WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Castor canadensis MTKA00000000.1 (MTKA01) 229 86 33 31 39 23 8 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Castor canadensis V1 trbv MTKA01000335.1 403262 SVKAEITQIPKHLVTEKGTNRMLTCEQNLGHNAMYWYRQSTKKTVELMFSYNYKELVKNETVSNRFTPKNPDNSQLQLRVDALEPEDSAVYLCASSQ
Castor canadensis V2 trbv MTKA01000335.1 404749 HMEPGVTQIPSHQVTKMGQMVILSCDPISGHLYFYWYRQILGQRMEFLVSFYNDKPSEESEIFKDGFSVERTDGSYFTLKIHATRLGDSAMYFCASSF
Castor canadensis V3 trbv MTKA01000335.1 414359 SVDTAVSQSPKYLITQVGNKMSLKCEQILGHNAMYWHKQDSKQLLKIMFSYNVQELTLNETVPSRFSPESPDKAHLNLHVKSLEPEDSAVYLCASSQ
Castor canadensis V4 trbv MTKA01000335.1 438400 TADADITQTPKSQVLKTGKHVKIECLQDMNHNNMFWYRQDPGLGLRLLYYSYGVRSTEKGEVPDGYNVTRPCTEDFLLTLESATPSQTSVYFCASSL
Castor canadensis V5 trbv MTKA01000335.1 459874 SVDAGVIQSPRYLIKAKGGKSTLQCFPISGHISVSWYQQTPDQGPQLLIEHYEKMPRNEENIPNRFTAQQFNDYHSELNMSALELGDSAVYLCASSL
Castor canadensis V6 trbv MTKA01000335.1 477422 SVETAVSQSPKYLITHVGNKICLKCEQNLGHNSMFWYKQDSKQLLKIMFSYNVKELTLNETVPSRFSPESPDKAHLNLHVKSLEPEDSAVYLCASSQ
Castor canadensis V7 trav MTKA01001743.1 597357 TQGAGVEQPAGLTAVEGALVQVNCTYGTSGFNGLSWYQQRAGGAPVFLSYIVLDELQTRGRFSTFLSRSDRHSHLLLRKLRVTDSASYLCAVS
Castor canadensis V10 trdv MTKA01002752.1 156088 KGMLCDKVTQSSQDQMVTSGSEITLFCTYQTTLLNPDLYWYRRRADQSFQFILYRDNTRSRDAEFVQRRFYVKHSQTHKTFHLVINPVRTEDSATYYCALS
Castor canadensis V11 trgv MTKA01002790.1 198541 SPSKLERSTMSITKPTGSSIIITCDIQRETNYIHWYQLKERNGPQHLLYYDHFISQPVVDTGLSSGKYHAYEGTEKSCKFVLRNLDENDSGVYYCAIWT
Castor canadensis V12 trgv MTKA01002790.1 202052 GSQMSSNLEGRMLSITRPTGSYAVITCDIHRKRNYIHWYHFKEGKAPKYLSYYDILKSTHVLVSELSQRKYDSYEGTDRSYKFVIQNVDKSDSGIYYCATWT
Castor canadensis V13 trgv MTKA01002790.1 204726 SQTSSNLEGKMISITRSTGSLIAISCDFYEEGSYIHWYQSKEGKAPQRLLYYDFFYSRPVIDSEFSSKKYHAYAGTDKNYKFVLRNADESDTGIYYCATWT
Castor canadensis V14 trgv MTKA01002790.1 223777 EQSQISVFSEVKKSVYIHCKIWSTNFENEVIHWYWQKQNQALEHLVHVASTKSPAKSSVRGSVVGGSSKVEAIKDPQSFSSTLIINFIEKEDEAIYYCAGWD
Castor canadensis V15 trgv MTKA01002790.1 229587 GLGQLKQPVFSISRAIDGSAQVSCKASINSFKSVAIHWYQQKPNQGLEYITYVIGAYTKLSLDGKDKKLEASKNYSTSTSTLKINFLKKEDEATYYCAYGY
