WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mus pahari FMBV00000000.1 (FMBV01) 103 37 1 4 32 21 5 3
Mus pahari FMBV00000000.2 (FMBV02) 196 54 2 63 45 21 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mus pahari V41 trav FMBV01011614.1 79217 GVRGMQVEQNPPALSLHEGADSGLRCNFSTTMKSVQWFQQNHRGRLITLFYLAQGTKENGRLKSIFNSKERYSTLHIKDAQLEDSGTYFCAAE
Mus pahari V42 trav FMBV01011614.1 90543 RTHGDSVIQIQGQVTLSENDFLFINCTYSTTGYPILFWYVQYFGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQESDSAVYYCAMR
Mus pahari V43 trav FMBV01011614.1 98710 VRSQQNVQQSPESLIVPEGAMTSFNCTFSSSASQYFAWYRQRSGEGLKTLMTIYSNGEKEEGRFTIYLNKASLHVSLHIRDSQLSDSAVYFCAV
Mus pahari V44 trav FMBV01011616.1 40 VKGQQVQQSPVSLVLQEGEKAELQCNFSISTNHVQWFYQRPGGRLISLSYIPGMKLSGKRTSSTVTKGQHSSLTISSSQTTDSGTYFCVLSTQCSP
Mus pahari V45 trav FMBV01011616.1 16177 GNSAQSVDQPDAHVTVSEGASLELRCSYSYSAAPFLFWYVQYPGQSLQFLLKYISGDAVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALS
Mus pahari V46 trav FMBV01011619.1 42251 IASDAKTTQPDSMESTEGETVRLPCSHATIGGNQYIYWYRQVALQGPEYVTHGRLQNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRV
Mus pahari V48 trav FMBV01011619.1 101557 ASIAQTVSQPQKEKTVRVAESATLECTYDTRDINYFLFWYKQQGEQLTLVIRQEAYKQHNATLNRFSVNFQKAAKSFSLEISDSQLGDAATYFCALGG
Mus pahari V49 trdv FMBV01011619.1 111591 ASMAQTVSQPQKEKTVRVAESVTLECTYDTRDTNYFLFWYKQQGEQLTLVIRQEAHKQYNATLKRFSVNFQKAAKSFSLEISDSQLGDAATYFCALME
Mus pahari V50 trdv FMBV01011619.1 226361 TSLDVHLEPVAETFTVVAGDPASFYCTVTGDMKNYHMSWYKKSGNNALSLVYKLKGNSTDDPMNNVKGKINISKNQFILDIQKATMKDAGTYYCGSD
Mus pahari V0 trbv FMBV01000505.1 301225 PVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAKKSLELMFSFSYQKLMDNQTASSRFQPHNSEKTYLDLQITALKPDDAATYFCASSQ
Mus pahari V1 trbv FMBV01000505.1 302674 HTEPKVLQIPSHKVIDMGQVVTLSCDPVSNHLYFYWYKQIFGQQMEFLVSFYNGKVMEKSKLFKDQFSVERPDRSYFTLKIQPTTLEDSAMYFCASSL
Mus pahari V2 trbv FMBV01000505.1 311743 PLEMAVFQTPNYRVTQVGNEVSFNCEQTLGHDVMYWYKQDSKKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVVPDDSAVYLCASS
Mus pahari V3 trbv FMBV01000505.1 316779 FTNTKIMQSPRYLIMGRANKSLKCEQHLGHNAMYWYKQSAKKPPELMFLYNNKQLIRNETVPSRFSPECPDSSQLLLHVSAVDPEDSAIYFCASSQ
Mus pahari V4 trbv FMBV01000505.1 348656 DGGITQTPRDWITKTSRKIILKCSQDRNHSRMSWYRQDAGQGLKLIHYSVGIDRTTKGDVPEGYSAFRNETQSFPLTLESTSSNQTSMYFCASSEQT
Mus pahari V5 trbv FMBV01000505.1 376291 SANSGVVQSPRHIIKEKGGRSVLKCIPISGHSNVVWYQQTLGQELKFLIQHYEKMERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCAS
Mus pahari V6 trbv FMBV01000505.1 378694 HMEAAVTQSPRNKLTVTGGNVTLSCHQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLEKGDVPDGYKASRTTQEDFFLVLELASPSQTSTYFCASSD
Mus pahari V7 trbv FMBV01000505.1 381509 SANSGVVQSPRHIIKEKGGRSILKCTPISGHLSVAWYQQTQGQELKFFIQHYDKMERDKGNLPSRFSVQQFSDYHSEMNMSALELEDSAMYFCASS
Mus pahari V8 trbv FMBV01000505.1 383967 HMEAAVTQSPRNKVTVTGGNVTLSCHQTNSHSNMYWYRQDMGQGLRLIHYSYGAGSTEKGDVPVGYKASRTKQEDFFLMLELASPSQTSVYFCASSD
Mus pahari V9 trbv FMBV01000505.1 390833 HMEAEVTQSPRNKVTATGGKVTLSCRQTNNHDYMYWYRQDMGHGLRLVYYSYSVNNTEKGDVPDGYKASRPSQEDFSLILELASLSQTAVYFCASSD
Mus pahari V10 trbv FMBV01000505.1 397583 LSEAGVTQSPRYAVLQEGQTVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFRNEAVIDNSQLPADRFSAVRPKGTNSTLKIQSAKQGDTATYLCASSL
Mus pahari V11 trbv FMBV01000505.1 404182 HTDAGVTQTPSHEVTEKGQTITLKCEPVSGHNDLFWYRQTKTRGLELLSYFRSKSLMEDAGTLKHRFKAEMLQNSSFSTLKIQATEPQDSAVYLCASSL
Mus pahari V12 trbv FMBV01000505.1 414926 PTNAGVIQTPRHKVTGKGQEATLRCEPISGHSAVYWYRQTTVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQSLSTLKIQSTQPQDSAVYLCASSL
Mus pahari V13 trbv FMBV01000505.1 424953 FVDTMVKQNPRYKVARVGKPVNLICSQTMNHDTMLWYQKKPNQAPKLLLYYYDENLNREADTSENLQSSRPNNSFCSLDIGSASLEDSAMYLCATSR
Mus pahari V14 trbv FMBV01000505.1 439767 TTHGGIISQTPKFLIGQEGQKLTLKCQQNFNHDSMYWYRQDSGKGLRLIYYSITEKDLQKGDLSEGYDASRESKSSFALTVTSAQKNEMAVYLCASSV
Mus pahari V16 trbv FMBV01000505.1 460137 SMDSGVIQSPRHLVKGKEQKAKMDCTPINGHSYVYWYYKKLGEELKFLVYFQNEDIMDKTDMIGKNISAKCPAKKSCTIEIQSSKLTDSAVYFCASSQ
Mus pahari V17 trbv FMBV01000505.1 469432 SFVAGVTQTPRYLVKKKGEKSHMSCTPEKGHTAVYWYQQNQKQELTFFINFRNEEIMEQTDLVKKRFSAKCSQNSRCILEILSSEEDDSALYLCASSL
Mus pahari V18 trbv FMBV01000505.1 479859 ILNSNVIQTPRYLVKGKGQKAKMRCIPEKGHPFVFWYQQNKNNEFKFLINFQNQDVLQQIDKTEKQFSAECPSNSPCSLEIQSSEAGDSALYLCASSL
Mus pahari V19 igkv FMBV01000665.1 100899 ATGDIVMTQAALSVPVTPGESVSISCRSSKSLLHSSGNTLLYWFLHRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLEYP
Mus pahari V22 ighv FMBV01002742.1 15423 IQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDFYMEWVRQAPGKGLEWIGASRNKANDYTTEYSASVKGRFTISRDTSQNILYLQMNTLRAEDTAIYYCARD
Mus pahari V23 ighv FMBV01002742.1 54466 VDSEVQLQQSGAELVRPGASVKLSCKASGYTFTDYYMNWVKQRPGQGLEWIGDIDPEDGVAEYAPKFQGKATLTADTSSSTAYMQLSSLTSEDTAVYFCA
Mus pahari V24 ighv FMBV01002742.1 81200 VNSEVQLKQSGAELVRPGASVKLSCKTSGYTFINYYLHWVKQTPEQGLEWIGRIDPEDGNTKYAPKFQGKATMTADTSSNTAYMQLSSLTSEDSAVYYCT
Mus pahari V25 ighv FMBV01002742.1 122787 VQGEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYVMHWVRRAPEKELEWIAYINSGSSNIHYADTVKGRFAISRDNAKNTLFLQMSSLKSEDTAMYYCAR
Mus pahari V26 ighv FMBV01002742.1 129696 VLSQVQLKESGPDLVQPSLTCTVSGFSLSSYGVHWFHKPPRKGLEWLGRIWSGGSIYDNSVLRSRLSISRDTSKSQVFFQMSSLQSEDTAVYYCAR
Mus pahari V27 ighv FMBV01002748.1 107 VHSQVQLQQSGAELVKPGASVKLSCKASGYTFTSYGIHWVKQRPGQGLEWIGYINPSSGGTIYNEKFKSKATLTADKSSNTAYMQLNSLASEDSAVYFCA
Mus pahari V28 ighv FMBV01002748.1 19081 VYSQLELQQSGAELVRPGASVKLSCKDSHYAFIASAMHWVKQRPGQGLEWIGSFTMYSDATKYSEKFKGKATLTANTSSSTAYMELSSLTTEDSAVYYCA
Mus pahari V29 ighv FMBV01002748.1 36013 ILSQVTLKESGPGILQSYQPIRLTCTFSGFSLSTSGIGVSWIRQPSGKGLEWLATIWWDDDKRYNPSLKSRLTVSKDTSNNQAFLMIISVETADTAIYYCAQSA
