WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Phascolarctos cinereus MSTS00000000.1 (MSTS01) 191 39 10 60 48 24 4 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Phascolarctos cinereus V0 trbv MSTS01000001.1 10198409 VVGKNIEQPALLMVTEGASIKINCTYQTDGFNGLYWYQQREGGAPMYAYYRVLDGLEDHGGFVSFLSQANTRSYLLLNHSQMVNSASYLCAVI
Phascolarctos cinereus V1 trav MSTS01000001.1 10311751 ETRAQSVTQPEALITVSEGAPLEMKCIYSYTGFLYFSWYIQYTNQEPQLLLESNTGQSLVKGIKDFEVEFNKGKTSFHLKKLSAQGSDSAMYHCALS
Phascolarctos cinereus V3 trav MSTS01000001.1 10358358 VSSQKVEQSTLPVMVQEDERCSLNCSYTSSITNLHWYRQDPGKGLVFLMLIRSNEKERVSERFTARLDTTNKHSSLHLLACKPEDSATYFCAVD
Phascolarctos cinereus V4 trav MSTS01000001.1 10381824 ARGQDKLEQSPSTLRIQEGENIALNCSYSVGNFNGLLWYRQYPGEGPVLLFQMFSDGNEKNEGRTTASLDKTKSHSSLYIMASQPGDSATYFCAMT
Phascolarctos cinereus V5 trdv MSTS01000001.1 10391466 ISTAQKVTQEKSTMSGQEGKTVTLNCKYETSEPDYALFWYKQYPSGKIILLIRQDSYSQENMWKGRYSVNFQKTEKYINLTILASQLWDAAMYFCAFG
Phascolarctos cinereus V6 trav MSTS01000001.1 10398118 VSCQQKVEQTQFLSVQEGDSATLNCNYTDSAANYFLWYHQSPGKGPALRIASYSSSDVKEGRFTISINKGAKQFSLHISDSQLVDSGSYFCEVV
Phascolarctos cinereus V7 trav MSTS01000001.1 10416306 DSTAKEVIQPQPATSGQETEAVTLNCKYEISDRNYVLFWYKQPPGGGLIFLIRQESYKSLNARKDRYSVNFQKADKFINLAISALQLGDSAMYFCALYE
Phascolarctos cinereus V8 trav MSTS01000001.1 10439097 GARTQTVNQPEGQIAISERDSLELTCTASYTGSPRFYWYVQYPKQSLQMLLKYFSGNTLVRGSKGFEAEFNKNNKSFNLRKPSVEVSDAAVYFCAVY
Phascolarctos cinereus V9 trdv MSTS01000001.1 10467649 NSIGKKVTQLQSSMTGQEGEAVTLSCKYDTSETNYGLFWYKQLPSGEMIFLIRQNSYNQQNATEDRYLVNFQKVNKSITFTILASQLQDSAMYFCVFSV
Phascolarctos cinereus V10 trav MSTS01000001.1 10478249 GVSSQDEVKQSLLSLRVLAGESATLNCSYKVSDLRNLHWYRQYPGQGPRALFMLFSTWEEKWKGRLKASLDKKEAFSSLHINDTQSEDSATYFCAVE
Phascolarctos cinereus V11 trav MSTS01000001.1 10495244 GTNGDSITQTEGPIIVSEGESMTLNCTFRTTSFPFLFWYVQYPNKALHFLLKESKENEEKIRNDFWDKKNKEENSFPLKMNLIQMKDAAVYYCAMR
Phascolarctos cinereus V12 trav MSTS01000001.1 10508765 VSSKQMVEQSPQSLKVQEGESTAFNCSYSDSASRGLQWFKQDHGKDLTSLFYMTSEEKKRGRLRSTINRKERLSTLYIIASQPGDSGTYLCDVE
Phascolarctos cinereus V13 trav MSTS01000001.1 10530819 RAEAQSVTQPENQVSVSEGFPVELKCTYSSSGAAYLYWYVQYPNQELQVLLRHTSQESNKGFQANLNKDETSYHLKKLHVQEEDAAVYFCALS
Phascolarctos cinereus V14 trav MSTS01000001.1 10545593 RAEAQSVTQPEDQVSVSEGFSVELKCTYSSPVGAYLYWYVQYPNQELQVLLRHTSQESNKGFQANLNKDEASYHLKKLHVQEEDAAVYFCALG
Phascolarctos cinereus V15 trav MSTS01000001.1 10562275 TTEAQSVTQPENQVSVSEGSQVKLKCTYSYSGAVYLFWYVQYPNQELQVLLRHTSQESNKGFQANLNKNETSYHLRKFHVQEEDAAVYFCALS
Phascolarctos cinereus V16 trav MSTS01000001.1 10590325 ATEAQSVTQPEHQVSVSEGSPVKLKCTYSYSGSPFLLWYVQYPNQELQVLLRHTSQESNKGFQAKFNKDETSYHLRKLHVQEEDAAVYFCALG
Phascolarctos cinereus V17 trdv MSTS01000001.1 10609222 ISTAQKVTQLQPSMSGKEGEAVTLDCEYETPDNDYALFWYKQPSGRELILLIHQEAYNQMSAKVDQYSVNFQKSNKSISLTISALQLGDSATYFCAFRG
Phascolarctos cinereus V18 trav MSTS01000001.1 10620920 VTGQQLEQSPQFMSIQEGQNFTMSCNSSSTLNSLMWYRQQPGKQPVFLVILLKSKEVKSQEKFIAQFDEKRKQSFLLIKTSQPQDSATYLCAG
Phascolarctos cinereus V19 trav MSTS01000001.1 10638079 VNGQVQVEQNPLFQIIQEGKNGTIHCNYSSGSSNYFYWYKQVPGESLVNIFILFLSEAVKQDGRLTASFNTKDRHSTLHIQNSQPRDSATYFCAT
Phascolarctos cinereus V20 trav MSTS01000001.1 10651584 VNSKDSVEQSPRTLTIQEGANATFYCNYSSRSSHYLDWLKQDLRKSLVYLFTLTSNGEVKKNGRLAVTLNIEDQQSSLHITASQPEDSATYICA
Phascolarctos cinereus V21 trav MSTS01000001.1 10666667 ARFQNKVEQSPQILKVKAGKDSTLKCSYKVTPFNNIRWYKQRPGKGLVLLILVLYFEERKSNGRFKATLNVTAEESSLHITSSQSKDSATYFCVAG
Phascolarctos cinereus V22 trav MSTS01000001.1 10676001 GTRAQSVTQPEDQVTVSEGDQLELKCTYSYGATPSLFWYIQYPNQGLQLLLKYTSGNNLVKGIKGFEAEFNKSKPSFHLKKLSAQESDSAKYFCAVG
Phascolarctos cinereus V23 trav MSTS01000001.1 10700867 VTSQTKVKQSPQFLRVQERDTAVINCSYTDNTFDYFAWYWQAPGKGPTFLVAIRLSKNIQEEGRLTVHLNKDAKYFFLHIKESQPEDSGTYFCAAS
Phascolarctos cinereus V24 trav MSTS01000001.1 10710946 KIDGDSVTQTESHLTLSEGAPLKLDCIYKSPKIYSDFLAWYVQYPNGGLNLLRDTNKTEERHIHGFQVNHTKSEHSFHLKKAAVQMRDSGVYYCLLS