Castor canadensis V16 igkv MTKA01003159.1 22443 STGDIEMIQTPLSLLITSGEPASISCRSNQSLLNSDGNTYLNWLVHKPGQSPQRLIYKISNRDSGIPDKFSGSGSGTDFTLKISSVEVEDVGVYYCMQ
Castor canadensis V17 trav MTKA01003934.1 12360 ASVAQTVTQSQPEMSVQETETVTLSCTYDTGDNNYYLFWYKQLSSGQIIFIIHQESYKLQNATKNGFSVNFQKAAKSFSLKIINSQLGDAARYFCA
Castor canadensis V18 trav MTKA01003934.1 18191 PSVAQIITQSQAEIYVQEAEMAILGCTYDTKESNYYLFWYKQHPSGQLVFIISQEAYTQQNATESRFSVNFQKAAKSFSLKISDSQLGDAAMYFCALK
Castor canadensis V19 igkv MTKA01005301.1 3421 AYGDIVMTQSPSSLAASAGERVTINCKSSQSISSNLAWHQQKPGQPPRMLIYAASNRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCLQHYSY
Castor canadensis V20 trav MTKA01005601.1 16363 AKGKNQVEQSPHSLRPQERDVTSMSCTYSVSGFNGLQWYRQDSGRGLKHLFSIFSAGDVKQEGRLRATLLRNGSSLHITALQPEDSATYFCAV
Castor canadensis V21 ighv MTKA01006417.1 39518 VQCKVKQVESGGGLVQPGGALKLSCAASGFTFSDFYMDWVHQAPGKGLECVARIRNKANSHTTEYNASVKGRYTISRDDDKNMLYLQMNSLRDEDTAMYYCVT
Castor canadensis V22 ighv MTKA01006417.1 65369 VLSQVQQQDSGPGLVKPSETLSLICTVSGYSITSGYDWHWICQPPGKSLECIVYISYSISSNYSLSLKSHISISREKSKNQFSLQLSSVTTEDRAVYYCAR
Castor canadensis V23 ighv MTKA01006417.1 101982 VLSQVQLQESGPGLVKPSQTLSVTCAVSGASISSYGWSWIRQPSGKSLEWMGYINYGGSTSYSPSLKSRISISRDTSKNQFSLQLSSVTSKDTATYYCTS
Castor canadensis V24 ighv MTKA01006417.1 113161 FSLFAGVQCEVQPGGGLVQLGGALKFSCAASVFTFSRPMGWGRQPLGKGLEFIASISSSGGSTYYADSVKGRVTISRDNNKNQLYLQMNSLRAEDTAVYYCAR
Castor canadensis V25 iglv MTKA01006517.1 39976 SWAQSALTQPPSASGSLGQTATISCTGTSSDIGSYNAVSWYQKQPGANHKLLIYNVNSRPSGISDRFSGSKSGNTASLTISGLQPEDEADYYCASYAGS
Castor canadensis V27 trav MTKA01006562.1 39380 VVADSKVTQPNSMEITEEEPVHLPCNHSTIATDEYIHWYRQIPLQGPEYIIHGLKGKVTNRMASLTIPADRKSSTLILPHASLRDTGVYYCILR
Castor canadensis V29 igkv MTKA01007832.1 142877 ASCDTQMTQTPSSLSASPGDKVTITCRASQSISNYLNWFQQKPGNALKLLIYNTNSLESGIPSRFSGSGYGTDFSLTISSLEPEDVGTYFCQQYDEL
Castor canadensis V30 igkv MTKA01007832.1 244544 SSGVVTMTQTPLSLSLTPGEQASISCKSSKSIQHSDGNTYLSWLRQKPGQSPQLLIYKVSTRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQATKLP
Castor canadensis V31 igkv MTKA01007832.1 305770 ARCDIQLTQSPSSLSATLGDRVTITCRASKNIYSSLAWYQQKPGKAPKLLIYNANSLDSGVPSRFSGSGSGTDYTLTISSLESGDAATYYCQQYSEYP