Mus pahari V30 ighv FMBV01002748.1 67390 VHSQVQLQQSGAELVKPGSSVKLSCKASGYTFTSYYMNWVKQRPGQGLEWIGAINLGISDTGYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYYCA
Mus pahari V31 ighv FMBV01002748.1 72138 VHSQVQLLQSGAELVKPGASVKMSCKASGYTFTDYHMSWVKQRPGQGLEWIGRIYPESGGTNYNEKFKGKATLTSDKSSSTAYMQLSSLTSEDSAIYYCA
Mus pahari V32 ighv FMBV01002748.1 86827 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTTYPIQWVKQSHGKSLEWIGNFHPYNDDTKYNEKFKSKARLTVEKSSSTTYLELSRLTSDDSAVYYCA
Mus pahari V33 trgv FMBV01006597.1 9329 GLGELEQTEVSVTRVTDESAQMSCRVSLPDFSNIAIHWYRQKPNQHIEYLIYVMKNYNQRPLGGKIRKIEATKDFQTSTSTLKLNYLKKEDEATYYCAAWI
Mus pahari V34 trav FMBV01011611.1 49740 AAGQGVEQPAYLMSVEGTFARVNCTYSTSGFNGLSWYRQREGQAPVFLSYVVLDGLKDSGSFSTFLSRSNEYSYLLLTELQIKDSASYLCAVR
Mus pahari V35 trav FMBV01011614.1 4677 GVQGMQVEQNPPALSLHEGADSGLRCNFSTTMQNVQWFQQNHRGRLITLFYLVQGTKENGRLKSTFNFKERYSTLHIRDAQPENSGTYFCAAE
Mus pahari V36 trav FMBV01011614.1 17892 ESQGEQVEQLPSSLSVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLHITATQPGDSAVYFCSTS
Mus pahari V37 trav FMBV01011614.1 27902 RTHGDSVTQMQGQVTLSEDDFLFINCTYSASGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKKSTSFHLQKASVQESDSAVYYCAVS
Mus pahari V38 trav FMBV01011614.1 42299 VNSQQEVQQSPEYLIVPQGGMTSLNCTFSDPSSQYFWWYRQHSGEGPKALMSIFSNGDKKEGRFTAYLSRASLHTSLHIRDSQPSDSALYFCAV
Mus pahari V39 trav FMBV01011614.1 49878 RTHGNSVTQMQGQVTLSEEEFLFINCTYSASGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCALG
Mus pahari V40 trav FMBV01011614.1 58558 VNSQQKVQQSPESLSVPEGGMASLNCSSSDRNVDYFWWYRQHSGKSPKVLISIFSNGEKEEGRFTVHFNKASLHVSLHIRDSQPSDSALYFCAV
Mus pahari V53 igkv FMBV01015252.1 6761 TNGDIVLTQSPVSLTVSLGERVTISCKASQSIDYYGDNYMHWFQQKPGQPPKLLIYDASNLESGVPDRFSGSGSGTDFTLNINPIEDDDTATYYCQQSKEFP
Mus pahari V54 igkv FMBV01015252.1 35224 CTCDIVLTQSPASLAVSLGQRATISCRASKSVSISTTSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTIDPVEEEDSADYYCQQSNEDP
Mus pahari V55 trav FMBV01000446.1 48320 ESHGEKVEQHHSTLSVQEGDSAVINCTYTDPASSYFPWYKQEAGKSLHFVIDIHSNVDRKQSQRLTVLLDKKAKRFSLHITATQPEDSAVYFCAA
Mus pahari V56 trav FMBV01000446.1 38237 RTHGDSVTQTEGQVTVSESKTLTINCTYSASSIAYPTLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKETTSFHLRKASVQESDSAVYYCALG
Mus pahari V57 trav FMBV01000446.1 35017 VTGKTQVEQSPQSLVVRQGENCVLQCSYSVVPDNNLRWFRQDTGKGLVSLTVLVHQKDKTSNGRYSATLDKDAKHSTLHIMASTLDDTATYICVVG
Mus pahari V58 trav FMBV01000446.1 20405 VNSQQKMQQSPESLIVPEGATASLNCTFSDRTSNNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLKKASLHVSLHIRDSQPSDSALYLCAA
Mus pahari V59 trav FMBV01000446.1 9605 VKGQQVQQSPLSLVLQEGENAELQCNFSTTLNSMQWFYQRPGGSFVSLLYNPSGTKQSGRLTSTTVIKERRSSLHISSAQTTDSGTYLCAMDPQCS
Mus pahari V60 trbv FMBV01000506.1 21952 LVDMKVTQKPRYLIKRMGENVLLECGQDMNHERMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSL
Mus pahari V61 trbv FMBV01000506.1 12536 SVFSVLVYQKPNRDILQSGTSLEIQCVVDSQVVTMFWYQQFGQSLMLMATANEGSEATYESGFTKDKFPISRPNLTFSTLTVNNARPEDSSVYFCSSG
Mus pahari V62 trbv FMBV01000510.1 65780 VSAQTIHQWPAAEVKAVGSPLSLECTIKGKSNPNLYWYWQATGGTLQQLFYSINVGQVESVVPLNLSASRLKDNEFILSTEKLLLSHSGFYLCAWS
Mus pahari V64 igkv FMBV01000666.1 94131 STGDIVLTQSPASLALSLGQRATISCRASKSVSTSSYSYMHWYQQKPGQPPKLLIYLASNLRSGVPARFSGSGSGTDFTLTIDPVEADDVADYYCQHSKEVP
Mus pahari V66 ighv FMBV01002741.1 23324 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYAMSWVRQTLEKRLEWVASISSSGGYTNYPDTVKGRFTISRDNAKNTLYLQMSSLRSDKTAMYYCAR
Mus pahari V67 ighv FMBV01002743.1 75895 ILSDVQLQESGPGLVKPSQTLSLTCTVTGYSINSDCYWIWIRQFPGNKLEYMGYIFYSGITYYNPSLESRMYITRDTSKNQFFLKLSSVTTEDTATYYCAR
Mus pahari V68 ighv FMBV01002743.1 44905 VHSEVQLQQSGAELVSPGASVKLSCKASGYTFTDYYMHWVKQRPEQGLEWIGRIDPEDGDTAYAPEFQGKATLTADTSSNTAYMQLSSLTSEDTAVYFCA
Mus pahari V69 ighv FMBV01002743.1 31877 IQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDFYMTWVRQPTGKALEWLGFIRNKANGGTAEYGASVKGRFTISRDDSQNILYLQMNALRAEDSATYYCARD
Mus pahari V70 ighv FMBV01002745.1 31982 ILSEVQLQASGPGLVKPSQSLSLTCTVTGYSITSNYWFWIRKFPGNKLEHMGHISYSGDTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTAIYYCAR
Mus pahari V71 ighv FMBV01002745.1 2345 VQAQIQLVQSGPELKKPGDTVKISCKASGYTFTSNGMQWVQRTPGKGLKWIGWINTNSGVPKYAEDFKERFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus pahari V72 ighv FMBV01002746.1 210475 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMSWVRQAPGKGLEWVAHIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYFCTR
Mus pahari V73 ighv FMBV01002746.1 197061 VYSQIQLQQSGAELARPGASVKMSCKASGYTFTSYWIHWVKQRPGQGLEWIGAIYPGDGDTSYNQKFKGKATLTADKSSSTAYLQLSSLTSEDSAVYYCA
Mus pahari V74 ighv FMBV01002746.1 175339 VLSEITLKESGPGILQPSQTLSLTCTFSGISLSTSGMGLSWLRQPAGKALEWLASIWNNDNYYNPSLRSRLTISKETSNNQVFLKLTSVDTADTATYYCAWR
Mus pahari V75 ighv FMBV01002746.1 159558 VQCEVKLDESGGGLVQPGRSMKLSCAASGFTFSDYWMSWVRQSPEKGLEWVAQIRDKANNYATYYTDSVRGRFTISRDDSKSSVYLQMNSLKAEDTGIYYCT
Mus pahari V76 ighv FMBV01002746.1 106596 VQSDVNLEVSGGGLVHPGGSMQLSCAASGFTFIDGWMDWVRQSPEKGFEWVAEIANKASDYATYYAESVKGRFTISRDDSKSSVYLQMKSLRAEDTGIYYCT
Mus pahari V77 ighv FMBV01002746.1 91665 VQSEVKLEESGGGLVQPGRSMKLSCVTSGFTFTNYWMQWVRQSPEKGLEWVAEIRLKSNNYATYYVESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus pahari V78 ighv FMBV01002746.1 59862 VHSQVQLQQSGAELLRTGASVKISCKASGYTFTSYYVDWVKQRTVYSLEWIGRIIPGFGATDYAQKFKGKATLTADKSSRTVYMELSSLTSEDSAVYYCARQCC
Mus pahari V79 ighv FMBV01002747.1 171439 VHSEVQLQQSGAELVKPGASVKLSCKASGYTFTDYWMNWVKQRPGQGLEWIAYIRPGNGDTSYNQKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCW
Mus pahari V80 ighv FMBV01002747.1 165735 VHSQVQLQQSGTELVKPGASVKMSCKASGYTFTNYWMHWVKQSHGKSLEWIGYINPYNGGTGYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus pahari V81 ighv FMBV01002747.1 160956 VHSEVQLQQPGHKVVNAGDSVKLSCKSSGYSFSRFKMDWMKQIHGKSLKWIGDINLFNSGTNYNEKFKIKGILTVDISSCTAYMDLSRLTSEDSAVYYCA
