WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Odocoileus virginianus texanus MLBE00000000.1 (MLBE01) 118 9 6 6 50 28 7 12
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Odocoileus virginianus texanus V0 trdv MLBE01005800.1 7790 KGVLCNQVTQSSPEQRVASGSEVTLLCTFQTIYSNPDLYWYRIRPDGVFQFVLYRDNAKSHDADFAQGRFSVQHSVSHKTFHLVISSVRLEDTATYYCALEL
Odocoileus virginianus texanus V1 trbv MLBE01020555.1 23492 SMDTEVTQSPSHLIKGKDEKAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNEDPMEETAVFKQRFSAECPKNSPCSLEIKSTEAADSALYFCASSQ
Odocoileus virginianus texanus V2 trbv MLBE01020555.1 35454 SMDTGVTQTPRNRIANTGKSIVLECSQTKDHESMYWYRQDPGQGLRLIYSSYDIGGIDKGDVSDGYNVSRKEKAKFSLYLEPATPSQTAIYFCASSI
Odocoileus virginianus texanus V3 trbv MLBE01020555.1 41224 FMDAVVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGLELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Odocoileus virginianus texanus V4 trbv MLBE01020555.1 42928 LKDAAVTQFPRHKILETKKEVILQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGRDTVKKGDVPEGYDVSRDELEHFPLTLKSASPNQTSVYFCASSE
Odocoileus virginianus texanus V5 trbv MLBE01020555.1 50164 SLEADVTQSPRYRITETKKRVTLTCSQNMNHEAMYWYRQDPGLGPRLIYFSRNNGNVQKGDIPDGYTVSREEKPNFPLTLELASTKQTSLYLCASSK
Odocoileus virginianus texanus V6 trbv MLBE01020555.1 61868 LMDAQVTQTPRYLAKRRGEKVVIECIQNIDYKRMFWYRQDPALGLWLLHFSINVGMVEKGDVPHGYSVSRKKKESFPLTLESATTNQTSVYLCASSE
Odocoileus virginianus texanus V7 trbv MLBE01020555.1 67790 SAFGAVLSQKPSRAICQRGTSVKIECQVDSQLTFMYWYRQLPGQSLVLMATANQGSKATYESGFAEDKFPISRPTLVFSTLTVSNASSKDSSSYFCSAG
Odocoileus virginianus texanus V8 trdv MLBE01032790.1 24030 SALAQKVTQDQPDVSSQVGQSVTLNCRYETSWTAYYLFWYKQPPSGQMTYVIRQGSEVTNARNGRYSVNFKKADKSISLTISALQLEDSAKYFCALRE
Odocoileus virginianus texanus V9 trav MLBE01032790.1 32137 VQGADVAQSPPALSLQEGASCMLRCNFSTFPQSVNWYLQSPGGRLIHLFYIPSGTKQEGRLNATTVPTERRSSLHISSSRTTDSGTYFCAAQHGAPQ
Odocoileus virginianus texanus V10 trdv MLBE01032790.1 49236 SGVAQSVTQDQPHILSEVGKTVTLNCRYETSWGMYKYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTIPALELEDSAKYFCALWD
Odocoileus virginianus texanus V11 trdv MLBE01032790.1 62188 SSVAQRVTQDQPDISSQVGEVVTLSCRHETRVSSYIIFWYKQLPSGEMIYLIRQGSSSQNARDGRYSINVQRSQRSISLTISDLQLEDSAKYFCTLWE
Odocoileus virginianus texanus V12 trdv MLBE01032790.1 87652 SGMAQKVTQDQPDISSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIHQYSEDSNARNGRYSVNFWKADKSIRLIISSLELEDSAKYFCALRE
Odocoileus virginianus texanus V13 trav MLBE01032790.1 93380 IVIDAKTTQPSSMDCAEGEDINLPCNHSTIRVDDYIHWYRQNPNQSPQYVIHGLRGTVNKSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Odocoileus virginianus texanus V14 trav MLBE01032790.1 96380 VRGADVEQSPPALSLQEGASYTLQCSFSTSPQSVNWYLQNPGGHLIQLFSVPSGRKQEGRLKATTVPTERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Odocoileus virginianus texanus V15 trav MLBE01032790.1 102719 GTGAQLVTQPDGHISVSEGNRLELRCNYSYGGSINLFWYVQYPSQGLQVLLKYLSGPTQVKGIKGFEAEFKKDEKSFHLMKASAHWSDSAKYFCALC