Castor canadensis V32 igkv MTKA01007832.1 317219 VRCDIQLTQSPASLSATLGGRVTITCRASKNIYSNLAWYQQKTEKAPKLLIYNANSLDSGVPSRFSGSGSGTDYTLTISSLESGDAATYYCQQYSEYP
Castor canadensis V33 trav MTKA01008125.1 18571 VSSQQKEVEQHPESLSVAEGAMASLNCTYRDSASQSFRWYRQYPGKGLELLVSTFSIGDKDEGRYTAHLNKASRYFSLHIRGSQPSDLATYLCTV
Castor canadensis V34 trav MTKA01008125.1 72483 RSSGDSVTQTEGPVTLTEGTPMFLNCTYQITFSISFTFWYVQYLHEAPQLLLKSSTESQRTENKGFQATLVKSNSSFHLQKSSLLLSDSAVYYCAVR
Castor canadensis V35 trav MTKA01008125.1 89497 LHGKDEVEQSPEILRLLEGDSGSLNCSYTTSYFRGLHWYRQDPGKGPKFLFSLHSAGDTKDKDRLKATLSKMGSSLHITTPKPEDSATYLCAVD
Castor canadensis V36 trav MTKA01008125.1 100973 VKGMQVEQRPSSLIIQEGNNSTLQCNFSASVTSVQWFLQNPGGRLINLFYVPSGTKRNGRLTATTVTRERHSSLYISSSQNTDSATYFCAVDPQCSP
Castor canadensis V37 trdv MTKA01008125.1 112970 SSVAQKVTQVPTAKSRQQGKEVVLHCSYETSQHSYYIFWYKQVPSGEMIFLIRQSSAGQNARNSRYSVYFQEPVKTISLTISALQLEDSAKYFCALWE
Castor canadensis V38 trav MTKA01008125.1 130500 GSGAQSVTQIDSHVAVSEGAPLELRCNYSYRATLYPYWYVLYPNQGLQLLLKYLVRDPLVKGIKGFEAEFRKSENSFHLKKASAHWSDTAVYFCAVS
Castor canadensis V39 trav MTKA01008125.1 145605 GLSAQQLEQSPRLLTVQEGENLIMYCNSSTIFPSFQWYRQKPGEHPVFLMALVKVGDVKKQKRMAAWLGEARKSSSLNICMVQPEDAGTYLCAG
Castor canadensis V40 trav MTKA01008125.1 160199 NSQQKNGDQQVKQNSPSLTVKEGDTSILNCDYNNNMLDYFAWYKKYRDNGPTFLISVRSIVEKNEDGKFTIFLNKSAKHFSLQIASSQSEDSATYLCAAS
Castor canadensis V41 trav MTKA01008125.1 219809 VVTDSKVTQPNSMGSTEEEPVHLPCIHSTISGSEYIYWYRQILLQGPEYIIHGLKGNVTNGMVSLAIPADRKSSILILPHASLRDTGVYYCILR
Castor canadensis V42 ighv MTKA01008680.1 45297 TAGGVWGGLVQSGGTLKLSCTASGFIFGSYAMGWVCQAPGKGLEWMAEINSGGSYTYYPDSVKGRFTISGDNNKNQLHLQMNSRRAEDTAVYYCTR
Castor canadensis V43 ighv MTKA01008680.1 76470 VLSQVQLQESGSGLVKPSQTLSLTCAVSGYSITSDYYWSCICQPLGKSLKWMAYISYGGSNYYSTSLKRDVSITRDTSKNQFSLQLSSVTTEDTAVYYCAI
Castor canadensis V44 ighv MTKA01008816.1 33668 VLSQGQLQESGRGLAKPSETLTLTCTITGVSLPSCHMHWMRQPPQKGLEWVGVLWSNGNTGYNSALKFLLSITRDTSKNQVTLALSSLIAEDTAMYYCAR
Castor canadensis V45 igkv MTKA01008837.1 184096 TSGNPLLTQSPNFLSVTPGESISIICTANESVSDYLTWYQQKPGQAPKILIYDADNLYSGVPDHFMGLQSGTEFILKISKVKVDGIATYYCQQG