Mus pahari V82 ighv FMBV01002747.1 148105 AHSQVQLQQSGAELVKPGASVKMSCQASGYKFNSFNIDWVKQSHGKTPEWIGYINPGNGATGYNQKFKGKATLTADTSSSTAYMQLSSLTSEDTAVYYCA
Mus pahari V83 ighv FMBV01002747.1 134430 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFIDYWMQWVKQRPGQGLEWIGEIYPGSGGTTYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSVVYFCA
Mus pahari V84 ighv FMBV01002747.1 126065 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTNYWMYWVKQSHGKTLEWIGNIYPGNGGTNYNEKFKGKATLTVDTSSSTAYMQLSSMTSEDSAVYYCA
Mus pahari V85 ighv FMBV01002747.1 111910 VHSQVQLQQSGAELVRPGASVKLSCKASGYTFNDYEIHWVKQSLKQGLEWIGAIHPGSGGTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYFCA
Mus pahari V86 ighv FMBV01002747.1 79003 VHSEVQLQQSGAELVKPGASVKLSCKASGYTFTDYNMHWVKQRPGQGLEWIGRIYPYNGDTRYNEKFKGKATLTADKSSSTAYMKLSSLTSEDTAVYFCA
Mus pahari V87 ighv FMBV01002747.1 75477 AHSQVQLQQSGAELASPGASVKLSCKASGYTFTDHIISWIKKRPGQGLEWIGRIYPVSGEINYNQKFMGKATFSVDQSSSTVYMVLNSLTSADPAVYYCG
Mus pahari V88 ighv FMBV01002747.1 38941 VHSQVQLQQSGAELVKPGASVKMSCKASGFTFSSNYIGWLKQKPGQSLEWIGYIYPGSGGTGYTEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCA
Mus pahari V89 ighv FMBV01002747.1 29448 IHSQVHLQQSGSELRSPGSSVKLSCKDFDSDVFPIAYMSWVRQKPGHGFEWIGDILPSIGRTLYGEKFEDRATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus pahari V90 ighv FMBV01002747.1 7039 VHSQVQLQQSGAELARPGASVKISCKASGYTFTSYWMPWIKQRPGQGLEWIGYINPSNGYTEYNQKFKGKATFTADKSSSTAYMQLSSLTSEDSAAYYCA
Mus pahari V91 ighv FMBV01002749.1 2079 VHSEVQLLQSGAELVKPGASVKMSCKASGYTFTDYYMYWVKQRPGQGLEWIGEINPYNGGTNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus pahari V92 iglv FMBV01004818.1 32774 FQPTLTQPDAFLVFPGQEAHLSCTIDSQHATVGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAARNACILTISPVLPEDDADYFCSI
Mus pahari V93 trgv FMBV01006595.1 38357 RQTSSNLEGRIMSITSSEGSSAIMTCDIHRTSNYIHWYRFQKGKAPERLLYYNFISSTAVMDSGFSSKKYLVYEGPDKRYKFVLRNVEESDSALYYCATWT
Mus pahari V94 trgv FMBV01006595.1 31346 GHGKLEQPEVSISRARDETVQISCKVIIESFRSVTIHWYRQKSNQGLEFLLYVLATPTHIFLDKEYKKMEASKNSSASTSTLTIYSLEEEDEAIYYCSYGK
Mus pahari V95 trgv FMBV01006595.1 25663 SEGSSLTSPLGSYVIKRRGNTAFLKCQIKTSVQKPNAYMHWYQEKPGQRLQRILCTSSKENIVYEKGFSEERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus pahari V96 trgv FMBV01006595.1 23872 GDAMISQDQLSFTRKPNKTVHISCKLSGVTLQNTIVHWYQLKEGEPLKRIFYGSPKTYKQEKPNSRLEIDERDDGTFYLIINNVVTSDEATYYCAYWN
Mus pahari V98 trav FMBV01011613.1 21112 SWSLAKTTQPASMEAYEGQEVNVSCSHTNIATSEYIYWYRQVPHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPWVSLRDTAVYYCIVT
Mus pahari V99 trav FMBV01011613.1 6864 VSRGEQVEQRPPHLSVREGDSAAIICTYTDPNSYYFFWYKQEWGAGLQLLMGVFSNVDRKEEQGLTVLLNKKDKILYLNITTVHLGNSATYFCAAS
Mus pahari V100 trav FMBV01011615.1 119888 VSRGEQVEQRPPHLSVREGDSTAIICTYTDPNSYYFFWYKQEPGAGLQLLMKVFSSMEINEGHGFTVLLNKKDKRLSLNITAAHPGDSATYFCAVS
Mus pahari V101 trav FMBV01011615.1 106785 DAQAQSVTQPDARVTVSEGASLQLRCNYSTSGTPYLFWYVQYPRQGLQLLLKYYSGDQVVQGLNDFEAEFSKSDSSFHLRKAAVHWSDSAVYFCALR
Mus pahari V102 trav FMBV01011615.1 97838 GVRGDQVEQSPSALSLHEGSNSALRCNFSTTMRSVQWFRQNSRGSLISLFFLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAE
Mus pahari V103 trav FMBV01011615.1 87271 MSQGEQVEQLPSVLRVQEGSSAIINCTYENSASLYFPWYKQEPGENLKLIIDIRSNMERKQIQGLLVLLDKKAKRFSLHITDTQLGDSAVYFCAAS
Mus pahari V104 trav FMBV01011615.1 80158 RAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASRDKEKGSSRGFEATYDKGATSFHLRKASVQESDSAVYYCALS
Mus pahari V105 trav FMBV01011615.1 75580 VNSQQKVQQSPESLVVPEGATASLNCTFSDSASQSVWWYRQHPGKGPKALISVFSNGNKKEGRLTVYLNRASLHVSLHIRDSQPSDSAVYLCAAS
Mus pahari V106 trav FMBV01011615.1 64076 VKGQQVQQSPVSLVLQEGENAELQCTYSTTLNSMQWFYQRPGGSLIRLLYNPSWTKQRGGRLTSIAASNERRSSLHISSSQTTDSGTYLCAVE
Mus pahari V107 trav FMBV01011615.1 51024 VKSQWGEENLQVLSIQEGDDVTMNCSYKTYTTVVQWYRQDSGEGPALLLLIRSNEREKRSGRLRATHDTSSQSSSLSITAAQSEDTAVYFCATD
Mus pahari V108 trav FMBV01011615.1 45525 TSMAQKVTQTQTSISVMEKTTVTMDCVYETQDSSYYLFWYKQTASGEMVFLIRQDSYKKENTTEGRYSLNFQKPKSSIGLIITATQSEDSAVYFCAMRE
Mus pahari V109 trav FMBV01011615.1 37004 VKGQQVQQSPVSLVLQEGEIAELRCNFSSTATQLQWFYQRPRGSLISLLYNPSGTKKSGRLTSTTVTNERRSSLHISSAQTTDSGTYLCAMDPQCS
Mus pahari V110 trav FMBV01011617.1 3952 VVTQQLEQSPQFLSIQEGQDFTAYCSSSTTFPQFYWYRQVPREGPVILMTLVKSGEVKEQKRMTAKFGEARKNSSLFITRAQPGDVGTYFCAG
Mus pahari V111 trdv FMBV01011619.1 294784 KDVLCITLTQSSPDQTVASGSEVTLLCTFEVDFSNPDLFWYRKRLDGSFQFILYRDNTRSHDADFVQGRFSVKHSMAYRTFHLVISPVRLEDSATYYCASG
Mus pahari V22 trbv FMBV02000505.1 479859 ILNSNVIQTPRYLVKGKGQKAKMRCIPEKGHPFVFWYQQNKNNEFKFLINFQNQDVLQQIDKTEKQFSAECPSNSPCSLEIQSSEAGDSALYLCASSL
Mus pahari V838 trav FMBV02011615.1 64076 VKGQQVQQSPVSLVLQEGENAELQCTYSTTLNSMQWFYQRPGGSLIRLLYNPSWTKQRGGRLTSIAASNERRSSLHISSSQTTDSGTYLCAVE
Mus pahari V839 trav FMBV02011615.1 51024 VKSQWGEENLQVLSIQEGDDVTMNCSYKTYTTVVQWYRQDSGEGPALLLLIRSNEREKRSGRLRATHDTSSQSSSLSITAAQSEDTAVYFCATD
Mus pahari V18 trbv FMBV02000505.1 439767 TTHGGIISQTPKFLIGQEGQKLTLKCQQNFNHDSMYWYRQDSGKGLRLIYYSITEKDLQKGDLSEGYDASRESKSSFALTVTSAQKNEMAVYLCASSV
Mus pahari V20 trbv FMBV02000505.1 460137 SMDSGVIQSPRHLVKGKEQKAKMDCTPINGHSYVYWYYKKLGEELKFLVYFQNEDIMDKTDMIGKNISAKCPAKKSCTIEIQSSKLTDSAVYFCASSQ
Mus pahari V21 trbv FMBV02000505.1 469432 SFVAGVTQTPRYLVKKKGEKSHMSCTPEKGHTAVYWYQQNQKQELTFFINFRNEEIMEQTDLVKKRFSAKCSQNSRCILEILSSEEDDSALYLCASSL
Mus pahari V4 trbv FMBV02000505.1 301225 PVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAKKSLELMFSFSYQKLMDNQTASSRFQPHNSEKTYLDLQITALKPDDAATYFCASSQ
Mus pahari V5 trbv FMBV02000505.1 302674 HTEPKVLQIPSHKVIDMGQVVTLSCDPVSNHLYFYWYKQIFGQQMEFLVSFYNGKVMEKSKLFKDQFSVERPDRSYFTLKIQPTTLEDSAMYFCASSL
Mus pahari V6 trbv FMBV02000505.1 311743 PLEMAVFQTPNYRVTQVGNEVSFNCEQTLGHDVMYWYKQDSKKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVVPDDSAVYLCASS
Mus pahari V7 trbv FMBV02000505.1 316779 FTNTKIMQSPRYLIMGRANKSLKCEQHLGHNAMYWYKQSAKKPPELMFLYNNKQLIRNETVPSRFSPECPDSSQLLLHVSAVDPEDSAIYFCASSQ
Mus pahari V8 trbv FMBV02000505.1 348656 DGGITQTPRDWITKTSRKIILKCSQDRNHSRMSWYRQDAGQGLKLIHYSVGIDRTTKGDVPEGYSAFRNETQSFPLTLESTSSNQTSMYFCASSEQT
Mus pahari V9 trbv FMBV02000505.1 376291 SANSGVVQSPRHIIKEKGGRSVLKCIPISGHSNVVWYQQTLGQELKFLIQHYEKMERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCAS
Mus pahari V10 trbv FMBV02000505.1 378694 HMEAAVTQSPRNKLTVTGGNVTLSCHQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLEKGDVPDGYKASRTTQEDFFLVLELASPSQTSTYFCASSD
Mus pahari V11 trbv FMBV02000505.1 381509 SANSGVVQSPRHIIKEKGGRSILKCTPISGHLSVAWYQQTQGQELKFFIQHYDKMERDKGNLPSRFSVQQFSDYHSEMNMSALELEDSAMYFCASS
Mus pahari V12 trbv FMBV02000505.1 383967 HMEAAVTQSPRNKVTVTGGNVTLSCHQTNSHSNMYWYRQDMGQGLRLIHYSYGAGSTEKGDVPVGYKASRTKQEDFFLMLELASPSQTSVYFCASSD
Mus pahari V13 trbv FMBV02000505.1 390833 HMEAEVTQSPRNKVTATGGKVTLSCRQTNNHDYMYWYRQDMGHGLRLVYYSYSVNNTEKGDVPDGYKASRPSQEDFSLILELASLSQTAVYFCASSD
Mus pahari V14 trbv FMBV02000505.1 397583 LSEAGVTQSPRYAVLQEGQTVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFRNEAVIDNSQLPADRFSAVRPKGTNSTLKIQSAKQGDTATYLCASSL
Mus pahari V15 trbv FMBV02000505.1 404182 HTDAGVTQTPSHEVTEKGQTITLKCEPVSGHNDLFWYRQTKTRGLELLSYFRSKSLMEDAGTLKHRFKAEMLQNSSFSTLKIQATEPQDSAVYLCASSL
Mus pahari V16 trbv FMBV02000505.1 414926 PTNAGVIQTPRHKVTGKGQEATLRCEPISGHSAVYWYRQTTVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQSLSTLKIQSTQPQDSAVYLCASSL
Mus pahari V17 trbv FMBV02000505.1 424953 FVDTMVKQNPRYKVARVGKPVNLICSQTMNHDTMLWYQKKPNQAPKLLLYYYDENLNREADTSENLQSSRPNNSFCSLDIGSASLEDSAMYLCATSR
Mus pahari V27 igkv FMBV02000665.1 100899 ATGDIVMTQAALSVPVTPGESVSISCRSSKSLLHSSGNTLLYWFLHRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLEYP
Mus pahari V68 ighv FMBV02002742.1 15423 IQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDFYMEWVRQAPGKGLEWIGASRNKANDYTTEYSASVKGRFTISRDTSQNILYLQMNTLRAEDTAIYYCARD
Mus pahari V69 ighv FMBV02002742.1 54466 VDSEVQLQQSGAELVRPGASVKLSCKASGYTFTDYYMNWVKQRPGQGLEWIGDIDPEDGVAEYAPKFQGKATLTADTSSSTAYMQLSSLTSEDTAVYFCA
Mus pahari V70 ighv FMBV02002742.1 81200 VNSEVQLKQSGAELVRPGASVKLSCKTSGYTFINYYLHWVKQTPEQGLEWIGRIDPEDGNTKYAPKFQGKATMTADTSSNTAYMQLSSLTSEDSAVYYCT
Mus pahari V71 ighv FMBV02002742.1 122787 VQGEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYVMHWVRRAPEKELEWIAYINSGSSNIHYADTVKGRFAISRDNAKNTLFLQMSSLKSEDTAMYYCAR
Mus pahari V72 ighv FMBV02002742.1 129696 VLSQVQLKESGPDLVQPSLTCTVSGFSLSSYGVHWFHKPPRKGLEWLGRIWSGGSIYDNSVLRSRLSISRDTSKSQVFFQMSSLQSEDTAVYYCAR
Mus pahari V73 ighv FMBV02002748.1 107 VHSQVQLQQSGAELVKPGASVKLSCKASGYTFTSYGIHWVKQRPGQGLEWIGYINPSSGGTIYNEKFKSKATLTADKSSNTAYMQLNSLASEDSAVYFCA
Mus pahari V74 ighv FMBV02002748.1 19081 VYSQLELQQSGAELVRPGASVKLSCKDSHYAFIASAMHWVKQRPGQGLEWIGSFTMYSDATKYSEKFKGKATLTANTSSSTAYMELSSLTTEDSAVYYCA
Mus pahari V75 ighv FMBV02002748.1 36013 ILSQVTLKESGPGILQSYQPIRLTCTFSGFSLSTSGIGVSWIRQPSGKGLEWLATIWWDDDKRYNPSLKSRLTVSKDTSNNQAFLMIISVETADTAIYYCAQSA
Mus pahari V76 ighv FMBV02002748.1 67390 VHSQVQLQQSGAELVKPGSSVKLSCKASGYTFTSYYMNWVKQRPGQGLEWIGAINLGISDTGYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYYCA
Mus pahari V77 ighv FMBV02002748.1 72138 VHSQVQLLQSGAELVKPGASVKMSCKASGYTFTDYHMSWVKQRPGQGLEWIGRIYPESGGTNYNEKFKGKATLTSDKSSSTAYMQLSSLTSEDSAIYYCA
Mus pahari V78 ighv FMBV02002748.1 86827 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTTYPIQWVKQSHGKSLEWIGNFHPYNDDTKYNEKFKSKARLTVEKSSSTTYLELSRLTSDDSAVYYCA
Mus pahari V181 trgv FMBV02006597.1 9329 GLGELEQTEVSVTRVTDESAQMSCRVSLPDFSNIAIHWYRQKPNQHIEYLIYVMKNYNQRPLGGKIRKIEATKDFQTSTSTLKLNYLKKEDEATYYCAAWI
Mus pahari V294 trav FMBV02011611.1 49740 AAGQGVEQPAYLMSVEGTFARVNCTYSTSGFNGLSWYRQREGQAPVFLSYVVLDGLKDSGSFSTFLSRSNEYSYLLLTELQIKDSASYLCAVR
Mus pahari V295 trav FMBV02011614.1 4677 GVQGMQVEQNPPALSLHEGADSGLRCNFSTTMQNVQWFQQNHRGRLITLFYLVQGTKENGRLKSTFNFKERYSTLHIRDAQPENSGTYFCAAE
Mus pahari V296 trav FMBV02011614.1 17892 ESQGEQVEQLPSSLSVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLHITATQPGDSAVYFCSTS
Mus pahari V297 trav FMBV02011614.1 27902 RTHGDSVTQMQGQVTLSEDDFLFINCTYSASGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKKSTSFHLQKASVQESDSAVYYCAVS
Mus pahari V298 trav FMBV02011614.1 42299 VNSQQEVQQSPEYLIVPQGGMTSLNCTFSDPSSQYFWWYRQHSGEGPKALMSIFSNGDKKEGRFTAYLSRASLHTSLHIRDSQPSDSALYFCAV
Mus pahari V299 trav FMBV02011614.1 49878 RTHGNSVTQMQGQVTLSEEEFLFINCTYSASGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCALG
Mus pahari V300 trav FMBV02011614.1 58558 VNSQQKVQQSPESLSVPEGGMASLNCSSSDRNVDYFWWYRQHSGKSPKVLISIFSNGEKEEGRFTVHFNKASLHVSLHIRDSQPSDSALYFCAV
Mus pahari V301 trav FMBV02011614.1 79217 GVRGMQVEQNPPALSLHEGADSGLRCNFSTTMKSVQWFQQNHRGRLITLFYLAQGTKENGRLKSIFNSKERYSTLHIKDAQLEDSGTYFCAAE
Mus pahari V302 trav FMBV02011614.1 90543 RTHGDSVIQIQGQVTLSENDFLFINCTYSTTGYPILFWYVQYFGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQESDSAVYYCAMR
Mus pahari V303 trav FMBV02011614.1 98710 VRSQQNVQQSPESLIVPEGAMTSFNCTFSSSASQYFAWYRQRSGEGLKTLMTIYSNGEKEEGRFTIYLNKASLHVSLHIRDSQLSDSAVYFCAV
Mus pahari V304 trav FMBV02011616.1 40 VKGQQVQQSPVSLVLQEGEKAELQCNFSISTNHVQWFYQRPGGRLISLSYIPGMKLSGKRTSSTVTKGQHSSLTISSSQTTDSGTYFCVLSTQCSP
Mus pahari V305 trav FMBV02011616.1 16177 GNSAQSVDQPDAHVTVSEGASLELRCSYSYSAAPFLFWYVQYPGQSLQFLLKYISGDAVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALS
Mus pahari V306 trav FMBV02011619.1 42251 IASDAKTTQPDSMESTEGETVRLPCSHATIGGNQYIYWYRQVALQGPEYVTHGRLQNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRV
Mus pahari V308 trav FMBV02011619.1 101557 ASIAQTVSQPQKEKTVRVAESATLECTYDTRDINYFLFWYKQQGEQLTLVIRQEAYKQHNATLNRFSVNFQKAAKSFSLEISDSQLGDAATYFCALGG