Phascolarctos cinereus V25 trav MSTS01000001.1 10746835 VSGQVVEQSPATLSLKVGESTTLNCTYTTSINSLQWYRHNPGTGPTVLFIMVLDGDEKQEGRLKATLSTKGRHSSLSISAAQTRDSATYFCAVE
Phascolarctos cinereus V26 trav MSTS01000001.1 10756077 VSTQQLNQSPQSISIQEGEDFITNCSSSTSLPILQWYRQDPGKGLTFLMALSKGKELKRQGKITAQLDEKRQHSFLFITGTQPGDSARYFCVY
Phascolarctos cinereus V27 trav MSTS01000001.1 10777793 GTYGDSVTQPEGHITLPEGARLTLDCSYQTSGAPYLFWYIQYPNEALKLLLKETSGKDQEKDNNGFWATKIKEKSFFHLEKTSVQMGDAAVYYCVLS
Phascolarctos cinereus V28 trav MSTS01000001.1 10781422 GTYGDSVTQTEGHITLFEGASLTLNCSYQTIRTPYLFWYIQYPSEALKVFLRETSGKDQEKDNNGFWTRKIKEESSFYLEKTSVQMGDSAVYYCVLS
Phascolarctos cinereus V29 trav MSTS01000001.1 10793212 GTYGDSVTQPEGHITLPEGALLTLNCSYQASVTPYLFWYVQYPNEAPKLLLRETSGKDQEKDNNGFWAKNIKEKSFFYLEKTSVQMGDSAVYYCALS
Phascolarctos cinereus V30 trav MSTS01000001.1 10816086 PGMAPSVTQTPPVISVQEGKTVTLNCTYSTGDTNYYLFWYKWLPGGEMIFLIRQDSYSQQNASEGRYSVNFQKARDSISLMISASQLGDSSVYFCALRE
Phascolarctos cinereus V31 trav MSTS01000001.1 10828233 AWGQIKVDQSPQVLNLQEGVNASLECNWSSSVNTLQWFKQNPGEGPVSLFVIASGVKQIGRFNSKMNLKDRHNSLHITDSQRGDSATYFCAVQ
Phascolarctos cinereus V32 trav MSTS01000001.1 10838985 VNVKGNVDQSPPTLTIQEGKSCTLHCNYSSQSLDRVYWYRQEVGKSLKFIFALYSNGAVKQEERLTATFNTSTLHSSLSIRGSQPEDSGTYLCAA
Phascolarctos cinereus V33 trav MSTS01000001.1 10866192 TRCDSKVTQPILQEVTEGQEVNLPCSHEDIATNMNVFWYRQFPNQGPQFLIQTYKTNVTNQMISLTISADRKSSTLSLPPVTLRDNAVYYCIEQS
Phascolarctos cinereus V34 trav MSTS01000001.1 10886445 VRGQVKVDQSPQVLSLQEGEDVTLRCNFSSTMTTLQWFKQKPEEGLIFLFFLTGETQKKGNLRATLNTKERQSSLYIRASQPRDSGTYLCAIQ
Phascolarctos cinereus V35 trav MSTS01000001.1 10888426 VSGQKKVEQIPQSPSLKEGENVTIKCNYSFTENSLQWFRQDPQEGIVSLFVLTTGVKKKGRLEASITSKERHSFLHITNSKPEDSGTYLCAVE
Phascolarctos cinereus V36 trav MSTS01000001.1 10911327 VSCLQKVEQSPQSLRVQEGENITINCNFTETPQGSQWFRQDAGKGLISLFYLASGMKEEGRLKSVINLQERYSSLYVKASQPGDSATYLCGVR
Phascolarctos cinereus V38 trav MSTS01000001.1 10937695 VSCQQKVEQRPQNLRVQEGENTAFNCSYSDSASTNLQWFRQDPGKGLTTLFFLASQGKQEGRLRSTINRKERHSSLHISAAQLGDSGTYLCAVQ
Phascolarctos cinereus V39 trav MSTS01000001.1 10950116 VSCLQKVEQSPQSLKIQEGESTIINCSYAEATGQGLQWFRKDPGKGLTSLLYINSEETQNGRLRSTISRTERQSSLHITGAQAEDSATYLCAVR
Phascolarctos cinereus V40 trav MSTS01000001.1 10954139 VSCLLKVEQSPQSVKIQEGESTTTNCSYTETISQELKWFRQDPQKGLTSLLYIVSEEKTNGRLSSLISRKEHYRSLHITDTQPEDSATYLCAFG
Phascolarctos cinereus V41 trav MSTS01000001.1 10959222 VSCQQRVEQNPPFLSVQEGENVTINCNYSDQSSQGVQWFRQDPGKGLTLLFYLASGMKEGGRFKSTLSRNDRHSSLHITASQPGDSATYLCAVE
Phascolarctos cinereus V42 trav MSTS01000001.1 10973536 VSCLQKVEQSPQSLKIQVGESTTINCSYTDTTNNGLRWLRQDPGKGLASLFYLTSEEKQNGRLGSTISRKDRQSSLHITGAQPEDSATYLCAVE
Phascolarctos cinereus V43 trav MSTS01000001.1 10977717 VSCQQRVDQNPPFLSVQEGENVTINCNYSDQSSQGVQWFRQDPGKGLTLLFYLASGAKEEGRFRSTLSRNDRHSSLHITASQPGDSATYLCAVQ
Phascolarctos cinereus V44 trav MSTS01000001.1 10981860 VSCLQKVEQNPQSLKIRDGGSATINCTYTDTTTDRLQWFRQDPGKGLISLVYLTAEEKQKGRLRSTISRKDHQSSLHITGAQPEDSATYLCAVE
Phascolarctos cinereus V45 trav MSTS01000001.1 10985141 VSCQQKVDQNPPFLSVQEGENITMNCSYPGIGSSSLQWFRQDPGKGLTLLFYLASGTKEGGRFKSVISSRDRHSSLHITASQPGDSATYLCAVQ
Phascolarctos cinereus V46 trav MSTS01000001.1 10989953 VNCLQKVEQSPQSLKIQVGGSATINCSYTETTNQALWWLRQDPEKGLTSLFYMNSEEEQKGRLKSTISRKERHSSLHITDAQPEDSATYLCAVE
Phascolarctos cinereus V47 trav MSTS01000001.1 10994369 VSCQQRVDQNPLFFTAREGQNITIHCTYSEEGSQNLHWFKQDPGKSLTSLFYVTTEEKQNGRLRSTISRKDRQSSLHITGAQAEDSATYLCAVG
Phascolarctos cinereus V48 trav MSTS01000001.1 10997660 VSCQQRVEQNPPFLSVQEGENITMNCTYSEQGSQGLQWFRQDPGKGLTLLFYLASGTKEGGRFKSVISSKDRHSSLHITASQPGDSATYLCAVQ
Phascolarctos cinereus V49 trav MSTS01000001.1 11002388 VSCLEKVEQSPQSLKIQEGGSATINCSWTDITNNELQWFRQDPGKGLILLLYITSEEKQNGRLRSTISRKERHSTLHITGAQAEDSATYLCAV
Phascolarctos cinereus V50 trav MSTS01000001.1 11007444 VSCLLKTEQSPQSLKIQEGENASINCSWTDATNNGLEWLRQDPGKGLTSLFFVNSEEKQNGRLRSTISRKDRHSSLHITDAQPEDSATYLCAVE
