISGALAEDEAIYYCSAADSYA
Pogona vitticeps V69 iglv emb|CEMB01028068.1| 21669 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V70 iglv emb|CEMB01028068.1| 24175 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAIYYCAAGYSGV
Pogona vitticeps V71 iglv emb|CEMB01028068.1| 29351 ITSQATVTQPASISLSPGQTLKLSCTRSGGSSWGGFQWYRQRPGEAPHFVHRESYSRGEGISDRFTASQSGDAGQLTITNVQATDEAHYYCFISYDNGNQ
Pogona vitticeps V72 iglv emb|CEMB01028068.1| 33065 ANSQLTVSQPPSASVSLGSTTKLSCTISMDGRTIRWYQQKPGNAPRFLLYYYTESSKGQGSGVPSRFSGSKDSSGKIFYLTISGALAEDEAVYYCAAWYSDA
Pogona vitticeps V74 trav emb|CEMB01029335.1| 217 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASRL
Pogona vitticeps V75 iglv emb|CEMB01029607.1| 470 ANSQFTVSQPPSASVSPGNTAKLSCTISSSGKTVYWYQQKPGNAPRYLLYYYSESSKGQGSGVPSRFSGSKDSSNTIGYLTISGALADEAVYYCTAWDGNA
Pogona vitticeps V76 iglv emb|CEMB01030482.1| 1072 SFGQYVLTQPPSASVSLGGNAQISCSGNNIGGTYVHWYQQKPGKAPVLIIYYNSRRSAGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVGDGNA
Pogona vitticeps V77 trav emb|CEMB01032697.1| 2273 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPHLFWYTQHLDDGSLQLLLQEHNAEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V78 trav emb|CEMB01032697.1| 3731 GTHADSVSQTEDLVTVREGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V79 trav emb|CEMB01032697.1| 7495 STTGQSVNQAEGTVLVTQGKNIFLHCSYKSSFTTAYPFWYVQYPGQPPRLFLREFGKEEGDRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVR
Pogona vitticeps V80 trav emb|CEMB01032697.1| 9791 SCVNAQKIVQPESAVSFAGASFNLPCNLSSVSTEMIQWYRQFPGQGPQYIAGAFPGRTGEGTNPKSTLRFAKEKTSSVLVLHRVTLADAAVYFCALSD
Pogona vitticeps V81 trav emb|CEMB01032697.1| 12864 FGLSDSIFQLLSVRSVSEGEDVVLYCNFSTFDSNPYLFWYNQFPSQPPKHITTIARYSTNVPGTLNLEKKTVSLKIETVSLRDQAVYFCALR
Pogona vitticeps V82 trav emb|CEMB01032697.1| 16331 STTGQSVNQIEGTVVVTQGKNIFLHCSYESSFTTNDPFWYVQYPGQRPRLFLKEYTKEEGNRHGFQAEHRKGEKTFHMKKSASQLKDSAVYFCAVS
Pogona vitticeps V83 trav emb|CEMB01032697.1| 18293 SLGRAQKIVQPESAIPVAGGSYDLPCNLSSVSSEKILWYRQFPGQGPQYIAGAYPGRTDEGTDPKSTLRVAKEKTSSVLFLHHVTLADAAVYFCALVL
Pogona vitticeps V84 trav emb|CEMB01032697.1| 23715 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V85 trav emb|CEMB01032697.1| 26076 MKGSPVNQPEGTMTITEGKQITIKCTYEKSIYYLFWYIQHPGQPPKLFLRDAEDPSDEGRARGFVAENEKPLSTFSLKKTAIQLEDSAIYFCAGS
Pogona vitticeps V86 trgv emb|CEMB01032697.1| 30541 VLWCKAQEIIQEPVMEASEGKTFNLTCSHPKATTETIFWYRQFPGQTLLYVTSGYSHNEEGTLHVPSGRKSNALTLTKVTLNDAAVYYCALS