Odocoileus virginianus texanus V16 trdv MLBE01032790.1 120002 SGVAQNVIQDQSDISGQLGESVTLNCRYGTTWRYYYMFWYKLLPNGEMIYLIGQISTGQNARDGRYSVNFQKAHKSISLTISDLELEDSAEYFCALWE
Odocoileus virginianus texanus V17 trav MLBE01032790.1 131401 VRGVDVAQSPPALTPQEGASSTLWCNFSTFAESVQWYLQSPGGHLIHLIYIPSVTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Odocoileus virginianus texanus V18 trdv MLBE01032790.1 142941 SSVAQKVTQVQTAITSQVGQTVTLNCRYEVSWTMDYYYIFWYKQLPSGEMAFLIHQYSAHLNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALRE
Odocoileus virginianus texanus V19 trav MLBE01032790.1 150105 MNGQQIKHFPEFLLLQEGENFTTYCNFSSNFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLTAAQPSDVGTYFCAQKQCSG
Odocoileus virginianus texanus V20 trav MLBE01032792.1 3409 ESTQQLEQNPQFLHIQEGGNVTMHCNSSSTFTFFQWYRQEPKERPVLLMTLTKPKEMKEQKRIRARFGEARKDSSLLITATQPGDAGTYLCAG
Odocoileus virginianus texanus V21 trav MLBE01032792.1 10028 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSMTSVQWFQQNPDRRLISLFYVASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVD
Odocoileus virginianus texanus V22 trdv MLBE01032792.1 32742 SGVAQNVIQDQSDISGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLIRQISTGQNAKDGRYSVNFQKARKSISLTISDLELEDSAEYFCALCE
Odocoileus virginianus texanus V23 trav MLBE01032793.1 884 MNGQQIKHFPEFLLLQEGENFTTYCNFTSNFYNLQWYKQRPGGSPVLLMILAKSGEVKTQQRLTVRFGESRQHSSLHLTAAQPSDVGTYFCA
Odocoileus virginianus texanus V24 ighv MLBE01036297.1 8476 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSRYAVHWVRQAPGKALEWVGDISSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAK
Odocoileus virginianus texanus V25 ighv MLBE01036644.1 101 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSYAVNWVRQAPGKALEWVGTIDNSGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V26 ighv MLBE01036826.1 10164 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSNNVAWIRQAPGKALEWVGGIVYSGSTGYNPALKSRLSITRDTSRSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V27 trav MLBE01036896.1 50 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSGFRALQWYRQDSGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYFCSVQ
Odocoileus virginianus texanus V28 trav MLBE01036897.1 323 VSSKQDVSQSPEALSVREGDSVDLNCSYTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQTSGRITVSLDKPSRHSALHIATSQHSDSTTYLCAV
Odocoileus virginianus texanus V29 igkv MLBE01002658.1 77017 SSGDVVLTQTPLSLSVSPGEMVSISCKSTQSLKDSDGKTYLRWFQHKPGQSPQSLIYEISNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQA
Odocoileus virginianus texanus V30 igkv MLBE01002658.1 54788 ASGKAVLHQTPAYIAVPLGESISITCRANQSISDYLSWYKQKPGQAPSILIYDADNQYSGVPGRFTATQSETEFVFMISKVEADDAAMYYCQQDHVL
Odocoileus virginianus texanus V31 igkv MLBE01002658.1 22061 TIAEITLTQSPATVSVTPGDRVTITCKASQKVDDDLYWYQQKPGQTPKLIIKQASTLISGVPSRFSGSGYDIDFTLTIDDIKSEDSAYYFCQHDENIP