Phascolarctos cinereus V51 trav MSTS01000001.1 11017037 VSCQQKVTQTPPSLSVQEEKSITINCTYSDSNAKNFQWYRQDPGQGLTLLFYMTSGNKQRGRFGSTSNMKESHSSLHITGSQLGDSATYLCAVD
Phascolarctos cinereus V52 trav MSTS01000001.1 11056185 HLCSAKFTQSSDKVAKEGSDLELQCQHNIPAGNYDSVYWYLQKTNQKLTYVHHGFQDITEAGHYQINVDRKKCCSKLIIRNVHLSDVAVYYCALQ
Phascolarctos cinereus V53 trdv MSTS01000001.1 11070091 VISDIQLEQPDRTLSVHVGMAITLQCTLKGGDLNSHQMIWYKKNRDNSLTLIYQHENKYGLSFQGNFLGSIDSNNFFTLKIVKAAVKDTGTYYCGSV
Phascolarctos cinereus V54 trdv MSTS01000001.1 11092391 VMPEIVLEQQEKVVTVLIGGISTLKCSMTGGHMHSYYMYWYRKNQDNTLTFICDENFCDMENFQSEIDSANNKFTLKIIKPSVRDNGIYYCAA
Phascolarctos cinereus V55 ighv MSTS01000001.1 11105739 SAPGIGGDVRRAGETLQISCKANGFNIGETWIYWYRDTLQEAPTFICYIQPGSGVSYSETVKGRFLTFINDTTNSGYLQMNNLTLEDTAVYYCAR
Phascolarctos cinereus V79 trbv MSTS01000071.1 7207839 LLDAGVILTPTLLIIEKGQNAVFRCNPIKGHSYVFWYCQFLGEELKFLIDLQNDQKVDDSGMPKSRFSALPEESLIFRIEIQPKELMDSAVYFCASSV
Phascolarctos cinereus V80 trbv MSTS01000071.1 7210161 SMDAGVTQIPKLLVKEKGQKATLRCKQNLNHDYMYWYRQDDKGFQAMFSWNNNELFENFTNSNHFRPKRLDKAQLNLQIETLQPVDTAVYFCASSY
Phascolarctos cinereus V81 trbv MSTS01000071.1 7220534 LMDSGVTQTPRYIVKGREQKMVLKCDLIKGHHYNNWYQKLLEEELKFFLSLHDNKVMESLGLSQNRFLVEWPSNSPCSLTIELTEKGGSAMYFCATSK
Phascolarctos cinereus V82 trbv MSTS01000071.1 7223483 PMDAGVTQIPRLLIKVKGQKGILRCKQDLGHDAMLWYRQDTNHELRMMFYYNYQELVTNETLSNRFEVEPLKTQLNLQIQPLQPEDTATYLCASR
Phascolarctos cinereus V83 trbv MSTS01000071.1 7235054 GQLDDRVIQHPSYLVSRTGQSVILGCDPIFGHDGAFWYRQILSKSPEMLFYFYFKKESDKGEIPNRFKAEQDNNLYFTLNISSLEQGDSALYLCASSK
Phascolarctos cinereus V89 trbv MSTS01000071.1 7292301 GQLDDRVIQHPRYLVSRTEQSVILECDPISGHVSAVWYRQILGQGPEMLFSFYNKGERDKGEIPNRFSATQDDNFYFTLNISSLEQGDSALYLCASSK
Phascolarctos cinereus V90 trbv MSTS01000071.1 7307275 GQLDDRVIQHPSCLVSMTGQSVTLGCDPISGHLGAFWYRQILGEVPEMLFSFYNKGNPEEGKISSRFKAKQENNFHLTLTIGSLEQEDSAVYLCASSK
Phascolarctos cinereus V91 trbv MSTS01000071.1 7311843 GQMDTRVTQHPSYLITRTGQSVTLGCDPISGHPDALWYRQIQGQGLDMLFYFNFKQLIEKGKISERFTAKQYENFYFNLNISSLEQGDSALYLCASSE
Phascolarctos cinereus V92 trbv MSTS01000071.1 7323713 PLDAGVTQTPHLITRTRQNTNLRCKQNLGHNTLYWYQQDSKMGLRIMFSFNNKNLIENATISNRFKPNSSDNSLLDLHIESLQSEDTATYLCASSV
Phascolarctos cinereus V93 trbv MSTS01000071.1 7372564 LTDGIVLQTPRYLVTDTGQAVALRCDQDKNYDYMYWYQQKPGQEPKQLLYYFKLSDMKKEEGISYNFQANRTNINLCYLSISSLSLGDSAIYLCAIS
Phascolarctos cinereus V94 trbv MSTS01000071.1 7377503 FTDAGVIQVPKQLITETRRTVTLTCHPISTHVSLYWYRQNKGERIESLVYFQNNRPLDDTGLPKDRFSAEWPEKSPSTLKIQTTELRDSAFYLCASSP
Phascolarctos cinereus V95 trbv MSTS01000071.1 7379846 SGLGALISQQPSRAIWKKGSSALIHCHQIDSQLTFMYWYRQLPQQSLVLMATANQGTPSNYEEGFNKDKFPISRPDTKSSTLEVIDLGPKDSGIYFCSAS
Phascolarctos cinereus V97 trbv MSTS01000071.1 7425956 CMHAKLTQIPRHLIIGKGQAVTMTCDQDTQDTGMFWYQQTPEKVDLVLVLYSVGKGDISDGDDPQGFQAKRPDIKVFTLSKPSAEPSDSGMYFCSS
Phascolarctos cinereus V98 trbv MSTS01000071.1 7444975 PMDAKDARITQSPRHIVTRMGQEVTLKCEQNLGHNAMYWYRQDLGQGLQLIYYSPLKDDIQKGDIPEGYNVTREKMELFHLILQSSRINQTSLYLCASSK
Phascolarctos cinereus V99 trbv MSTS01000071.1 7451195 SMDTKDARIIQTPRNLITGIGQNVTLNCEQNLGHESMYWYRQDQGQGLQLIYFSRTKDSTEKGDISEGYDVSRIKETFALIIQSSRTKQTSFYFCASS
Phascolarctos cinereus V101 trbv MSTS01000071.1 7474368 SAEAEITQTPRFLVTRVKQEVTLRCQQHLGHNNMYWYQQEPHKGHKLMFYFTYQKINSNESLPQRFKSDSPSKDQLTLHIHGVETEDSSTYFCSSSK
Phascolarctos cinereus V102 trbv MSTS01000071.1 7481942 PMDAKDARITQSPRHIVTRMGQEVTLKCEQNLGHNAMYWYRQDLGQGLQLIYYSAIKDDIQKGDIPEGYKVTREEKEFFPLTLQSSRINQTSLYLCASSK
Phascolarctos cinereus V103 trbv MSTS01000071.1 7488290 SMDTKDARIIQTPRNLITGIGQNVTLNCEQNLGHESMYWYRQDQGQGLQLIYFSRTKDSTEKGDISEGYDVSRIKETFALIIQSSRTKQTSFYLCASS
Phascolarctos cinereus V104 trbv MSTS01000071.1 7500173 PMDAGVTQNFRYVLTATGREVTLRCDQDLGHDSMYWYRQDPGLGLQLLSYSRYVGSTETEVPHGYNASRNEKPFFLLTLKPTNTNQTSGYFCASSE