Pogona vitticeps V88 trgv emb|CEMB01032697.1| 37330 ILLCKAEQITQEPLVEASVGKALNLSCSHPSAAKGDAIHWYQQLPNQAPHFIVSGYSGVVRSEKLKGASLLINEDKKSSYLSLTLVTLEEAAVYYCAVS
Pogona vitticeps V89 trav emb|CEMB01032697.1| 43621 FLGIAQKIEQQESTTAFSGKAHNLSCTLTSVSSVTKMIQWYRQFPGQGPQYIAGAYPGETVEGTDPKSTLHFAHDKKSSALALHHILLDDAAVYFCALAD
Pogona vitticeps V92 iglv emb|CEMB01034103.1| 692 ANSQPSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQRPGQAPRYVHCNGCSRGPGIPDRFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V93 trav emb|CEMB01035531.1| 34118 IDGQEKVEQHPPSLEVLRGNNATLTCTVSTGGLQWYRQHPGGKPIFLMFVYGGQRTKEGDHFVGEFNSKEKQGYLHIINAQLHHGENYFCAPD
Pogona vitticeps V94 trav emb|CEMB01035531.1| 37048 GTLGQSVDQTEGTVIVSQGSSVSIRCSYDLSGQVDPFWYIQLPGQPPKLFLRDLGKTDSDEGHLRGFMANHDKSSNKKQKTFHMEKSSVQLNDAALYFCAVR
Pogona vitticeps V95 trav emb|CEMB01035531.1| 40863 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNSVQWYQQNPDGQIVHIAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V96 trav emb|CEMB01035531.1| 45520 IWGQETVTQKDRFANTTEGEPVHLNCSYQGTPNNLQWYQQNPDGHIVHVAILFQTKTESFGRFDMNLNKQEKTTWLRLKNPRLEDSGVYFCAM
Pogona vitticeps V97 trav emb|CEMB01035531.1| 49277 ARSQDAVEQEPLKVTREGENTTIACRYKTSNFYSLHWYRQYPGEGLEFLLQKVTDNPNLKDHMQGDLDKKKQLSRLSFRGARLRDDATYFCALA
Pogona vitticeps V98 trav emb|CEMB01035531.1| 91105 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDPKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS
Pogona vitticeps V99 iglv emb|CEMB01035986.1| 6032 ATSQPTVTQPASQSVSPGRTTTLSCSKSSGSWNDGVYWLQQKHGQPPHFVHCNGCRSRGAGIPDRFTASTSGNSGSLTITNVEDGDEAVYYCAAWS
Pogona vitticeps V100 ighv emb|CEMB01036198.1| 2008 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTNSYYWNWIRQTPGKGLEWMGYWVGSTSYSPSFQNRITISVDSSQTKYFLRLTSGTAADTATYYCAR
Pogona vitticeps V101 ighv emb|CEMB01036198.1| 11157 LSSQLQLKESGPGMVKPGDILELTCMVTGGSVTSGPWWGWIRQAPGKGLEWMGLWNGNTYYSSSFQNRATISVHSSQTKYFLQLTSVTTADTGTYYCAR
Pogona vitticeps V102 ighv emb|CEMB01036198.1| 18124 LSFQLQLKESRPGTVRPGDALELTCTVTGGSVTSGNWWSWIRQAPGKGLEWIGMWDGSTYYSSSFQNRISISVHSSQTKYFLRLTSVTTADSSTYYCAR
Pogona vitticeps V103 ighv emb|CEMB01036198.1| 22116 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGPWWSWIRQAPGKSLEWIGSWTGSTYYSSSFQNRVTISVHSSQTKYSLRLTSMTTADTSTYYCAR
Pogona vitticeps V104 ighv emb|CEMB01036246.1| 142 THSQVVLTQEGPVVKKPGESHKLTCATSGLPLSSTWMTWIRQKPGKGLEWLLEYYDSGSNNYSPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCA
Pogona vitticeps V106 ighv emb|CEMB01036246.1| 4915 ARSQVVLTQDGPVVKKPGESHKLTCATSGLTLSSTIMQWIRQKPGKGLEWLVEYYSAGSNDYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAR
Pogona vitticeps V107 ighv emb|CEMB01036246.1| 8799 ARSQAVLTQEGPVVKKPGESHKLTCATSGLALSSTWMNWIRQKPGKGLEWLVHYYSAGNNYYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V108 ighv emb|CEMB01036246.1| 10296 TRSQAVLTQEGPVVKKPGESHKFTCATSGFTLRSTYMHWIRQKPGKGLEWLVYYYNTASGNSYYSPAIQGRFTASKDSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V109 ighv emb|CEMB01036246.1| 20448 THSEVVLTQEGPVVKKPGESYKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V110 ighv emb|CEMB01036246.1| 21754 ARSQVVLTQDGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLERLLEYKDSRSSNYSPAFRGRFTASKSASDFYLQISDLNAEDTAVYYCAA
Pogona vitticeps V111 ighv emb|CEMB01036246.1| 23058 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAEDTAVYYCAA
Pogona vitticeps V112 ighv emb|CEMB01036246.1| 23575 ARSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMQWIRQKPGKGLEWLVEYYSAGSNYYSPAIRGRFTASKGASDFYLQMNDLKAEDTAVYYCAR
Pogona vitticeps V113 ighv emb|CEMB01036246.1| 27139 ARSQVALTQEGPVVKKPGESHKLTCATSGFTLRSTNMYWIRQKPGKGLEWLVYYYSDEDNAYSPAIRGRFTASKGASDFYLQMNDLNAKDTAVYYCAA
Pogona vitticeps V115 ighv emb|CEMB01036246.1| 46652 IFASLQLLESGPGVVKPGGSLKLTCVVSGVDVGDYYWNWIRQPPGKGLEWLGDIQDSDDGGGTAYNPRFISRMSISRDIAKNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V116 ighv emb|CEMB01036246.1| 53915 LSSQLQLKESGPGTVRPGDNLELTCTVTGGSITSSYIWNWIRQTPGKGLEWMGYWVGSPSYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V117 ighv emb|CEMB01036246.1| 56108 LSSQLHLKESGPGMVRPGDTLELTCTVTGGSVTSSWYWHWIRQTPGKGLEWMGYWTGSTSYSPSFQNRITISVDSSQTKYFLRLTSVTASDTAMYYCAG
Pogona vitticeps V118 ighv emb|CEMB01036246.1| 59553 LSSQLQLKESGPGTVRPGDTLELTCTVTGGSVTSGYTWHWIRQTPGKGLEWMGWWSGSTRYSPSFQNRITISVDPSQTKYFLRLTSVTAADTATYYCAR
Pogona vitticeps V119 trav emb|CEMB01534111.1| 54 TLAESVTQPQRSLIIEEGSPIFINCTYKYGGYPRLFWYTQHLDDGSLQLLLQEHNTEADRRKKDGEFFATHNKGMTSFHLEKQASSVKDSAVYFCAFG
Pogona vitticeps V121 ighv emb|CEMB01005252.1| 55426 FSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYDSAFQSRVSITADASKNEYYLELRSLTAADTAVYYCARR
Pogona vitticeps V122 ighv emb|CEMB01005252.1| 51630 FSENRLTESGGGAWKPGASLRLTCVVSGYSITSGAGLNWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARG
Pogona vitticeps V123 ighv emb|CEMB01005252.1| 48986 SSEIRLTQSGGETWKPGATLRLTCAVSGYAISSGYYWHWIRQPPQKGLEWVGRGYYSGSTWYTSYGSAFQSRTSITTDASKNEFYLELRSLIAADTAVYYCARR