Odocoileus virginianus texanus V32 igkv MLBE01002660.1 33853 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLLSSDGNTYLYWLQHKPGQSPERLIYQVFKHDPGVSDRFTGSGSETDFTLRISSVQAEDAGVYYCFQA
Odocoileus virginianus texanus V33 igkv MLBE01002660.1 17865 FDGAIVLTQTPRSLSVIPGEMASISCRASKSLEDSYGNSLLHWYVQKPSQSPQLLIYVASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Odocoileus virginianus texanus V34 igkv MLBE01002660.1 7377 SSGDVVLTQTPLSVSVSPGEMVSISCKSTQSLKDSDGKTYLRWFQHKPGQSPQGLIYQVSNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQA
Odocoileus virginianus texanus V35 trdv MLBE01005802.1 46693 VMSPAVLVPQDQEKTVPVGKSVTLSCSMKGDSISKHYIFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDGLTNQAMLEVLKASKRDEGFYYCASI
Odocoileus virginianus texanus V36 trdv MLBE01005803.1 9403 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGNFKGKIDTSKNQYVFNIQKATIKDVGTYYCGSD
Odocoileus virginianus texanus V37 trgv MLBE01006835.1 61333 IQQDFRVLQSSMMVGHAGRAITMSCRVSSSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLMKLAKSDEGMYYCAAWRS
Odocoileus virginianus texanus V38 iglv MLBE01009251.1 3754 RAVTSQLTQPPAVSVSLGQTASITCQGDDFDSIGANWYQQKPGQAPVMVIYGNRERASGIPDRFSGSNSGDTATLTISGAQAEDEADYYCQSADISGG
Odocoileus virginianus texanus V39 iglv MLBE01009253.1 3351 SWAQAMLTQLLSVSGSPGQRVTITCSGSSSNIGILGVSWYQQLPGSAPKTLIYDSNKRPTGVPDQFSGTKSGNTGTLTITSLQAENEADYYCAFM
Odocoileus virginianus texanus V40 trbv MLBE01020556.1 48601 VSAQTIHQWPPTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQLLFYSVSAEDIDPREFQNFEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Odocoileus virginianus texanus V41 trgv MLBE01021218.1 100051 HLEQPQISSTRKLSKTARLECMVSSVTISTTSVYWYQERPGQAIQHLLHIFPNNTVKRESGILLSKFEAHMTPETSTSTLTVHSVREQDSATYYCALWD
Odocoileus virginianus texanus V42 trgv MLBE01021218.1 88210 GLGLSKVEQAQISLSTEVKKSINIRCKIESTNFESEAVHWYRQKRNQALEHLVYVTSTTTAARSQVDGKNKIEARKDARMFTSTLTVNFIEKEDVGVYYCAGWD
Odocoileus virginianus texanus V43 trgv MLBE01021218.1 77409 GLGQLTLEQPEVSVTGTREKSAVMSCKVSSKDFSKDYIHWYRQKPDQGLEQLLYVLAASAQSHLGGTKNKFEAKKDVASSTSTLKISFLEKEDEAMYYCAGWVS
Odocoileus virginianus texanus V44 trgv MLBE01021218.1 70672 GDIKMKISQQQLSSTRRPDRTVHIRCKLSGVPLENAIVHWYQEKEGEPLTRILYGSANSYKLDKPNSRLEMDSKRNGIFYLIINNVVKSDEATYYCACWD
Odocoileus virginianus texanus V45 trgv MLBE01021218.1 35937 TQVSSNMEEDKLSVMRATGSSVVIDCDLTHNYIHWYKFQEGAVPRRLLYYDVYNSKVVLEPGTSQGKYHVYKGTGKGYTIVISNLQESDSGTYYCAFWE
Odocoileus virginianus texanus V46 trav MLBE01021762.1 4110 GSNGDSVTQPKGQVTLLEEESLTVNCSYETKQYPALSWYVQYSGEGPKFLLRAHRDNEKGSSKGFEATYNTETTSFHLEKASVQESDSAVYYCALN
Odocoileus virginianus texanus V47 trav MLBE01021763.1 11383 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASTYFFWYKQEPGKGLQLLIHILSNEDKKQGQRLIVLLNKKNKHLSLNITATHPADSATYFCAAR
Odocoileus virginianus texanus V48 trav MLBE01021765.1 13159 TLSLAKTSQPIFIDSYEGQDVNISCNHTTISTSDYIFWYRQFPSQGPQYIIQGYKTNVENEVASLLIPTDRKVSTLMLLRASLRDSAVYYCIVR