Phascolarctos cinereus V105 trbv MSTS01000071.1 7503241 PMDAGVTQNFRYVLTATGREVTLRCDQDLGHDYMYWLREDQGSGLQLISYSRDVGFTETEVPHGYNASRNEKSFFLLTLKPTNTNQTSGYFCASSE
Phascolarctos cinereus V106 trbv MSTS01000071.1 7507221 PMDAGVTENFRYLITATGCEVTLRCDQDLDYESMYWYRQDPGLGLQLISFSLNVGFIETEVPYGYNASRNEKSFFLLTLKPTNTNQTSGYFCASSK
Phascolarctos cinereus V107 trbv MSTS01000071.1 7522493 PMDAGITQNLRYLVIGIGRKVTLRCDQDLGHNYMYWYRKDPGLGLRLIHYSTNVNLIDKGELSDGYNASRTEKPFFLLILESTNKNQTSEYFCASSL
Phascolarctos cinereus V108 trbv MSTS01000071.1 7526319 LMNARVTQTPKYLITRTGQKAILQCEPMPTYDVLYWYRKKAGQRLQFLYDFRDNKIVESKVDKSRFTAKWTNYSSCILNIAFTEVEDLAVYLCASRK
Phascolarctos cinereus V122 igkv MSTS01000366.1 717620 ANGQIVITQSPTSLSVTPGDTVTISCTASQDISKYLKWHQQKPGQSPKGLIYYTSSLQSGVPSRFSGSGSGTDYTLTISGVETEDAGVYYCQHYKSYP
Phascolarctos cinereus V123 igkv MSTS01000366.1 734932 ANGEIVMTQSPTSLSVTPGDTVTISCTASQDISKYLDWYQQKPGQSPKLLIYYTSTLYSGVSSRFSGSGSGTHYTLTISGVETEDAGVYYCQQYKNWF
Phascolarctos cinereus V124 igkv MSTS01000366.1 918176 SHRADCNDSDSSFPSASPGEKVTTSCRAHQGASNNSAWCQQTPGQSPKPLICAADILPSGIPAWFSGSGSGTDYSIIISTVEAEDARLYYCQHRYS
Phascolarctos cinereus V125 igkv MSTS01000366.1 939830 ASGQIVLTQSPASLSVSAGERVTMSCRASQGISTNLHWDLQKPGQAPRLLIEYASILHDGVPSHVSGRGSGTDFSLTISGLKPEDVAYYYCQQNSKWP
Phascolarctos cinereus V126 igkv MSTS01000372.1 11451 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSKYMSWYQQKPGQSPRLLIYAASTLHSGVPDRFSGSGSGTDFTLTISAVEAEDVADYYCLRVIIMH
Phascolarctos cinereus V127 iglv MSTS01000372.1 24189 SQAAIVLTKAPASLCVAAEHQVTNNCKASSDISKAMQWYQQEPGQSPNLLIYTFSILQSGVPARFSGSCSGRDYTFTINAVEAEDVADYYCSQYDNAPF
Phascolarctos cinereus V128 igkv MSTS01000372.1 29661 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSKYLSWYQQKPGQSPRLLIYAASTLHSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFAL
Phascolarctos cinereus V129 igkv MSTS01000372.1 35073 SQAAIELTQSPASLSVAAGDQVTISCKASTNIYKNMAWYQQKPGQSPRLLIYYASTLNSGVPARFSGSGSGTDYTLTISAVEAEDVADYYCFAYYSATV
Phascolarctos cinereus V130 igkv MSTS01000372.1 83772 SQAAIELTQSPASLSVAPGDQVTISCKASSSISKWMAWYQQKPGQSPKLLIYDASTLYSGVSARFSGSGSGTDFTLTISAVEAEDVADYYCFSVL
Phascolarctos cinereus V131 igkv MSTS01000372.1 88902 SQAAIELTQSPASLSVAAGDQVTISCKASSSVSKYMAWLQQKPGQSPKLLIYAASTLESGVPARFSGSGSGTDFTLTISAVEAEDVADYYCAHYSNYVF
Phascolarctos cinereus V132 igkv MSTS01000372.1 94390 SQAAIEVTQSPASLSVAAGDQVTISCKASSSVSKYMSWYQQKPGQSPKLLIYYASTLESGVPARFSGSGSGTDFTLTISAVEAEDVADYYCFQFIVLH
Phascolarctos cinereus V133 igkv MSTS01000372.1 99780 SQAAIELTQSPASLSVAAGDQVTISCKASSSVSKYMAWFQQKSGQAPKLLIYAASTLQSGVPARFSGSGSGTDFTLTISAVEAEDVADYYCFQYYSTAF
Phascolarctos cinereus V134 igkv MSTS01000372.1 874334 EPQELILTQSPASLSVALGEGVTINCKASQSLLHSNGYTYLHWYQQKPGQAVKLLIYRVSSLFSGIPSPFSGSGSGTNFTLTISRLEPEDLAIYYCMVG
Phascolarctos cinereus V135 igkv MSTS01000372.1 957908 IVLTQSPASLSKSPGERVTISCKASENVVSGGDDDYSVDYLLHWYQQKPGQAPRLLIYLATSLASGVPARFSGSGSGTDFTLTISSLEPEDAGDYYCQQSISSPF
Phascolarctos cinereus V136 igkv MSTS01000372.1 1034022 SSAAIVLTQSPASLPMTVGERVTINCRASKDIGNWLTWYQQPPGKAPKPLIYAATYLVPGVPARFSGSGSGTDFTLTISSVEAEDIGHYHCQHYYEYPN
Phascolarctos cinereus V137 igkv MSTS01000372.1 1037243 GEIVLTQSPASVSVIPGERVTINCKASESVKHSNGNTHLTWFQQKPGQSVQRLMYKVSNLHSGVPARFSGSGAEKDFTLTITSVEPEDGANYYCFQGTSQP
Phascolarctos cinereus V138 igkv MSTS01000372.1 1047163 SYGAVVLTQSPASLSASPGDRVTMNCKASESITYSDGDDLLYWYQQKPGQAPRLLIYWATNLASGVPARFSGSRSGTDFTLTISNMEAEDAAVYYCQQSYSYP
Phascolarctos cinereus V139 igkv MSTS01000372.1 1062034 SRGEIVLTQSPASVSVTPGERVTISCKASQSVQHSNGYTYLHWLQQKPGQSPRLLIYEVSKLHSGVPARFSGSGAEKDFTLTISSVEPEDVADYYCVQGTSYP
Phascolarctos cinereus V140 igkv MSTS01000372.1 1070216 SRKVNVLTSSPALVSTTPEERITISCKASQSIKHCNAYTYLNWLQQKPGQSPLRPIYRISNLDSGVPSWFSGSGAGKDFTITISSVEPEDGADYYCFQHSLDP
Phascolarctos cinereus V141 igkv MSTS01000372.1 1089587 SRGEIVLTQSPASVSVTTGETVTISCQASQSVTQSDGNTYLNWLQHKPGQSPRRLIYQVSNLDSGVPARFSGSGAEKDFTLTISSVEPEDVADYYCAQSTSS