Pogona vitticeps V124 ighv emb|CEMB01005252.1| 42250 VQLEVQLLQSGGETKRPGESLRLSCRASGYPFGSHSAHWIRQAPRKALEWIAWIYDDGSRLSYADSVKGRFTISRDNSKNMLYLLMNSLRPDDTAMYYCAAE
Pogona vitticeps V125 ighv emb|CEMB01005252.1| 35499 FSEIRLTQSGGETWKPGATLRLTCAVSGYSMTSGYNWNWIRQPPQKGLEWIGRGYYSSSNWKTNYGSAFQSRISITADASKNEYYLELRSLTAADTAVYYCARG
Pogona vitticeps V126 ighv emb|CEMB01005252.1| 32550 YSEIRLTQSGGETWKPGTTLQLTCAVSGDTVTSGYSWNWIRQPPEKGLEWIGRIYYSSSKWYTNYGSAFQSRVSITADASKNKYSLELRSLTAADTAVYYCARE
Pogona vitticeps V127 ighv emb|CEMB01005252.1| 29191 FSEIRLTQSGEGTWKPGASFRLTCKVSGYTMTSGAEWDWFRQPSKKALEWLGTGRYIRSTWKPGYSSAFQSRISITADASKNEYYLQLRSLTAADTAVYYCAR
Pogona vitticeps V128 ighv emb|CEMB01005252.1| 14190 AHSQVVLTQEGPVVKKPGESHKLTCATSGFSLSGSGMHWIRQKPGKGLEWLVYYYSASHNNYSPSIRGRFTASKGASDFYLQMNDLNAEDTTVYYCAR
Pogona vitticeps V129 ighv emb|CEMB01005252.1| 10761 ARSQVVLTQEGPIVKKPGESHKLTCATSGFPLSSRTMHWIGQKTGQGLEWLVRYYSAGDNQYSPSIRGRFTASKSASDLYLQMSDLNAEDTAVYYCARE
Pogona vitticeps V130 ighv emb|CEMB01005252.1| 8588 AHSQVVLTQEGPVVKKPGESHKLTCATSGFTLSSTWMSWIRQKPGKGLEWLLEYKDSGSNNYIPEIRGRFTASKSATEFYLQMNDLKSEDTAVYYCARF
Pogona vitticeps V132 iglv emb|CEMB01005754.1| 5399469 SFGQYVLTQPPSASVPLGQNAQISCSGNNIGGKYVHWYQQKEGKAPVLIIYYDDSRPDGISDRFSGTNSGNTARLSIARAQAGDEAVYYCQVRDG
Pogona vitticeps V135 igkv emb|CEMB01006509.1| 4682 TSGQIVLTQSPKSLFLSVGDPATIKCQSDTDIDDDMNWYQQKPEQPPRLLFSEGNTRQKDVPARFSSSGYGEDFTLTISSVEAEDEGYYHCQQNDRVP
Pogona vitticeps V136 iglv emb|CEMB01007033.1| 4231 LSVQQLQPLKDRESVAAGGTVTLSCRYSGGTIGDGNYPWWVQMKPGSRPWTVMYTTSTRPSGIPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V137 trgv emb|CEMB01010246.1| 61880 VNPQTILQSAESVVQWLGSSTSLSCFLEGSSDPNLYWYQQMPGGWLEQLSYSISQGSATTTGPGHIKGKRLDKRTFHLEITSLRRNDTATYYCAWS
Pogona vitticeps V139 ighv emb|CEMB01016747.1| 6591 VFSGPQLIETGPGVVKPGGSFKLTCSVTGVQVSDYYWSWVRQPLEKRLEWLGFIRSTAQGGTTQLSPAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V140 ighv emb|CEMB01016747.1| 4078 TSSSPQLIQSGLGVVKPGGSLKLTCTVTGVQVSDYYWGWIRQLQGKTLEWLGYIRDTADGGTPYYNSAFSSRVTVSRDTSRNEVYLQMSSMAAADTGMYYCAR
Pogona vitticeps V142 iglv emb|CEMB01021247.1| 764 ANSQLSLTQPASQSVSPGQTTTLSCLKGSGSWGSTVYWLQQKAGQTPHFVHCNGCSSRGAGIPARFTSSASGNTGSLTITSAETGDEAVYYCYVWS
Pogona vitticeps V143 iglv emb|CEMB01023034.1| 35372 VDSQPTVTQPASQSVSPGQTTTLNCMKGSGSWSSYIGWVQQKPGQAPRFVHCDGCSRGPGIPDRFTASASGNSGSLTITNVEAGDEAVYYCIGWSTSPQM