Mus pahari V309 trav FMBV02011619.1 111591 ASMAQTVSQPQKEKTVRVAESVTLECTYDTRDTNYFLFWYKQQGEQLTLVIRQEAHKQYNATLKRFSVNFQKAAKSFSLEISDSQLGDAATYFCALME
Mus pahari V310 trdv FMBV02011619.1 226361 TSLDVHLEPVAETFTVVAGDPASFYCTVTGDMKNYHMSWYKKSGNNALSLVYKLKGNSTDDPMNNVKGKINISKNQFILDIQKATMKDAGTYYCGSD
Mus pahari V438 igkv FMBV02015252.1 6761 TNGDIVLTQSPVSLTVSLGERVTISCKASQSIDYYGDNYMHWFQQKPGQPPKLLIYDASNLESGVPDRFSGSGSGTDFTLNINPIEDDDTATYYCQQSKEFP
Mus pahari V439 igkv FMBV02015252.1 35224 CTCDIVLTQSPASLAVSLGQRATISCRASKSVSISTTSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTIDPVEEEDSADYYCQQSNEDP
Mus pahari V446 igkv FMBV02015340.1 2085 ARCDIQMTQSPALAASVGETVTISCQASKDIYNNLAWYQQKQGKSPQLLIYGANSLVDGVPSRFSGSGSGTQYSMKINSMQPGDAATYFCQQYYEFP
Mus pahari V447 igkv FMBV02015340.1 32436 SRCDIVMTQSPATLSVTLGDRVSLSCRASQSISNYLHWYQQKSHESPRLLIKYSSQSLSGIPSRFTGSGSGTDFTLSINSVEPEDVGVYYCQN
Mus pahari V448 igkv FMBV02015395.1 13325 STGDIVMTQALSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYLASKLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLEYP
Mus pahari V449 igkv FMBV02015395.1 44794 SSSDAVMTQTTLSLPVSLGDQASVSCRSSQSLVHSNGNTYLNWYLQKQGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLQISRVEAEDLGVYFCLQV
Mus pahari V450 ighv FMBV02015440.1 7590 AQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYYMSWVRQTLEKRLEWVATISTGGSTYYPDTVKGRFTISRDNAKNTLFLQMSSLKSEDTAMYFCAR
Mus pahari V451 ighv FMBV02015440.1 26263 AQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYYMSWVRQTPEKRLEWLAYITSGGSSMQYADSVKGRFTISRDNAKNTLYLQMSSLKAEDTALYYCA
Mus pahari V452 ighv FMBV02015631.1 8033 VHSQVQLQQSGAELVKPGVSVKLSCKASGYTFTDHTIHWVKQKPGQELEWIGYIYPGSGSTNYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCA
Mus pahari V453 ighv FMBV02015631.1 45829 VHSQVQLLQSGAELVKPGASVKKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYFYPYNGNTKYNEKFKDKATLTADKSSSTAYMQLSRLTSEDSAVYYCA
Mus pahari V454 trav FMBV02015749.1 2753 VKGQQVQQSPVSLVLQEGENAELQCNFSTALNSMQWFYQRPGGSLVSLFYNPSGTKQSGRLTSTTVIEERRSSLHISSSQTTDSGTYLCAMDPQCS
Mus pahari V455 igkv FMBV02015835.1 3297 SISDIVLTQSPASLAVSLGKRATISCRASKSVGTYMHWYQQKPGQPPKLLIYDASNLESGVPARFSGSGSGTDFTLTINPVEDDDVATYHCQQGNELP
Mus pahari V456 igkv FMBV02015928.1 17890 ATGDIVMTQPALYNPVTLGESASISCRSSKSLLHSNGITYLYWYLQRPGETPQQIVYRVSNLASGVPDRFSGSGSGTDFTLKISRVEGADMGVYYCMQAL
Mus pahari V457 igkv FMBV02015928.1 30522 SRGDVVMTQTPVSLPVSLGDQASISCRSSQSVAHSNGNTYLKWLLQKPGQSPRLLIYEISNRFSGVPDRFSGSGSGTDFTLKISRVELEDLGVYYCIQS
Mus pahari V458 ighv FMBV02015999.1 4669 VHSQVQLQQSGAELVRPGASAKISCKASGYTFTSEWMQWVKQRPGQGLEWIGEIYPGSGSTNYNEKFKSKATLTADKSSSTAYMQLSSQTSEDSAVYYCA
Mus pahari V459 trdv FMBV02016037.1 1821 SNMAQRVTQVPSMASKQEGEELTLECSYETSQVLYHLFWYKQLLSGEMVFLIKKSSSSTAKERSGRYSVVFQKLFKSISLVISALQPDDSGTYYCAHWER
Mus pahari V460 ighv FMBV02016054.1 2962 VHSQVQLQQSGAELVKPGASVKMSCKASGYTFTSYCMDWVKQRPGQGLEWIGAIDPGSGGTVYNEKFKGKATLTAEKSSSTAYMQLNSLTSEDSADYFCA
Mus pahari V462 igkv FMBV02016201.1 1556 VSGDVVKTQDELSNPVTSGESVSISCRSSKSLLYKDGKTYLNWFLQRPEQSPQLLICLMSTHALGVSDRFSGSGSGTDFTLKISRVEAEGVGVYYCQQIVEYP
Mus pahari V463 igkv FMBV02016201.1 19862 SSSDVVMTQTPVSLPVSLGDQASISCRSSQSIVSSSGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQY
Mus pahari V464 igkv FMBV02016205.1 356 STGDIVLTQSPASLAVSLGQRATISCKASQSVEDGGISYMYWYQQKPGQPPKLLIYHASNLESGVPARFSGSGSGTDFTLTINPVEDDDVADYYCRQGNELP
Mus pahari V465 igkv FMBV02016416.1 4079 SSGDIVMTQTPLSLSVSIGQPASISCKSSQSLLHSNGNTYLNWVLQRPGQSPKRLMYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCWQG
Mus pahari V466 ighv FMBV02016435.1 13079 ILSDVQLQESGPGLVKPSQTVSLTCTVSGISITTGNYRWSWIRQFSGNKLEWIGYIYYSGSITYNPSLKSRISITRDTSKNQFYLQFDSLTTEDTATYYCAR
Mus pahari V467 ighv FMBV02016598.1 69596 VYSQVQLQQSGDELARPGTSVKMSCKASGYTFTSNWVSWVIQRPGQGLEWFAAIHPGNGGTAYNEKFNGKATLTVDTSSSTAYIQLSRLKSEDSAVYFCA
Mus pahari V468 ighv FMBV02016824.1 8508 VHSQVQLQQSGAELVKPGASVKMSCKASGYTFTDYWMNWVKQRPGQGLEWIGMIYPGGGSTNYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus pahari V470 ighv FMBV02016894.1 13961 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPEKRLEWLAYITSGGSNMQYADSVKGQFTISRDNAKNTLYLQMSSLKAEDTAMYFCAR
Mus pahari V471 ighv FMBV02016894.1 26226 AQCEVKLVESGGGLVQPGGSLKLSCAASGFTFNSYSMDWVRQTPEKRLEWVAYISSGGSTIHYADSVKGRFTISRDNAKNTLFLQMSSLKSEDTAMYFCAR
Mus pahari V472 igkv FMBV02017155.1 3488 AQCDIQMTQSPSLLSASPGGKVTITCRASQDINKYIAWYQHKPGKAPRLLIRYTSVLQSGVPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNF
Mus pahari V473 igkv FMBV02017155.1 8126 TRCDIQMTQTTSSLSASLGDRVTISCRASQDISKYLSWFQQKPDGTVKPLIYYTSNLHSGVPSRFSGSGSGTDYSLTISNLEPEDFAIYYCLQYDKLP
Mus pahari V474 trdv FMBV02017306.1 2215 SNVAQKLTQVPSMGSRQVGEELALECSYETSQGLYHLFWYKHLLSGEMVFLIKKSSSSTAKERSGRYSVVFQKSFKSISLVISALQPDDSGTYYCALWEL
Mus pahari V475 trav FMBV02017306.1 6836 SSNGDSVTQTEGQVTLTEGLPVMLNCTYQTTYSPFLFWYVQYLNEAPWLLLKSSTDNRRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mus pahari V476 igkv FMBV02017310.1 1839 SSGDIVLTQSPASLAVSLGQKATIACTASESVDNYGISFMNWYQQKPGQRPKLLIYGASNLESGVPARFSGSGSGTDFTLNINPVEEEDAADYYCQHSRELP
Mus pahari V477 igkv FMBV02017364.1 2480 TRGDVVMTQTPLSLAVTIGQPASISCKSSQSLLYSDGKTYLNWFFERPGQSPKLLISLVSRLFSGVPDRFSGSGSETDFTLKIRRVEAEDLGVYYCVQA
Mus pahari V478 ighv FMBV02017450.1 10046 GVHSQVQLQQSVAELVRPGASVMMSCMASGYTFTDYYMHWVKQSHGKSLEWIGFIIPFSGGTSYNQKFKGKAILTVDKSSSTANMELSRLTSEDSLVYYCA
Mus pahari V479 ighv FMBV02017450.1 20778 VHSQVQLQQSGAELVKPGASVKMSCKASGYTFTEYYMEWVKQSHGKTLEWIGNIYPGNGGTNYNEKFKGKATLTVDTSSSTAYMQLSSMTSEDSAVYYCA
Mus pahari V480 ighv FMBV02017450.1 40510 AHSQVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIYPGDGDTNYNEKFKGKATLTADKSSSTAYMQLSSLTSEDTAVYFCA
Mus pahari V481 ighv FMBV02017450.1 47953 VYSQVQLQQSGPELVKPGASVKMSCKAPCYTFTSFNIDWVKQSHGKTLEWIGYINPGNGGTGYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARQ
Mus pahari V482 igkv FMBV02017502.1 1864 ACADIVMTQSPSSLAVSAGEKVTMSCKSTQSLLNSFTKKSYLNWYQQKPGQSPKLLIYWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYFCQQHY
Mus pahari V483 igkv FMBV02017502.1 40966 VDGDIVMTQSHRFMSTSVGDSVSIPCKASQNVGTAIAWYQQKPGQSLQLLIYGASYRFTGVPDRFIGSGSGTDFTLIISNVQAEDLADYFCQQHSSSP
Mus pahari V484 igkv FMBV02017502.1 44915 VDGDIVMTQSHRFMSTSVGDRVSIACKASQNVGTAIDWYQQKPGQSPKLLIYAASNRYTGVPDRFTGSGSRTDFTLTISNVQAEDLADYFCQQYNSYP
Mus pahari V486 iglv FMBV02017609.1 6672 AISQAVVTQESALTTSPGGTVTLTCCSSTGAVTTSNYANWVQEKPYHLFSSLIGGTSNRAPGVPARFSGSLIGDKAALTITEAQTEDDATYFCALWYSNH
Mus pahari V487 igkv FMBV02017611.1 15503 SSSDVVMTQTPLSLPVSVGDQDSISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYMVSNRFSGVPDRFSGSGSVTEFTLKISRVEAEDLGVYYCVQG
Mus pahari V488 igkv FMBV02017656.1 32525 AHGSIVMTQSPKSLPVSAGDRVTMTCKASQSVSNYVAWYQQKPGQSPKLLIYRASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYFCQQHD
Mus pahari V489 igkv FMBV02017657.1 30865 TCGDIVMTQSPSSLAVTAGEKVIMSCKSSQSLIWSVNQKNYLSWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYNYP
Mus pahari V494 trav FMBV02000446.1 48320 ESHGEKVEQHHSTLSVQEGDSAVINCTYTDPASSYFPWYKQEAGKSLHFVIDIHSNVDRKQSQRLTVLLDKKAKRFSLHITATQPEDSAVYFCAA
Mus pahari V495 trav FMBV02000446.1 38237 RTHGDSVTQTEGQVTVSESKTLTINCTYSASSIAYPTLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKETTSFHLRKASVQESDSAVYYCALG
Mus pahari V496 trav FMBV02000446.1 35017 VTGKTQVEQSPQSLVVRQGENCVLQCSYSVVPDNNLRWFRQDTGKGLVSLTVLVHQKDKTSNGRYSATLDKDAKHSTLHIMASTLDDTATYICVVG
Mus pahari V497 trav FMBV02000446.1 20405 VNSQQKMQQSPESLIVPEGATASLNCTFSDRTSNNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLKKASLHVSLHIRDSQPSDSALYLCAA
Mus pahari V498 trav FMBV02000446.1 9605 VKGQQVQQSPLSLVLQEGENAELQCNFSTTLNSMQWFYQRPGGSFVSLLYNPSGTKQSGRLTSTTVIKERRSSLHISSAQTTDSGTYLCAMDPQCS
Mus pahari V500 trbv FMBV02000506.1 21952 LVDMKVTQKPRYLIKRMGENVLLECGQDMNHERMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSL
Mus pahari V501 trbv FMBV02000506.1 12536 SVFSVLVYQKPNRDILQSGTSLEIQCVVDSQVVTMFWYQQFGQSLMLMATANEGSEATYESGFTKDKFPISRPNLTFSTLTVNNARPEDSSVYFCSSG
Mus pahari V502 trbv FMBV02000510.1 65780 VSAQTIHQWPAAEVKAVGSPLSLECTIKGKSNPNLYWYWQATGGTLQQLFYSINVGQVESVVPLNLSASRLKDNEFILSTEKLLLSHSGFYLCAWS
Mus pahari V510 igkv FMBV02000666.1 94131 STGDIVLTQSPASLALSLGQRATISCRASKSVSTSSYSYMHWYQQKPGQPPKLLIYLASNLRSGVPARFSGSGSGTDFTLTIDPVEADDVADYYCQHSKEVP
Mus pahari V576 ighv FMBV02002741.1 23324 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYAMSWVRQTLEKRLEWVASISSSGGYTNYPDTVKGRFTISRDNAKNTLYLQMSSLRSDKTAMYYCAR
Mus pahari V577 ighv FMBV02002743.1 75895 ILSDVQLQESGPGLVKPSQTLSLTCTVTGYSINSDCYWIWIRQFPGNKLEYMGYIFYSGITYYNPSLESRMYITRDTSKNQFFLKLSSVTTEDTATYYCAR
Mus pahari V578 ighv FMBV02002743.1 44905 VHSEVQLQQSGAELVSPGASVKLSCKASGYTFTDYYMHWVKQRPEQGLEWIGRIDPEDGDTAYAPEFQGKATLTADTSSNTAYMQLSSLTSEDTAVYFCA
Mus pahari V579 ighv FMBV02002743.1 31877 IQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDFYMTWVRQPTGKALEWLGFIRNKANGGTAEYGASVKGRFTISRDDSQNILYLQMNALRAEDSATYYCARD
Mus pahari V580 ighv FMBV02002745.1 31982 ILSEVQLQASGPGLVKPSQSLSLTCTVTGYSITSNYWFWIRKFPGNKLEHMGHISYSGDTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTAIYYCAR
Mus pahari V581 ighv FMBV02002745.1 2345 VQAQIQLVQSGPELKKPGDTVKISCKASGYTFTSNGMQWVQRTPGKGLKWIGWINTNSGVPKYAEDFKERFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus pahari V582 ighv FMBV02002746.1 210475 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMSWVRQAPGKGLEWVAHIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYFCTR
Mus pahari V583 ighv FMBV02002746.1 197061 VYSQIQLQQSGAELARPGASVKMSCKASGYTFTSYWIHWVKQRPGQGLEWIGAIYPGDGDTSYNQKFKGKATLTADKSSSTAYLQLSSLTSEDSAVYYCA
Mus pahari V584 ighv FMBV02002746.1 175339 VLSEITLKESGPGILQPSQTLSLTCTFSGISLSTSGMGLSWLRQPAGKALEWLASIWNNDNYYNPSLRSRLTISKETSNNQVFLKLTSVDTADTATYYCAWR
Mus pahari V585 ighv FMBV02002746.1 159558 VQCEVKLDESGGGLVQPGRSMKLSCAASGFTFSDYWMSWVRQSPEKGLEWVAQIRDKANNYATYYTDSVRGRFTISRDDSKSSVYLQMNSLKAEDTGIYYCT
Mus pahari V586 ighv FMBV02002746.1 106596 VQSDVNLEVSGGGLVHPGGSMQLSCAASGFTFIDGWMDWVRQSPEKGFEWVAEIANKASDYATYYAESVKGRFTISRDDSKSSVYLQMKSLRAEDTGIYYCT
Mus pahari V587 ighv FMBV02002746.1 91665 VQSEVKLEESGGGLVQPGRSMKLSCVTSGFTFTNYWMQWVRQSPEKGLEWVAEIRLKSNNYATYYVESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus pahari V588 ighv FMBV02002746.1 59862 VHSQVQLQQSGAELLRTGASVKISCKASGYTFTSYYVDWVKQRTVYSLEWIGRIIPGFGATDYAQKFKGKATLTADKSSRTVYMELSSLTSEDSAVYYCARQCC
Mus pahari V589 ighv FMBV02002747.1 171439 VHSEVQLQQSGAELVKPGASVKLSCKASGYTFTDYWMNWVKQRPGQGLEWIAYIRPGNGDTSYNQKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCW
Mus pahari V590 ighv FMBV02002747.1 165735 VHSQVQLQQSGTELVKPGASVKMSCKASGYTFTNYWMHWVKQSHGKSLEWIGYINPYNGGTGYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus pahari V591 ighv FMBV02002747.1 160956 VHSEVQLQQPGHKVVNAGDSVKLSCKSSGYSFSRFKMDWMKQIHGKSLKWIGDINLFNSGTNYNEKFKIKGILTVDISSCTAYMDLSRLTSEDSAVYYCA
Mus pahari V592 ighv FMBV02002747.1 148105 AHSQVQLQQSGAELVKPGASVKMSCQASGYKFNSFNIDWVKQSHGKTPEWIGYINPGNGATGYNQKFKGKATLTADTSSSTAYMQLSSLTSEDTAVYYCA
Mus pahari V593 ighv FMBV02002747.1 134430 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFIDYWMQWVKQRPGQGLEWIGEIYPGSGGTTYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSVVYFCA
Mus pahari V594 ighv FMBV02002747.1 126065 VHSQVQLQQSGAELVRPGASVKMSCKASGYTFTNYWMYWVKQSHGKTLEWIGNIYPGNGGTNYNEKFKGKATLTVDTSSSTAYMQLSSMTSEDSAVYYCA
Mus pahari V595 ighv FMBV02002747.1 111910 VHSQVQLQQSGAELVRPGASVKLSCKASGYTFNDYEIHWVKQSLKQGLEWIGAIHPGSGGTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYFCA
Mus pahari V596 ighv FMBV02002747.1 79003 VHSEVQLQQSGAELVKPGASVKLSCKASGYTFTDYNMHWVKQRPGQGLEWIGRIYPYNGDTRYNEKFKGKATLTADKSSSTAYMKLSSLTSEDTAVYFCA
Mus pahari V597 ighv FMBV02002747.1 75477 AHSQVQLQQSGAELASPGASVKLSCKASGYTFTDHIISWIKKRPGQGLEWIGRIYPVSGEINYNQKFMGKATFSVDQSSSTVYMVLNSLTSADPAVYYCG
Mus pahari V598 ighv FMBV02002747.1 38941 VHSQVQLQQSGAELVKPGASVKMSCKASGFTFSSNYIGWLKQKPGQSLEWIGYIYPGSGGTGYTEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCA
Mus pahari V599 ighv FMBV02002747.1 29448 IHSQVHLQQSGSELRSPGSSVKLSCKDFDSDVFPIAYMSWVRQKPGHGFEWIGDILPSIGRTLYGEKFEDRATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus pahari V600 ighv FMBV02002747.1 7039 VHSQVQLQQSGAELARPGASVKISCKASGYTFTSYWMPWIKQRPGQGLEWIGYINPSNGYTEYNQKFKGKATFTADKSSSTAYMQLSSLTSEDSAAYYCA
Mus pahari V601 ighv FMBV02002749.1 2079 VHSEVQLLQSGAELVKPGASVKMSCKASGYTFTDYYMYWVKQRPGQGLEWIGEINPYNGGTNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus pahari V658 iglv FMBV02004818.1 32774 FQPTLTQPDAFLVFPGQEAHLSCTIDSQHATVGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAARNACILTISPVLPEDDADYFCSI
Mus pahari V699 trgv FMBV02006595.1 38357 RQTSSNLEGRIMSITSSEGSSAIMTCDIHRTSNYIHWYRFQKGKAPERLLYYNFISSTAVMDSGFSSKKYLVYEGPDKRYKFVLRNVEESDSALYYCATWT
Mus pahari V700 trgv FMBV02006595.1 31346 GHGKLEQPEVSISRARDETVQISCKVIIESFRSVTIHWYRQKSNQGLEFLLYVLATPTHIFLDKEYKKMEASKNSSASTSTLTIYSLEEEDEAIYYCSYGK
Mus pahari V701 trgv FMBV02006595.1 25663 SEGSSLTSPLGSYVIKRRGNTAFLKCQIKTSVQKPNAYMHWYQEKPGQRLQRILCTSSKENIVYEKGFSEERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus pahari V702 trgv FMBV02006595.1 23872 GDAMISQDQLSFTRKPNKTVHISCKLSGVTLQNTIVHWYQLKEGEPLKRIFYGSPKTYKQEKPNSRLEIDERDDGTFYLIINNVVTSDEATYYCAYWN
Mus pahari V830 trav FMBV02011613.1 21112 SWSLAKTTQPASMEAYEGQEVNVSCSHTNIATSEYIYWYRQVPHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPWVSLRDTAVYYCIVT
Mus pahari V831 trav FMBV02011613.1 6864 VSRGEQVEQRPPHLSVREGDSAAIICTYTDPNSYYFFWYKQEWGAGLQLLMGVFSNVDRKEEQGLTVLLNKKDKILYLNITTVHLGNSATYFCAAS
Mus pahari V832 trav FMBV02011615.1 119888 VSRGEQVEQRPPHLSVREGDSTAIICTYTDPNSYYFFWYKQEPGAGLQLLMKVFSSMEINEGHGFTVLLNKKDKRLSLNITAAHPGDSATYFCAVS
Mus pahari V833 trav FMBV02011615.1 106785 DAQAQSVTQPDARVTVSEGASLQLRCNYSTSGTPYLFWYVQYPRQGLQLLLKYYSGDQVVQGLNDFEAEFSKSDSSFHLRKAAVHWSDSAVYFCALR
Mus pahari V834 trav FMBV02011615.1 97838 GVRGDQVEQSPSALSLHEGSNSALRCNFSTTMRSVQWFRQNSRGSLISLFFLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAE
Mus pahari V835 trav FMBV02011615.1 87271 MSQGEQVEQLPSVLRVQEGSSAIINCTYENSASLYFPWYKQEPGENLKLIIDIRSNMERKQIQGLLVLLDKKAKRFSLHITDTQLGDSAVYFCAAS
Mus pahari V836 trav FMBV02011615.1 80158 RAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASRDKEKGSSRGFEATYDKGATSFHLRKASVQESDSAVYYCALS
Mus pahari V837 trav FMBV02011615.1 75580 VNSQQKVQQSPESLVVPEGATASLNCTFSDSASQSVWWYRQHPGKGPKALISVFSNGNKKEGRLTVYLNRASLHVSLHIRDSQPSDSAVYLCAAS
Mus pahari V840 trav FMBV02011615.1 45525 TSMAQKVTQTQTSISVMEKTTVTMDCVYETQDSSYYLFWYKQTASGEMVFLIRQDSYKKENTTEGRYSLNFQKPKSSIGLIITATQSEDSAVYFCAMRE
Mus pahari V841 trav FMBV02011615.1 37004 VKGQQVQQSPVSLVLQEGEIAELRCNFSSTATQLQWFYQRPRGSLISLLYNPSGTKKSGRLTSTTVTNERRSSLHISSAQTTDSGTYLCAMDPQCS
Mus pahari V842 trav FMBV02011617.1 3952 VVTQQLEQSPQFLSIQEGQDFTAYCSSSTTFPQFYWYRQVPREGPVILMTLVKSGEVKEQKRMTAKFGEARKNSSLFITRAQPGDVGTYFCAG
Mus pahari V843 trdv FMBV02011619.1 294784 KDVLCITLTQSSPDQTVASGSEVTLLCTFEVDFSNPDLFWYRKRLDGSFQFILYRDNTRSHDADFVQGRFSVKHSMAYRTFHLVISPVRLEDSATYYCASG
Mus pahari V960 igkv FMBV02015424.1 16836 SSGDVVMTQTPLSLSVSIGQPASISCKSSQSLLHSDGNTYLNWLLQRPGQSPKRLIYQVSKLGSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCCQV
Mus pahari V963 igkv FMBV02015554.1 28800 SSVTGETTQSPASLSFSLGETATLICRSSESVGSYLAWYQQKAEQVPQLLIHSASTRAGGIPDRFSGTGSGTDFTLTISTLEPEDAAVYYCQPFRSWS
Mus pahari V964 ighv FMBV02015648.1 1072 VHSEVQLQQSGAELVKPGASVKLSCKASGYTFTSYDINWVKQRPGQGLEWIGYIYPGNGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSEDTAVYFCA
Mus pahari V965 igkv FMBV02015684.1 5285 SSGDVVMTQTPTSLSVTIGQPASISCKSSRSLLDSDGKTYLNWLLQRPGQSPKRLMYLVSKLDPGIPVRFSGSGSETDFTLKVSSVEAEDLGVYYCWQGTYI
Mus pahari V966 igkv FMBV02015740.1 8457 VDGDIVMTQSHRFMSTSVGDRVSIPCKASQNVGTAIAWYQQKPGQSLQLLIYGASNRFTGVPDRFSGSGSGTDFTLTISNVQAEDLADYFCQQHSSYP
Mus pahari V967 trav FMBV02015746.1 41394 MRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGEGLQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCALG
Mus pahari V968 trav FMBV02015746.1 29288 VRSQQKVQQSPESLSVPEGATASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGEKKEGRFTAHFNKVSLHVSLHIRDSQPSDSALYFCAAS
Mus pahari V969 trav FMBV02015746.1 21562 VNSQLAEENPWALSIHEGENVTVNCSYKTSITALQWYRQKSGEGPALLILIRSNEREKRSGGLRVTLDTSNQNSSLSITAAQSEDTAVYFCATD
Mus pahari V970 trav FMBV02015746.1 8965 VQTQTVSQSDAHVTIFEGDSVELRCNYSYGGSVYLAWYIQHHGRGLQFLLKYYSGSPVVQGVNGFEAEFIKSNSSFHLRKASVHWSDSAVYFCALS
Mus pahari V971 trav FMBV02015746.1 5807 ESNGDSVTQTEGQVTLSEGTSLTVNCSYETKEYPALFWYVQYPGEGPQLLFRASRDKEKGSSRGFEATYDKGATSFHLRKASVQESDSAVYYCALG
Mus pahari V972 igkv FMBV02015866.1 10062 STGDTVLTQSPASLAVSLGQRATISCTASKSVDSYGISLMNWYQQKPGQPPKLLIYGASNLESGVPARFSGSESGTDFTLTINPIEDDDVADYYCQQSNEFP
Mus pahari V973 igkv FMBV02015970.1 14360 STGDIVLTQSPASLAVSLGQKATISCEASESVDFAGTSLMHWYQQKPGQPPKLLIYGASNLESGVPARFSGSGSGTDFTLTINPVEADDAADYYCQQGNELP
Mus pahari V974 igkv FMBV02016181.1 63537 ARCDVQMTQSPSSLSASLGETVKINCLASQGISSNLNWYQQKPGKAPKLLIYGASILEDGVPSRFSGSGSGTDFTLTISSLEDEDMATYFCLQHSNLP
Mus pahari V975 igkv FMBV02016181.1 14451 AQCDVQITQSPSYLAASPGDTITINCRASKSINKYLAWYQEKPGKPNKLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAVYYCQQHNEYP
Mus pahari V977 igkv FMBV02016275.1 5434 STGDIVLTQSPASLAVSLGQRATISCKASESVSTSMYWYQQKPGQPRKLLIYHASNLESGVPPRFSGSGSGTDFTLTINPVEADEVATYYCQQGWELP