Phascolarctos cinereus V142 igkv MSTS01000372.1 1098435 SRGEIVLTQSAASVSVTPGERVTISCKASESIKHSNGNTYLYWIQQKPGQSPRGLIYQVSKLISGVPARFSGSGAEKDFTLTISSVEPEDVADYYCAQATSSP
Phascolarctos cinereus V143 igkv MSTS01000372.1 1120763 SRGEIVLTQSPASVSVTPGERVTISCKASESIKHSNGNTYLYWIQHKPGQSPRLLIYEVSKLHSGVPARFSGSGAEKDFTLTISSVEPEDVADYYCAQATSSP
Phascolarctos cinereus V145 igkv MSTS01000419.1 29128 AQGAIELTQSPASLSVSPGEKVTMSCTASQSIGTNLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQYDYNYL
Phascolarctos cinereus V146 igkv MSTS01000436.1 39491 ARGAIELTQSPASLSVSPGETVTMSCTASQGISNYLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQQSSSSP
Phascolarctos cinereus V147 ighv MSTS01000448.1 230888 VHCDVELVESGGDVIQPGGSLSLSCKGTAFTFSSYYMHWVCQASGKGLEWVASIHTTSSTYYADSVKGRFTISRDNGNSMSYLQMTSVETEDTAVYYCTI
Phascolarctos cinereus V148 ighv MSTS01000448.1 242249 IQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYGMHWVHQASGKGLDWVAYISTRSSTYYADSVKGRFTISRDNGNSMSYLQMTSLQTEDTAVYYCA
Phascolarctos cinereus V149 ighv MSTS01000500.1 97454 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYYMHWVCQATGMGLERVARISTGGSTYYADSGKDRFTISRDNGNRMLYLQMTSLQTEDTAVYYCT
Phascolarctos cinereus V150 ighv MSTS01000505.1 69914 VQCDVELVESGGDVIQPGGSLTLSCKGSGFTFSSYNMHWVRQASGKGLEWVARISTSGSTSYADSVKGRFTISRDNGNSMSYLQMTSVETEDTAVYYCA
Phascolarctos cinereus V153 ighv MSTS01000563.1 16271 VQCDVQLVESGGDVIQPGGSLSLSCKGSGFTFSSYDMSWVRQASGKGLEWVAYISSSSSYKYYADSVKGRFTISRDNGNSILYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V154 ighv MSTS01000563.1 44686 VQCDVELVESGGDVIQPGGSLTLSCKASGFTFSNYEMSWVRQASGKGLEWVAYISSGSSTYYADSVKGRFTISRDNGNSILYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V155 ighv MSTS01000563.1 55075 VHCEVHLVESEGGVRQPGGSLSLSCKPSGFTFSIYYISWVLQAPGKGLEWHASIYSNVGKTFYADSVKGRFTISLNYSNDVLHLQMNSLKAEDTAMYYCAR
Phascolarctos cinereus V156 ighv MSTS01000570.1 23232 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYRMSWVRQASGKGLEWVASISGSSGSTYYADSVKGRFTISRDNGNSILYLQMISLETEDTAVYYCAR
Phascolarctos cinereus V157 igkv MSTS01000576.1 6863 SQAAIELTQSPASLSVAAGDQVTISCKASSSVSKYMAWYQQKPGQSPRLLIYYASTLQSGVPDRFSGSGSGTDFTFTISAVEAEDVADYYCFQYNSYPF
Phascolarctos cinereus V158 igkv MSTS01000576.1 17797 SQAAIELTQSPAFLSVAAGDQVTISCKASSSVSKWMAWYQQKPGQSPRLLIYYAFPLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFQYNSYPF
Phascolarctos cinereus V159 igkv MSTS01000576.1 24991 SQAAIELTQSPASLSVAAGDQVTISCKASSSVSNSMAWYQQKPGQSPRLLIYAASTLQSGVPDRFSGSGSGTDFTFTISAVEAEDVADYYCLRVIIMH
Phascolarctos cinereus V160 igkv MSTS01000576.1 49728 SQAAIELTQSPASLSVAAGDQVTISCKTSSSVSSYMSWYQQKPGQSPKLLIYAASTLYSGIPARFSGSGSGTDFTLTISAVEAEDVADYYCYGYYSTAF
Phascolarctos cinereus V161 igkv MSTS01000576.1 57649 SQAAIELTQSPASLSVAAGDQVTISCKASSSISKYLSWYQQKPGQSPRLLIYHASTLQSGVPDRFSGSGSGRDFTLTISAVEAEDMAGYYCFADYNYAF
Phascolarctos cinereus V162 igkv MSTS01000700.1 18976 ASGQIVLTQSPASLSVSAGERVTMSCRASQGISTNLHWDLQKPGQAPRLLIEYASILHDGVPSHVSGRGSGTDFSLTISGLKPEDVAYYYCQQNSKWP
Phascolarctos cinereus V163 igkv MSTS01000700.1 30804 AISQIVLTQSPASLVVSPGERISITCKASQSLVESQANYLNWYQQKASQAPRLLINYASNLMAGVPARFRGSGSGTDFSLTISSVEPEDAAVYYCQQSRVSA
Phascolarctos cinereus V164 ighv MSTS01000709.1 18270 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYVMHWVCQASGKGLEWVASISSSTYYADSVKGRFTISRDNGNSMLYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V165 ighv MSTS01000799.1 2542 VQCDVELVESGGDVIQPGESLTLSCKGSGFTFSSYNMHWVRQASGKGLEWVARISTSGSTSYADSVKGRFTISRDNGNSMSYLQMTSVETEDTAVYYCA
Phascolarctos cinereus V166 ighv MSTS01000799.1 14279 VHCEVHLVESEGGVRQPGGSLSLSCKPSGFTFSIYYISWVRQAPGKGLEWHASIYSNVGKTFYADSVKGRFTISLNYSNDVLHLQMNSLKAEDTAMYYCAR
Phascolarctos cinereus V167 ighv MSTS01000871.1 14211 VHCEVHLVESEGGVRQPGGSLPLSCKPSGFTFSIYYISWVRQAPGKGLEWHASIYSNVGKTFYADSVKGRFTISLNYSNDVLHLQMNSLKAEDTAMYYCAR