Pogona vitticeps V144 iglv emb|CEMB01023034.1| 32018 ISSQGTVTQPASASASLGQTVKLSCTRSSGGRWYNFHWYQQKPGEAPRYVHREGESRGEGISNRFTASQLGESGYLTITNIQAGDEAAYYCCALH
Pogona vitticeps V145 ighv emb|CEMB01024165.1| 812 ISSQVTLTESGEGVKKPGETLQLTCTVSGFSLTDSNYAVAWIRQLSGKTLEWIVEIWGSGSTYYNSALRNRITITKETSKRQVILQLSGLKPEDTAVYYCAR
Pogona vitticeps V146 ighv emb|CEMB01024411.1| 1780 VLSSPQLTESGPGVVKPGESFKLTCSISGIQVSNNYWSWIRQPPGKGLEYLGYIQSTAGGGSSYYNSAFGSRIIISRDTSRNEVYLQLSSLTAADTATYYCAR
Pogona vitticeps V150 ighv emb|CEMB01025432.1| 5223 VVSQVVLTQEGPVLKKPGESHKLTCATSGFALSSYWMYWVRQKPGKGLEWLVSYYNTASGNSHYSPAIQGRFTASKGSSNFYLQMNNLKEEDTAVYYCAR
Pogona vitticeps V151 ighv emb|CEMB01025432.1| 2012 CRSEVQLVETGGGVVSPGGSLRLTCKASGFTFSDYSMHWVRQAAGKGLEWVAGISYDSAYQWYNSKVQGRFTISRDNAQSSVDLRMASLKPEDSAVYYCAR
Pogona vitticeps V152 trav emb|CEMB01026698.1| 13104 FTGLCRGVVVTQKEPFKIIWAGSQTSIDCEHNDNTYFTVLWYRQQSEQTDMQLIGSSVHGTDAKMEVLSYSIKRPSVTQASLLVPLGKPGDSAVYFCAVST
Pogona vitticeps V153 trbv emb|CEMB01026698.1| 5244 STECKIHQPRSLIVEKGKNVQLECRQLHQHDAMYWYQQAKGMELQLGYYSRTSLSGSEVKETTSNRFTAHRPEKERFQLNISSVEMKDSATYFCASS
Pogona vitticeps V154 trgv emb|CEMB01026698.1| 2163 SSNAEIKQPWSLVLEVGKPAWLECRQTFQHTSMLWYQQKAGKGLQFLYRFYNKREQEKGNVPNRFTADQPQADCSNLNISSVKQEDSAVYYCASSL
Pogona vitticeps V155 ighv emb|CEMB01026708.1| 25064 AQLEVVLVESGGDVKRPGDSLRLSCQASGFTFSSYRMSWIRQAPGKGLEWVAYIDRSSTPIYYSDAVKGRFTISRDNSNSWLYLQMNSLKSEDTAVYYCAG
Pogona vitticeps V156 ighv emb|CEMB01026708.1| 17600 AQSEVLLVESGGDVKRPGDSHQLSCQGSGFTFSSYDMNWIRQAPGKGLEWVAYISTSSGSIYYSDAVKGRFTISRDNSNSLLYLQMNRLKSEDTGVYYCAR
Pogona vitticeps V157 ighv emb|CEMB01026708.1| 14848 AQSEVVLVESGGDVKRPGDSHQLSCQGSGFTFSSYHMSWIRQAPGKGLEWVAFISTSSGSIYYSDGVKGRFTISRDNSNSLLYLQMNRLKSEDTAVYYCAR
Pogona vitticeps V158 ighv emb|CEMB01026708.1| 11664 AQSEILLVESGGDVKRPGDSIHLSCQASGFTFSSYGMSWIRHAPGKGLEWVAYIGTSSTPIYYSNTVVKGRFTISRDDSNSQLYLQMNSLKSEDTGVYYCART
Pogona vitticeps V159 ighv emb|CEMB01026708.1| 8088 AQSEILLVESGGDVKRPGDSLRLSCQGSGYTFSDYAMNWIRQAPGKGLEWVAYINYNSATIYYSNTIKGRFTISRDNSNSLLYLQMNSLKSEDTGVYYCAR
Pogona vitticeps V160 ighv emb|CEMB01026708.1| 6251 VLSEIQLVESGGDMKRPGESLRLSCRASGFTFSSYWMHWIRQASGKGLEWVANIRGDGNNYFYADAAKGRFTISRDNPSSTLYLQMNRLTTEDSGLYYCAK
Pogona vitticeps V161 ighv emb|CEMB01026708.1| 4351 SFSQVILTQSDPVAKKPGEAHKLACAVTGFDINSYYMAWIRQKPGKGMEWLVSYHRPGSTSYYSSEIQGQFTASKEGSNFYLQMNSLKAEDTAVYYCAR
Pogona vitticeps V162 ighv emb|CEMB01026708.1| 378 CHSEVQLVETGGGVVSPGESLRLSCKASGFTFSSYYMSWIRQAAGKGLEWVATITHTASSQWYNSKVQGRFTISRDNAQSLLSLQMTSLKTEDSAVYYCAR