Odocoileus virginianus texanus V49 trav MLBE01021765.1 8271 GLRAQSVTQPEDQVPVSEGDPVTVKCTYSVSGSPSLFWYVQHRNQGLQFLLRYIGGDKLVQGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Odocoileus virginianus texanus V50 trav MLBE01021765.1 582 TLSFAKTSQPVFIDSYEGQDLNISCNHTTIATNDYIFWYRQFPNQGPQYIIQGYKTNVENEVASLFIPTDRKVSTLMLPRASLRDSAVYYCIVR
Odocoileus virginianus texanus V51 trav MLBE01021766.1 56959 SAGKGIEQPTELMVMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLSRFDAHSYLLLKELHMKDFASYLCAVI
Odocoileus virginianus texanus V52 trbv MLBE01024188.1 35709 PTDAGVTQTPRHELTEKGQAVTLSCEPIKSHAVLYWYRQTSVRGLELLIYFNNQEPVDESGMPKDRFSAKMPNASLSTLKIQSTDPGDSATYLCASSK
Odocoileus virginianus texanus V53 trbv MLBE01024188.1 33222 YISAEVAQFPSHRVIEKKQAVNLSCDPISGHDSLFWYYHAVGKEMKLLIYFIRESVQDNSGMPKGRFTAERMEGTSSTLRVHSAELGDSGVYFCASSR
Odocoileus virginianus texanus V54 trbv MLBE01024188.1 30916 HVGALVIQNPRYLVTGMGKPVNLSCSQNMKHDVMYWYQQKPSQAPKLLLYYYDRQITREKNTSENFQSSKPNTSFCSLDIHSAGLGDSAVYLCASSR
Odocoileus virginianus texanus V55 trbv MLBE01024188.1 26295 FLEAEVTQTPGHLVQGKGLDVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAECPSNSPCSLKIQATELQDSAMYFCASSD
Odocoileus virginianus texanus V56 trbv MLBE01024188.1 13227 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRLIFFSRFVSVVQKEDIAKGYNASRKKKPFFPLTVTSAQKNQTALYLCAAS
Odocoileus virginianus texanus V57 trbv MLBE01024188.1 9849 SGLGALVSQQPRRAVRKSGDSVTIQCRAVDFQTTTVFWYRQLPKQGLVLMAASNEGTDATYEQGYNKDKLPISQPNLTFSSLTVTSVDPADSSLYFCGAR
Odocoileus virginianus texanus V58 trbv MLBE01024188.1 3058 SMDTEVIQSPDHLVKGKDQKAKMDCVPKKGHSYVYWYRKRLEEAIEFLVNFQNQDIVKDTAVFKQRFSAECPKNSPCSLEIKSTEAADSALYFCASSQ
Odocoileus virginianus texanus V59 trbv MLBE01024189.1 37411 HTEAGVVSQSPSHRVTRRGQTVNLRCDPISGHISLYWYRQTLGQGPEFLAYFQNEQAVDKSGLPKNRFSAERPESTYSYLKIQPAEPEDSAVYLCASSP
Odocoileus virginianus texanus V60 trbv MLBE01024189.1 28282 PLEAEVTQTPRHLIKRTGQTATLKCSPMSGHSSVSWYQQAWSQGPQFIFEFYETQPRAKGNFSSRFSAKQFHDFSSELNVTSLELTDSALYLCASSL
Odocoileus virginianus texanus V61 trbv MLBE01024189.1 22745 HTGAGVVSQSPGHRVTGRGQSVDFRCDPIPGHQGLYWYRQMLGQGPERLTYFQGKEEPDKSGMPNNRFSAERSEGTFSYLKIQSAEPGDSAVYLCASSP
Odocoileus virginianus texanus V62 trbv MLBE01024190.1 6309 LVDSGVTQTPKYLIKSRKQQATLMCFPESGHRSVYWYQQALGQGPQFLVQYFDGEEYQKGNISDRFSGKQLSGSRSELSLTPLELTDSALYLCASSQ
Odocoileus virginianus texanus V63 trbv MLBE01024190.1 1901 LVDSEVTQTPKYLIKSRKQQVTLRCSPESGHHYVSWYQQALGQGPQFLVQYYDGKVHTKGNMSDRFSGEQFGDSRSQMKLSSLELTDSTLYLCASRE
Odocoileus virginianus texanus V64 trbv MLBE01024191.1 42728 LVDSGVTQTPKYLIKSRKQQVTLRCSPDSGHRSVNWYQQALGQGPRFLIQYYRGQVNGEGNMPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Odocoileus virginianus texanus V65 trbv MLBE01024191.1 37980 TVHAGVTQDPRFQVLRTGQSATLKCTQDLGHNNMFWYRQDPGRGLRLIHYSTGPFAKEQGDVPDGYSVSRPNTENFPLTLESANRSQTSVYFCASSY
Odocoileus virginianus texanus V66 trbv MLBE01024191.1 33950 LVDSGVTQTPKYLIKSRKQQATLRCSPDSGHLSVYWYQQALGQGPRFLVQYYNQKVWGEAQLPDRFSGEQFSDARSELSLTPVELTDSAVYLCASSQ