Phascolarctos cinereus V168 ighv MSTS01000926.1 22810 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYDMSWVRQASGKGLEWVATIYTSSNAYYADSVKGRFTISRDNGNSMLYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V169 igkv MSTS01000974.1 7276 ARGAIGLIQSPASLSVSPGEKATMSCTASQGISNDLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQYGYNYL
Phascolarctos cinereus V170 ighv MSTS01001381.1 873 VQCDVQLVESGGDVIQPGGSLQLSCKGSGFTFSSYRMNWVRQASGRGLEWIARISTGGSTYYADSVKDRFTISRDDGNSMLYLQMTSLKTEDAAVYYCAR
Phascolarctos cinereus V171 igkv MSTS01001714.1 428 ARGAIELTQSPASLSVSPGEKATMSCTASQGISNDLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCQYGYYNL
Phascolarctos cinereus V176 trdv MSTS01000001.1 11177024 KSIKCNKVTQSSRYQEVVSGSKVILFCRYKASFSDPYLYWYRTRSDSSIQSILHGSRYLNTHLAKGRFSVQHNDAQKIFHLVISEVGPEDAAFYYCAL
Phascolarctos cinereus V193 trav MSTS01000071.1 7604825 AGVGAQKIHQWPATKLQVEGSRLSLECSAEGMSDPYLYWYHQPLGGVLQLLSYSIGLNHVEDSMPRRFSGSRSQSHFQLISQKILITDSGFYFCAWS
Phascolarctos cinereus V202 igkv MSTS01000147.1 155447 SQAAIVLTQSPASLSVALGDKVTISCKASSSVSKWMAWYQQKPGQSPKLLIYDASNLQSGVPARFSGSGSGTDFTLTISAVEAEDVADYYCFQYYSDPF
Phascolarctos cinereus V203 igkv MSTS01000147.1 137084 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSSRMSWYQQKPGQSPRLLIYRASTLQSGVPDRFSGSGSGTDFTFTISAVEAEDVADYYCSQYYSDAS
Phascolarctos cinereus V204 igkv MSTS01000147.1 131589 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSSRMSWYQQKPGQSPRLLIYRASTLYSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCSQYYSDAS
Phascolarctos cinereus V205 igkv MSTS01000147.1 124562 SQAAIELTQSPASLSVAPGDQVTISCKASSSVSKYMAWFQQKPGQSPKLLIYSASTLQSGVPDRFSGSGSGTDFTLTISAVEAEDVADYYCAHYSNYVF
Phascolarctos cinereus V206 igkv MSTS01000147.1 113556 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSNRMSWYQQKPGQSPRLLIYSASTLQSGVPARFSGSGSGTDFTLTISAVEAEDVADYYCFAGYNYAS
Phascolarctos cinereus V207 igkv MSTS01000147.1 98123 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSKYMSWYQQKPGQSPNLLIYDASTLQSGVPARFSGSGSGTDFTLTISAVEAEDVADYYCFADYSYTF
Phascolarctos cinereus V208 igkv MSTS01000147.1 82813 SQAAIELTQSPASLSVAAGDQVTISCKASSSISKYMAWYQQKPGQSPRLLIYYASTLQSGVPDRFSGSGSGTDFTFTISAVEAEDVADYYCSQHYTDPF
Phascolarctos cinereus V209 igkv MSTS01000147.1 23838 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSNYMSWYQQKPGQSPRLLIYRASTCSLGSLTRFSGSGSGTDFTFTISAVEAEDVADYYCSAGYNYAF
Phascolarctos cinereus V210 igkv MSTS01000147.1 11271 SQAAIEVTQSPASLSVAAGDQVTISCKTSSSVSKWMAWFQHKPGQSPRLLIYAASTLYSGIPDRFSGSGSGTDFTLTISAVEAEDVADYYCFQSYSTPF
Phascolarctos cinereus V213 trgv MSTS01000153.1 554368 GQTAMILEQRVISMIRNVGGSAILICEIFSPTFDNIHWYHYQEGRAPERLLRYSMKKSESVLDPGFSPDKIRAYKGKDNSCRLILSNLQMSDSGMYHCASWDG
Phascolarctos cinereus V214 trgv MSTS01000153.1 527828 LELKQPQVSLTKDLSTTARVTCQVSSSQTFESKYIHWYQQKPSQPLQHLLSVQSTSIPSQKSLHEIQKKFVAEKNKDKGTSILTISSITREDEATYYCACWE
Phascolarctos cinereus V215 trgv MSTS01000153.1 522206 ASMEPIVTQLIPSNTKRSGSTAFFVCRVNVTSFGHTYIHWYHQKPGGHLERILYLSSNDNVVHEDGVSEERYEAKKRESDFSASLRIHQVTEADGGLYYCACWD
Phascolarctos cinereus V216 trgv MSTS01000153.1 514183 LELKQPQVSLTKDLSTTARVTCQVSSSQTFESKYIHWYQQKPSQPLQHLLSVQSTSIPSQKSLHEIRKKFVAEKNKDKGTSILTISSITREDEVTYYCACWE
Phascolarctos cinereus V227 iglv MSTS01000354.1 196491 SRASNVLTQPPSVSKSLGETAFISCAGVGSSSYSVDWYQQKPGQAPKLVIYSNNNRPSGIPDRFSGSRSGNTATLSISGLQAEDEADYYCEQWDNNAK
Phascolarctos cinereus V228 iglv MSTS01000354.1 181604 SRASNVLTQPLSVSKSLGETAFISCAGVGSSSYSVDWYQQKPGQAPKLVIYSNNNRPSGIPDRFSGSSSGNTAILSISGLQAEDEADYYCQHWDNNAK
Phascolarctos cinereus V229 iglv MSTS01000354.1 172649 SGASYVLTQPPSVSKRLGETASISCAGDGIGSKYVHWYQQKPGQAPKLMIYRDSNRPSGIPDRFSGSNSGNKATLSISGLQAEDEADYYCQVWDDNAK
Phascolarctos cinereus V230 iglv MSTS01000354.1 161772 SGASYVLTQPPSVSKSLGETASISCTGDGISSYYVQWFQQKPGQAPVEVIYYTSSRPSGIPDRFSGSSSENTATLSISGLQAEDEADYYCQVWHGNAK
Phascolarctos cinereus V231 iglv MSTS01000354.1 144818 SGASYVLTQPPSVSKSLGETASISCAGDGIRRYTVHWYQHKPGQAPKLVIYSNSNRPSGIPDRFSGSKSGNKATLSISRLQAEDEADYYCQLWDYNAE