Mus pahari V978 trgv FMBV02016286.1 2732 GLGQLEQIEVSVTRATDRSAQISCRVSLPDFYNTYIHWYRQKTNQEFEYLIYVRTNYNQRRLGGKNKKIEATKDLQTSTSTLKLNYLKKEDEATYYCAAWI
Mus pahari V979 igkv FMBV02016531.1 11713 STSDIVMTQSPASLAVSLGQRATISCRASKGVSTSMHWYQQKPGQPPKLLINGASNLESGVPPRFSGSGSGTDFALTINPVEDDDVADYYCQQGNEFP
Mus pahari V980 igkv FMBV02016531.1 3087 STGDIVLTQPSASLAVSLGQRATISCKASKSLNVLLSTSALNWYEEKPGQQLKLLIYSASNLESGVPARFSGSGSEMDFTLTMDPVEDDNTAPYYCQHSRELP
Mus pahari V982 igkv FMBV02016669.1 90627 ARCDIQMTQSPASLSASVGETVTITCEASEDIYSDLNWYQQKPGKSPQLLIYTANNLEDGVPSRFSGSGSGTQYSMKINSMEPEDSATYYCGQGTEYP
Mus pahari V983 igkv FMBV02016669.1 62829 SRGDILLTQSPAILSVTPGERVSISCRASQNIGTSIHWYQQKTNGSPRLLIKYASGSISGIPSRFSGSGSGTDFTLNINSVESDDVASYFCQQSNSLP
Mus pahari V984 igkv FMBV02016669.1 45440 VMSRGEIVLTQSPALMAASPGEKVTMTCSASSSVSTSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDVATYYCYQHSSS
Mus pahari V985 igkv FMBV02016669.1 17715 IMSRGDNVLTQSPAFMTASPGEKVIMTCSASSSVSTSYLHWYQQKSGSSPKRLIYRTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQWSGYP
Mus pahari V986 igkv FMBV02016669.1 1959 RVSSGEIVLTQSPAIMAASLGEKVTMTCSASSSVSNIYWYQQKSGASPKLWIYRISNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCCQWSSN
Mus pahari V987 igkv FMBV02016703.1 1637 ARCDIQMTQSPASLSVSVGESVSITCLASENIYSALHWYQEKPGKTPQILIYGTISLGDGVPSRFSGSKSGTQYPLKISSLHPDDVATYYCEQSYKYP
Mus pahari V988 trav FMBV02016902.1 78742 DAQAQSVTQPDARVTVSEGASLQLRCNYSSSVTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFKAEFSKSDSSFHLQKAPVHWSDSAVYFCAL
Mus pahari V989 trav FMBV02016902.1 69956 GVRGVEVEQSPSALILQEGTSSVLRCNFSTAMTTVQWFLQNPRGSLINLFYLVPGTKENGRLTSTFSSKERYSTLHIRDTQPEDSGSYFCAAE
Mus pahari V990 trav FMBV02016902.1 53680 RSNGDSVTQTEGQVTLTEGLPVMLNCTYQTAYSPFLFWYVQYLNEAPRLLLKTSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mus pahari V991 trav FMBV02016902.1 51780 DAQAQSVTQPDAPVTVSEGASLQLRCKYSYSGVPYLFWYVQYPRQGLQLLLKYYSGDPVVQGLNGFKAEFSKSDSSFHLQKASVHWSDSAVYFCALS
Mus pahari V993 trav FMBV02016902.1 33198 RSNGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNAFLFWYVQYLNEAPRLLLRTSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mus pahari V994 trdv FMBV02016902.1 11387 CNVAQKVTQVQSTASSQWGEELILDCSYETSDVFYHLFWYRQLLSGEMVFLIYQPSVDTQNQRSGRYSVVFQKSSKSISLVISASQPEDSGKYLCALSEL
Mus pahari V995 igkv FMBV02017077.1 3143 GKCDIQMTQSPASLSASLGESVTITCLASQTIGKSLAWYQQKPGKSPQLLIYAATSLADGAPSRFSGSGSGTKFSFKISSLQAEDFGTYYCQQVYSNP
Mus pahari V996 igkv FMBV02017155.1 39099 ARCDIQMTQSPSILSASLGERVTITCHASQSIKSWLAWYQQKPGNSPKLLIYEATKLQTGMPSRFSGSGYGTYFTLTISSLQSEDIAIYHCLQHETC
Mus pahari V997 igkv FMBV02017169.1 4407 SSGDVVMTQTPTSLSVTIGQPASISCKSSRSLLDSDGKTYLNWLLQRPGQSPKLLISLVSRLFSGVPDRFSGSGSETDFTLKISSVEAEDLGVYYCWQGTYIP
Mus pahari V998 igkv FMBV02017223.1 35160 IVSNGEIVLTQSPTTMAASPGEKIIITCSASSSINSNYFHWYQQKPGFTSKLLIYRTSKLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQGSSL
Mus pahari V999 igkv FMBV02017274.1 9839 SSGDIVMTQTPLTLSVSIGQPASISCKSSQSLLHSDGNTYLNWLLQRPGQSPLLLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVKAEDLGVYYCYQG
Mus pahari V1001 igkv FMBV02017361.1 11283 SRGDIVLTQSPATLSVTPGESISVSCRASQSISNNLHWYQQKSNESPRLLIKYASQSISGIPSRFTGSGSGTDFTLSINSVEPEDFGMYHCQQSNSW
Mus pahari V1002 igkv FMBV02017427.1 349398 IVSSGEIVLTQSPALMAASPGEKVTMTCSASSSVSTGYLHWYQQKSGASPKPWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQWSSN
Mus pahari V1003 igkv FMBV02017427.1 222814 SRGEIVLTQSPAIIAASPGQKVTMTCSASSSVSTSYLNWYQQKSGTTPKPWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQWSGSP
Mus pahari V1004 igkv FMBV02017427.1 202849 SSGEIVLTQSPALMAASPGEKVTMTCTASSSVSTSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDFATYYCQQWSSNQ
Mus pahari V1005 igkv FMBV02017427.1 184242 IMSRGEIVLTQSPAIMAASPGEKVTITCSASSSVSYMNWYQQKPGSSTKPWIYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDFATYYCQKCCGN
Mus pahari V1006 igkv FMBV02017427.1 162558 IVSSRGIVLTQSPATMTASPGEKVTITCSASSSINYIYWYQQKSGTAPKQWIYKTSDLPFGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQFTSSP
Mus pahari V1007 igkv FMBV02017427.1 151218 SRGEIVLTQSPAIIAASPGQKVTITCSASSSVSYVHWYQQKSGASPKLWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCLQWSSN
Mus pahari V1008 igkv FMBV02017427.1 126320 VSCDIQMTQSSPFLYASLGDHLTINCRASKDINKYFAWVQQKPGKAPRMLIHFASTLLPGVPEKFSGSGSGTDFSLTIRNIESEDIAMYYCLQYSEHP
Mus pahari V1009 igkv FMBV02017427.1 85691 VRCDIQMTQSTASLSGSVGESVSITCQASEDIYSALNWYQQKQGKSPQLLIYGATNLADGTSSRFSGSGSGRQYSLKISSLHPDDVATYYCQNGLSTP
Mus pahari V1010 igkv FMBV02017427.1 41955 ARCDIQMTQSPASLTASVGETVTISCQASKNIYNYLAWYQQKPGKSPQLLIYAANSLADGVPSRFSGSGSGTQFSMKINSMQPGDAATYFCGQSYEYP
Mus pahari V1012 igkv FMBV02017427.1 8024 IVSNGKIVLTQSPAIMAASPGERVTITCSASSSISYINWYQQKSGTTPKPWIYSTSNLASGVPARFGGSGSGTSYSLTISSVEAEDVATYYCQDWSGSP
Mus pahari V1013 igkv FMBV02017502.1 17874 STGDIVLTQSPASLAVSLGERATISCTASQSIDYYGDNYMHWFKQKPGQPPKLRIYDASNLESGVPDRFSGSGSGTDFTLNINPIEDDDTAIYYCQQSRKDP
Mus pahari V1014 ighv FMBV02017564.1 1125 VLSQVQLKESGPGLVQPSQSLSITCTVSGFSLTVYGVHWVRQSPGKGLEWMGVIWSGGSTNYNSALKSRLTITRDTSKSQVFLKLNSLQTDDTAMYYCAR
Mus pahari V1015 igkv FMBV02017590.1 2063 ARCDIQLTQSPASLSTSVGETVTITCQASENVNSYLHWYQQKQGKSPQLLVYAATNLADGVSSRFSGSGSGTQYSLKINSLQPEDIADYFCQHSYGT
Mus pahari V1016 igkv FMBV02017656.1 11369 ACADIVMTQSPTSLAVTASKKVTISCTASESLYSSKHKVNYLAWYQKKPEQSPTLLIYGASNRYTGVPDRFPGSGSGTDFTLTISSVQAEDLTDYYCVQFYSYP
Mus pahari V1018 igkv FMBV02017818.1 26950 VSGDVVITQDELSNPVTSGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLISLMSTRALGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQILEYP
Mus pahari V1019 igkv FMBV02017818.1 8739 SSSDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLSWYLQKPGQSPQLLIYRVSIRFSGVPDRFSGSGSVTDFTLKISRVEAEDLGVYYCFQG