Pogona vitticeps V163 trbv emb|CEMB01027004.1| 12966 CSTANISQQENLVLEEGKNASLACTQSFGHYGMFWYRQDKNKRLQLLFNFYHKNLQEKGEISERFKADQPQTDRSNLNITSVRREDSAVYFCASSL
Pogona vitticeps V164 trav emb|CEMB01027004.1| 2893 CSNAKISQPWSLLKKEGESIVLLCRQNDGHNVMAWYRQSAGQNLQLLYSFYLKNEQAKGSNISVRFTVERPDNTDFNLNISPAKPEDSAVYFCASSIDT
Pogona vitticeps V165 ighv emb|CEMB01027208.1| 2475 CLSAVQLVEMGGGVVSPGGSIHLSCKGSGFDFSSYNMVWIQQATGKGLEWVAEIRYNSEKVWYNPRFQGRFTISRDNPQSLLHLRMESLKPEDSAVYYCAR
Pogona vitticeps V167 trav emb|CEMB01030083.1| 23088 AQRWVVSQVFQPSQLTVVEGKKINISCYQNVTSHNTMSWYKQPLDGQGSLTILGSSYSGVTTAGDLEINVDPKLRSATLTKEAAALSDSRVYYCAVR
Pogona vitticeps V168 iglv emb|CEMB01030482.1| 6159 TNSQLTVSQPPSASVSLGNTMKLSCTVSMDGRAISWYQQKPGSAPRYLLYYYTESSKHQGSGVPSRFSGSKDSSGKIGYLTISGALAEDEAVYYCAAWDSNA
Pogona vitticeps V169 iglv emb|CEMB01033196.1| 1420 ANSQLTVTQPPLASVSLGNTTKLSCTISRNDRTISWYQQKPGNVPRYLLYYSSESSKGQGSGVPSHFSGSKDSSGSIGYMTISGALAEDEAIYYCAAGYNG
Pogona vitticeps V170 iglv emb|CEMB01035986.1| 36996 FGSQAALTQSGPVSVALGETATVSCTLQEVEFISTTSPSWYQVKTGEAPQLLIYKSRERDSRVPERFSGDTHGKTATLTIARVQAEDEGDYYCAVWFNDR
Pogona vitticeps V172 iglv emb|CEMB01035986.1| 8642 LSVQQLQTLKDTESVAAGGTVTLSCRYSGGTIGDGNYPWWAQKKPGSKPRTMIYTTSTRPSDVPARFSGSRSGNVMSLTITGAQGEDEAVYYCVVWTGS
Pogona vitticeps V173 iglv emb|CEMB01037069.1| 1065 ISSQGTVTQPASASASLGQTVKLSCTRSSGSWYKFHWYQQKSGGAPRYVHCDVCNRGEGIPDRFTASQSGDSGHLTITDVQAGDEAVYYCAAWDRDGGA
Pogona vitticeps V174 ighv emb|CEMB01037313.1| 233599 CHSEVQLVETGGGVVSPGSSLRLSCRGSGFDFSSYNMHWIRQATGKGLEWVAQISSPSGSSQWYNSKVQGRFTISRDNSQSSADLRMENLKPEDSALYYCAR
Pogona vitticeps V178 ighv emb|CEMB01037313.1| 163168 ASSDIQLVSSGPETVRPGETLDLVCKLTGFSITTQYWHWIRQAPGKGLQWVALMYPSSGRKWFASSFQSRATISSDASKNEVYLQLRSVTVDDSAVYYCVGE
Pogona vitticeps V180 ighv emb|CEMB01037313.1| 144342 VNSQVTLGQDPSVQLKPSETLRLTCSISGFSLTEYATAVSWIRQPFGKGLEWLSLVFWDDDKRYSSTLKNRLTISRDVSKSEVYLEFRGMGTGDSGTYYCARR
Pogona vitticeps V181 iglv emb|CEMB01037582.1| 1978 VTSQPTVTQPASQSVSPGQTTTIPCSKSSGSSWDSYLGWFQQKPGQTPRFVHCNGCNSREPGIPDRFTASASGNSGSLTITNVEAGDEAIYYCYAWSSSASA
Pogona vitticeps V182 trav emb|CEMB01535857.1| 432 GTQADSVSQIEDLVTVQEGEPVLLPCSHKISGAPILFWYEQSPNGAPQLLLSNYDNEDAETKERRRGFSAANKEKTFNLTKGAAELRDSVVYFCAVR
Pogona vitticeps V183 trav emb|CEMB01538122.1| 425 KVDGDSVTQREGLVTIQEGQLLSLPCEYQTSYTPTLFWYEQRSQGAPELLLASYDAQDLKTKKRMREFSAKVNRDEKSFHLTKGAAELRDSAVYFCALS