Phascolarctos cinereus V232 iglv MSTS01000354.1 134059 SGASYVLTQPPSVSKSLGETASISCTGDGISSYYVQWFQQKPGQAPVEVIYYTSSRPSGIPDRFSGSSSENTATLSISGLQAEDEADYYCQVWHGNTK
Phascolarctos cinereus V233 iglv MSTS01000354.1 125125 SRASNVLTQPPSVSKSLGETAFISCAGVGSSSYALNWYQQKPGQAPQLVIYSNNNRPSGIPDRFSGSNSGNTATLSISGLQAEDEADYYCQHWDNNAK
Phascolarctos cinereus V234 iglv MSTS01000354.1 116203 SWASFVLTQPPSVSKSLGETASISCARDGISSYYVHWFQQKPGQAPKLVIYEDSSRPSGIPDRFSGSSSGNTATLSISELQTEDEADYYCQQWDGNAN
Phascolarctos cinereus V235 iglv MSTS01000354.1 76364 SGASNVLTQPPSVSKGLGETASISCTGDVISNGYVQWYQQKAGQTPKLVIYNTSNRPSGIPDRFSGSSSGNTATLSISGLQAEDEADYYCQDWDGSAN
Phascolarctos cinereus V237 ighv MSTS01000394.1 720374 VHCEVQLVESGGDVRQPGGSLSLSCKGSGFTFSSNGMDWVRQAPGKGLEWLAYINAKGETTYYGDSVKGRFTISRDNSNSMLHLQMNSLKTEDTGIYYCAR
Phascolarctos cinereus V238 ighv MSTS01000394.1 627843 IHCDVQLVESGGDVTQPGGSLSLSCKASGFTFSSYGMHWVRQPPGKGLEWVAVIYYDGSNTYYADSVKGRFTISRDNSNSMLYLQMNSLKAEDTGLYYCVR
Phascolarctos cinereus V239 ighv MSTS01000394.1 532007 IQCDVQLVESGGDVTQPGGSLSLSCKTSGFTFSNDYMHWLRQAPGKGLEWVAQIIASGTTYYADSIKGRFTISRDNGNSMLYLQMTSLKTEDTAVYYCA
Phascolarctos cinereus V240 ighv MSTS01000394.1 494161 VQCDVQLVESGGNVRQPRGSLHLSCKASAFTFINYCIDWVRQAPGKGLEWVAQISASGNIYYADSGKGRFTISRGDSSSMLYLQMTSLKTKDTAVYYCTR
Phascolarctos cinereus V241 ighv MSTS01000394.1 479467 VHCDVQLVESGGGVRETGGSLSLSCKASGFTFSSYGMTWVGQSPGKGLEWLAYIYSNGGTTYYADSVKGRFTISRDNSNSMLHLKMNSLKAEDTATYYCAN
Phascolarctos cinereus V242 ighv MSTS01000394.1 432993 VQCDVQLVESGGDVRQPGGSLQLSCKVSGFTFSDYYMDWVRQAPGKGLEWVAGISDSGDTYYADSVKGRFTISRDDGNSMLYLQITSLKTEDTAVYYCTR
Phascolarctos cinereus V243 ighv MSTS01000394.1 381125 VQCDVQLVESGGDVRQPGGSLQLSCKVSGFTFSDYDMDWVRQAPGKGLEWVAEITYTGSIYYADSMKGRFTISRDNGNSMLYLQMTSLKTEDTAVYYCTR
Phascolarctos cinereus V244 ighv MSTS01000394.1 341561 VHCDVQLVESGGDVRQPGESLSLSCKASGFTFSSYSMNWVRQAPGKGLEWVAVISSNGGTTYYADSVKGRFTISRDNSNSVLHLQMNSLKAEDTALYYCAR
Phascolarctos cinereus V245 ighv MSTS01000394.1 269933 IHCAVQLVESGGDVRQPGGSLSLSCKCSGFSFSSYAMHWVHQAPGKGLEWVAGISANRGSTYYADSVKGRFTISRDNSNSMLNLQMNSLKVEDTALYYCAS
Phascolarctos cinereus V246 ighv MSTS01000394.1 141973 VHCDVQLVESGGDVRQPGGSLSLSCKASGFTISSYGMNWVRQAPGKGLEWLAYIYSSGGNTYYADSVKGRFTISTDSSNNMLHLQMNSLKAEDTAVYYCAR
Phascolarctos cinereus V247 ighv MSTS01000394.1 26567 VLSDLQLEESGPGIAKPSESLTLTCSVTVALTSSYYWHWIRQSPGKGLVWIGCWSGGTYYNPVFQNRVSITADTSKNQFSLQLKSLTAEDTAVYYCAR
Phascolarctos cinereus V249 igkv MSTS01000436.1 89179 SHRQVSVTQSLAFLSGSPGEKITITCKTSKSIIESQGTSSMPWYQQKPGQVPRLLIYHASTVAPGVPAWFSGTGSGTDFTFIISSVEAEDAADYYCQQGYNIPY
Phascolarctos cinereus V250 igkv MSTS01000436.1 42064 ARGAIGLIQSPASLSVSPGERVTMSCTASQSISNELHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQQSYSWP
Phascolarctos cinereus V251 igkv MSTS01000436.1 34398 ALGAIELTQSPASLSVSTGETVTMSCTASQGISNDLHWYQQKPGQAPRLLIRDASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCHQSYS
Phascolarctos cinereus V252 igkv MSTS01000436.1 28927 AQGAIELTQSPASLSVSTGERVTMSCTASQGISNYLHWYQQKPGQAPRLLIRGASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCQHNYNWP
Phascolarctos cinereus V253 igkv MSTS01000436.1 6124 ARGAIELTQSPASLSVSPGEKVTMSCTASQGISNYLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQYDYNYL
Phascolarctos cinereus V254 ighv MSTS01000448.1 156476 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYYMHWVRQASGKGLEWVARISTSGSSTYYADSVKDRFTISRDNGNSMLYLQMTSLQTEDTAVYYCTR
Phascolarctos cinereus V255 ighv MSTS01000448.1 76817 VQCDVELVESGGDVIQPGGSLSLSCKASGFTLSSYYMSWVRQPTGKGLEWVAGISSGGSKYYADSVKDRFTISRDNGNSILYLQMTSVETEDTAVYYCAR
Phascolarctos cinereus V256 ighv MSTS01000448.1 19221 VQCDVELVESGGDVVQPGGSLRLSCKASGFTISSYWMSWVRQASGKGLEWVASIYSSSSSTYYADSVKGRFTISRDNGNSILYLQMTSVETEDTAVYYCAR
Phascolarctos cinereus V257 ighv MSTS01000488.1 90808 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSNYRMHWVRQASGKGLEWVAYISSSGGTTRYADSVKDRFTISRDNGNSILYLQMTSLETENTAVYYCAR