Odocoileus virginianus texanus V67 trbv MLBE01024191.1 25939 LVDSGVTQTPKYLIKSRKQQATLRCSPESGHLYVSWYQQALGQGPQFLIQYYNRGVNEKGNMSDRFSGEQFSDSHSQMNLSLLELTDSAVYLCASSK
Odocoileus virginianus texanus V68 trbv MLBE01024191.1 19759 AVHAGVTQDPRFQVMRTGQSATLKCTQDLNHDYMYWYRQDPGHGLRLIHYSDGPPGTEKGDVPDGYSVSRPRTENFPLTLKSANRSQTAVYFCASSY
Odocoileus virginianus texanus V69 trbv MLBE01024191.1 5873 AVHAGVTQDPRFQVVTTGQSATLKCTQDLGHDRMYWYRQDPGLALRLIHYSAGTPYTEKGDVPDGYSVSRPSTENFPLTLKSANRSQTSVYFCASSD
Odocoileus virginianus texanus V70 trbv MLBE01024193.1 7073 ISADPGITQIPKYLVMGMMDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFIYNYKELAENASVPSRFQPRCPESSQCLLDLNAPKPQDAAVYLCASSR
Odocoileus virginianus texanus V71 ighv MLBE01027881.1 75691 AAAGVGTQPGEALTDPLPHLRCLWILTKQLCSTLGPQAPGKALEWVGAIGYSGSTCYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V72 trav MLBE01032957.1 4785 LRRADWIRSQETDVSGEEGKTVSLFCNYYTSSRSFVSLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Odocoileus virginianus texanus V73 trav MLBE01033851.1 84520 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLLWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSEFSFNLRKFSAHWSDSAEYFCALS
Odocoileus virginianus texanus V74 trav MLBE01033851.1 72464 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVSSVQWFQQNPGGSLARLFFIASGMKQNGRLSSTVNSKELYSTLHIAASQLEDAATYLCAVE
Odocoileus virginianus texanus V75 trav MLBE01033851.1 61141 SIIAQKVTQDPQPMLVWEKEVVTLDCTYDTSESNYNLFWYKQLSSGAMIFLLRQDSYNKQNATEGRYSLNFQRASKSITLVISASQLEDSAVYFCALRE
Odocoileus virginianus texanus V76 trav MLBE01033851.1 49816 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSDYFPWYKQEPGKGPQLLIAIFSNKRKEEDQRLTVLLNKTAKHFSLHIATTEAGDSAVYFCAAR
Odocoileus virginianus texanus V77 trav MLBE01033851.1 43377 SSIAQKVTQDQPPMSVQEKETVTLDCTYDTSDITYSLFWYKQPSSGMMTFLISQDSHNKQNATKGHYSLNFQKASKFIKLTISASQLEDSAVYFCALRE
Odocoileus virginianus texanus V78 trav MLBE01033851.1 30526 GVRGVKVEQSPSVLKLQEGANSTLRCNFSDTVNSVQWFQQNPGGSLTTLFFIASGTKQKERLSSTVNSKERYSTLHIAASQLEDAATYLCAVE
Odocoileus virginianus texanus V79 trav MLBE01033851.1 26799 VSLGNEVEQSPSTLSVQEGNTAVITCTYTDTASEYFPWYKREPGKGPQLLVAIRSTMGEKKDQRLTVLLNRTAKRFSLHIATIQPGDSAAYFCAAR
Odocoileus virginianus texanus V80 trav MLBE01033851.1 22583 SIIAQKVTQDQPQVLVQEKEAVTLDCKYDTSDSQYYLFWYKQPSNGGMILLVRQDSYNQQNATEGRYSLNFQKARKSITLVISASQLEDSAVYFCALSE
Odocoileus virginianus texanus V81 trav MLBE01033851.1 6973 VSIQYTLDQSSSFLSIQERTHADLHCTYQKKTFYNFGWFKQEPGKGLVSLSLTQSSQKEQADKNFKELLGKEKFHRVLRISASHPGDSATYFCAL
Odocoileus virginianus texanus V82 ighv MLBE01034227.1 51348 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSHPVAWVRQAPGMGLEWVGGIVYSGSTCYNAALKSRLSITRDTSRSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V83 ighv MLBE01034227.1 25148 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLTGYGIHWVRQAPGKALEWVGGICSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCGR
Odocoileus virginianus texanus V84 ighv MLBE01034227.1 5280 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSYGVSWVRQAPGKALEWVGIIYGGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V85 trav MLBE01034458.1 74180 RTSGDSVTQTEGVVTLPEKAPLTLTCTYQSSYSVALFWYVQYQNKELELLLRSSLGNQVTSRGFEATHTSSDSSFHLQKSSVQTSDSAVYYCALR
Odocoileus virginianus texanus V86 trav MLBE01034458.1 59461 GTNGDSVNQTEGPVIVSEGALMTLNCTYQTVGSVPYLFWYVQHLNKAPQLLLKGFTADKTVEHEGFQATLVKRDSSFHLQKGAVQTSDSAVYYCALR
Odocoileus virginianus texanus V87 trav MLBE01034458.1 53904 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEDFQATLVKGDSSFHLQKRAVQTSDSAVYYCALS
Odocoileus virginianus texanus V88 trav MLBE01034458.1 47075 GTSGDSVNQTEGPVTVLEGALMTLNCTYQATYSNIYLFWYIQHLNKAPQLLLKGFTADKTVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Odocoileus virginianus texanus V89 trav MLBE01034458.1 44723 SIMAQKVTQNQSEIPVLEKKDVKLNCAYEADSYSYYLFWYKQPPSGEMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLEDSAVYFCALR
Odocoileus virginianus texanus V90 trav MLBE01034458.1 35910 LRGEDRVEQSPRTLRTQEGDSLSLNCSHTVSGFRALQWYRQDPGKGPELLFLLYSAGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Odocoileus virginianus texanus V91 trav MLBE01034458.1 29523 VSSKQDVSQSPEALSVREGDSVDLNCSYTDSALYFLQWFRQDPRKGLTSLPSIQANQKEQTSGRITVSLDKSPRHSALHTATSQHSDWTTYLCAV
Odocoileus virginianus texanus V92 trav MLBE01034458.1 21075 VRGVDVEQSPPALSLQEGASSTLRCNFSTFPDSVQWYLQNPGGRLTHLFYIPSGTKQEGRLKATTVPAERHSSLHISSSRTTDAGTYFCAVQHGAPQ
Odocoileus virginianus texanus V93 trav MLBE01034458.1 13255 QVKQSPQSLTVQEGEISILNCSYEKSAFDYLLWYWQYPGKGPAFLIAIRSVVNEMEDGRLTIFLNKSAKQLSLHITTSQPEDSAIYFCAATAQYSP
Odocoileus virginianus texanus V94 trdv MLBE01034458.1 6374 SGVAQKVTQDQPYITSQIGQSVILNCRYEVSWSRYTHYLFWYKQLPSGEMTFLLRQESSGPNARNGRYSVDFRKAQNSISLTISALQLEDSAKYFCALWE
Odocoileus virginianus texanus V95 ighv MLBE01034692.1 16860 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSNSVGWVRQAPGKALEWVGAIGYSGSYNPALKSRLSITSDTSKSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V96 ighv MLBE01034693.1 22465 VLSQVQLRESGPSLVKPSQTLSLTCAVSGFSLSSYGVGWVRQAPGKALEWVGVICCGGSTCYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Odocoileus virginianus texanus V97 trdv MLBE01035536.1 36492 SSMAETVTQAQTTVTAREGEAATIDCTYHTSRTWYTLYWYRQFPGGRMEFLIYQDSNKANARRDRYSVNFQRARRFISLTISSLYLADSAEYFCALWE
Odocoileus virginianus texanus V98 trav MLBE01035536.1 27816 ILGDSKTTQPNLAEGAEEEPVHLPCNHSTISGREHVYWYRQISHQGPEYLIHGLNNNVTNKMASLSIAKDRKSSILVLPQVTVRDTAVYYCILR
Odocoileus virginianus texanus V99 iglv MLBE01036154.1 15707 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNVGCGNNLDWYQQVPGSAPRTLIYRATSRASGVPDRFSGSRSGNTATLTISSLQAEDEGDYYCASYDSSSNI
Odocoileus virginianus texanus V100 iglv MLBE01036154.1 7181 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNVGRGNYVSWYQQVPGSAPRLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDETDYYCASYDSSSSN
Odocoileus virginianus texanus V101 trav MLBE01036188.1 20615 ALITVEQSPASLPVPEGAVASLSCTYSDSASTYFEWYRQYPGKGPEFLLYVYADKDKEEGKFTAQATKANKHVSLLIRDSEPGDSATYLCAA
Odocoileus virginianus texanus V102 trav MLBE01036188.1 5006 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKYSGRLHFTLDNSIKSGSLSITASQAENAATYLCAAD
Odocoileus virginianus texanus V103 trav MLBE01036248.1 7597 PSVAQTVTQPQPEESVQEGGTVTLDCTYSTSDSDYYLFWYKQPPSGEMVFIIRQYAYERQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Odocoileus virginianus texanus V104 trav MLBE01036248.1 4841 PSVAQTVTQPQPEESVQETGTVTLDCTYSTSDSDYYLFWYKQPPSGEMVFIIHQYAYERQNATNDHYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Odocoileus virginianus texanus V105 trav MLBE01036490.1 12434 VLGDSKTTQPNSMEGTEEGPVHLPCNHSTISGSEYVYWYRQIPHQGPEYLIHGLNNNMTNRMASLSIAKDRKSSILVLPQVTVKDTAVYYCVLR
Odocoileus virginianus texanus V106 trav MLBE01036490.1 5342 VTAQQLNQSPQSMSIQEGEDVSMNCNSSSMLNFLQWYKQDAGEGLILLIKLLKGGELARNGKLTVQFGGTKKDSLLNISASEPKDAGTYFCAG
Odocoileus virginianus texanus V107 trav MLBE01036685.1 9421 VRGVDVAQSPPALTPQEGASSTLWCNFSTFAESVQWYLQSPGGRLIPLIYIPSGTKQEGRLKATTVPAERRSSLHVSSPRTTDSGTYFCAAQHGAP
Odocoileus virginianus texanus V108 trav MLBE01036696.1 7004 VSLGNEVEQSPSTLSVQEGSTAVITCIYTDTASEYFPWYKQEPGKGPQLLVAIRSNMGEKKDQRLTVLLNKTAKRLSLHIATIQPGDSAAYFCAAR
Odocoileus virginianus texanus V109 trav MLBE01036696.1 3288 SIIAQKVTQDQPQVLVQEKEAVTLDCKYDTSESRYSLSWYKQPSSGGMILLIRQDSHNQQNATEGRYSLNFQRARKSITLVISASQLEDSAVYFCALSE
Odocoileus virginianus texanus V110 trav MLBE01036698.1 1632 VRGVDVEQSPPALSLQEGASYTLWCNFSNPPLSVNWYLQSPGGRLIHLIYIPSGTKQEGRLKATTVPAERRSSLHISSPQTTDAGTYFCAAQHGAPQ
Odocoileus virginianus texanus V111 iglv MLBE01036863.1 6886 AASSYELTQSPSVSVSPGQTGRITCWGSSIGSENVQWYQQKLDQTPELVIYQDSKQYSGIPDRLSGSSLGSMATLTISGIRAEDQADYHCQSRDCS
Odocoileus virginianus texanus V112 iglv MLBE01036863.1 2681 RAVTSQLTQPPAVSVSLGQTASITCQGDDFFIGANWYQQKPGQAPVTVIYGNRERASGIPDRFSGSNSGDTATLTISGAQAEDEADYYCQSADISGG
Odocoileus virginianus texanus V113 trav MLBE01037056.1 6477 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKYSGRLHFTLDNSIKSSSLSITASQAEDAATYLCAAD
Odocoileus virginianus texanus V114 trbv MLBE01037115.1 6858 SMDTEVTQSPSGLVKGKDQKAKMDCVPEKGHINVYWYRKKLEEAFEFLVYLQNEKIIEDTAVFKQQFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Odocoileus virginianus texanus V115 trav MLBE01037425.1 5251 PSVAQTVTQPQPEESVQETGTVTLDCTYSTSDSDYYLFWYKQPPSGEMVFIIHQYAYERQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Odocoileus virginianus texanus V116 trav MLBE01037561.1 879 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSDPYLFWYVQHLNKAPQLLLKGFTADKTVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Odocoileus virginianus texanus V118 trgv MLBE01037757.1 1500 TRASSNMEEARMSITRATGSSAVIPCDLPTQNVKYIHWYKFQEGAVPRRLLYYDVYYSKVVLEPGISPGKYNVYEATDKTYKFVNSNLQESDSGVYHCAVWE