Phascolarctos cinereus V258 ighv MSTS01000488.1 22366 VQCDVELVESGGDVIQPGGSLSLSCKASGFTFSNYYMRWVRQASGKGLEWVASISGSSGSTYYADSVKGRFTISRDNGNSMLYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V259 igkv MSTS01000504.1 113087 ARGAIELTQSPASLSVSAGETVTMSCTASQGISNYLHWYQQKPGQAPRLLIRYASTLHGGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQQSKEWP
Phascolarctos cinereus V260 igkv MSTS01000504.1 93845 AQGAIELTQSPASLSVSPGEKVTMSCTASQGISNYLHWYQQKPGQAPQLLIRGASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCQHNYNWP
Phascolarctos cinereus V261 igkv MSTS01000504.1 86426 ARGAIELTQSPASLSMSPGEKVTMSCKASQSIGTSLHWYQQEPGQAPRLLITYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQYDYNYR
Phascolarctos cinereus V262 igkv MSTS01000504.1 67138 ARGAIELTQSPASLSVSPGEKATMSCTASQGISNYLHWYQQKPGQDPRLLIRDASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCHQSYSWP
Phascolarctos cinereus V263 igkv MSTS01000504.1 13928 AQGAIEVTQSPASLSVSPGETVTMSCTASQDISNQLYWYQQKPGQAPRLLIKHASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDGAVYYCLLDYNWS
Phascolarctos cinereus V264 igkv MSTS01000504.1 4904 ARGAIELTQSPASLSVSPGEKATMSCTASQGISNDLHWYQQKPGQVPRLLIRDASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCQYGYYNL
Phascolarctos cinereus V266 igkv MSTS01000642.1 35836 SQAAIEVTQSPASLSVAAGDQVTISCKASSSISKWMAWFQHKPGHSPKQLIYDASTLNSGVPARFSGSGSGTDFTFTISAVEAEHVADYYCFQGYSDPF
Phascolarctos cinereus V267 igkv MSTS01000642.1 21429 SQAAIEVTQSPASLSVAAGDQVTISCKASSSVSKYMAWYQQKPGQSPRLLIYYASTLYSGVPDRFSGSGSGTDFTLTISAVEAEDVADYYCFAL
Phascolarctos cinereus V268 ighv MSTS01000656.1 49917 VHCEVHLVESEGGVRQPGGSLSLSCKPSGFTFSIYYISWVLQAPGKGLEWHASIYSNVGKTFYADSVKGRFTISLNYSNDVLHLQMNSLKAEDTAMYYCAR
Phascolarctos cinereus V269 igkv MSTS01000705.1 33129 SQAAIELTQSPASLSVAAGDQVTISCTASSSISKYMAWYQQKPGQAPKQLIYYASTLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFQYNSYPF
Phascolarctos cinereus V270 igkv MSTS01000705.1 8149 SQAAIELTQSPASLSVSAGDQVTISCKASTNIYKNMAWYQQKPGQSPRLLIYAASTLNSGVPARFSGSGSGTDYTLTISAVEAEDVADYYCSQHYNAPF
Phascolarctos cinereus V271 ighv MSTS01000915.1 20431 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSGYRMSWVRQAPGKGLEWVAYISSSSSYTYYADSVKDRFTISRDNGNNMSYLQMTSLETEDTAVYYCA
Phascolarctos cinereus V272 ighv MSTS01000937.1 26694 VLSDLQLEESGPGLAKPSESLTLTCSVTGGSVTSSYYWSWIRQSPGKGLVWIGYWSGSTYYNPVFQNRVSITADTSKNQFSLQLKSLTAEDTAVYYCAR
Phascolarctos cinereus V273 igkv MSTS01001189.1 18566 AIELTQSPASLSMSPGEKVTMSCKASQSIGTSLHWYQQEPGQAPRLLITYASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCHQSYSW
Phascolarctos cinereus V274 igkv MSTS01001189.1 3227 ARGAIELTQSPASLSVSPGEKVTMSCTASQGISNYLHWYQQKPGQAPRLLIRYASTLHGGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQYDYNYA
Phascolarctos cinereus V275 igkv MSTS01001208.1 23472 ARGAIELTQSPASLSVSPGETVTMSCTASQSVGTSLHWYQQKPGQAPRLLIRGASTLHDGVPSRFSGSGSGTDFSLTISSVEAEDAAVYYCQQSKSNP
Phascolarctos cinereus V276 igkv MSTS01001208.1 3148 ARGAIELTQSPASLSVSPGEKATMSCTASQGISNDLHWYQQKPGQAPRLLIRYASTLHDGVPSRFSGSGSGTDYSLTISSVEAEDAAVYYCQYGL
Phascolarctos cinereus V277 ighv MSTS01001247.1 2358 VQCDVELVESGGNVVQPGGSLSLFCKASGFTFSSYWMHWVRQAPGKGLEWVAGIRSGGSTYYADSVKDRFTISRDNGNSMLYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V278 ighv MSTS01001324.1 5066 VQCDVELVESGGDVIQPGGSLSLSCKGSGFTFSSYYMHWVRQASGKGLEWVASISSSIYYADSVKGRFTISRDNGNSILYLQMTSVETEDTAVYYCAR
Phascolarctos cinereus V279 ighv MSTS01001442.1 7075 VQCDVELVESGGDVIQPGGSLSLSCKVSGFTFSSYDMSWVRQASGKGLEWVATIYTSSNAYYADSVKGRFTISRDNGNSMLYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V280 ighv MSTS01001477.1 17280 VQCDVELVESGGDVIQPGGSLSLSCKASGFTFSSYRMSWVCQAPGKGLEWVASIRTTSSTYYADSVKGRFTTSRDNGISILYLQMTSLETEDTAVYYCAR
Phascolarctos cinereus V281 ighv MSTS01001550.1 8367 ELSEQLEESGPGIVKPSESLTLTCSVTGGSVTSSYYWHWIRQCPGKGLVWIGYWSGSTKYNPVFQNRVSISTADTSKNQFSLQLKSLTAGPALYYCAR