Castor canadensis V46 trav MTKA01009212.1 27655 RSSGDSVTQTEGPVTLTQGKPMFLNCTYQTTYSIPFTFWYVQYLNETPQLLLKISTESQRTENQGFQATLVKSNSSFHLQKSSLLLSDSAVYYCAVR
Castor canadensis V47 trav MTKA01009212.1 43633 GLHGKDEVEQSPETLRLLEEDSGSFNCSYTTSNFRGLYWYRQDPGKGPEFLFPLYSVGDKKDKDRLRTMLAKKGSSLHIITPKPEDSAIYLCAVD
Castor canadensis V48 ighv MTKA01011581.1 18579 IQCEVQLVESGGGLVKPGGSLRLSCAASGSTFSDYAMNWVRQAPGKGLEWVAVIEYDSSEKYYADSVKGRFTISRDNAKNELYLQMNSLNVDDTATYYCAR
Castor canadensis V49 ighv MTKA01011674.1 25194 VQCEVQLVESGGGLVKPGGTLKLSCAASGFTFSSYAMGWVRQAPGKGLEFIAVISSNGGSTYYPDSVKGRFTISRDNNKNELYLQMNSLTAEDTAMYYCAR
Castor canadensis V50 trbv MTKA01013253.1 28099 YTESTITQNPRHKVTETRRKVALSCHQTYKHDYMYWYRQDPGHGLRLIHYSYDVNNTEKGEVSDGYSVSRSSTEEFPLTLESATTSQTSVYFCASSD
Castor canadensis V51 trbv MTKA01013253.1 37992 SLDTAVSQTPKYVITQVGKKNSLKCEQNLGHNTMYWYKQAFKQSVKIMFSYNSQKLILNETVPSRFSPESPDRAHLNLHVTSLEPEDSAVYLCTSSQ
Castor canadensis V52 trbv MTKA01013253.1 41052 PMDSRIIQTPRYLSMGTSNKKSLKCEQHLGHNAMYWYKQNANKSPELMFLYNFKKLVQNESVPSRFSPDCSDSSLLFLHMAFLEPKDSATYLCASSQ
Castor canadensis V54 trbv MTKA01013253.1 84129 HMEATITQSPRYKVTETGGKVTLSCHQTDNHDCMYWYRQNPGHGLKLIHYSFAVNSTEKGDVPDGYSVSRLKKKDFPLSLESATHSQTSVYFCASSF
Castor canadensis V55 trbv MTKA01013253.1 111839 SLDEVTQTPRHLVKGKDQKVKMHCVPRKGHIYVFWYQHILAKEFKFLISIWNENVLDDSGMPKERNFSAKCPKNSSCFLEIQPSELQDSAVYLCASSE
Castor canadensis V56 trbv MTKA01013253.1 126764 LKNASVTQSPRHLVKRRGQEATLKCIPEKGHSYVSWYQQLPEEGLKFMIYLQKGSIIDDSGMPTKRFSAEFPREGPNVFKIELAELGHSAVYFCASSA
Castor canadensis V57 trbv MTKA01013253.1 129095 TIDGGVTQTPKFMIREKAHGVTLECEQNLDHDAMYWYQQDPGQGLRLIYYSQIVNDVQKGDLAEGYSASQEKKPLFLLTVTLAQKNQTALYLCASSM
Castor canadensis V59 trbv MTKA01013253.1 142204 YVSSSTVSTDTEVTQSPRHVVKQKAKIDCIPVKGHSYVYWYRKKLEEELKFLLYFQNEDIMEKTEFINERVSAQCPANSSCSVEIQSTELADSGLYFCASSQ
Castor canadensis V60 trbv MTKA01013253.1 149373 FLEARVIQNPRHLVKGKGGKAKMGCTPKKGHNFVFWYQQNQNKVFYFLSKPRDFEQTNVIKERFSAKCPPNASCSLEIQSSEPGDSALYLCARSQ
Castor canadensis V61 trbv MTKA01013253.1 152559 CFDTKVAQTLRHLVKMKGKIVKMLCIPPKGHTVIYWYQNHNKDLKFLICFQNQQLLDQIDMIKGHFIAECPPNSPCSLEIQSSDKGDSALYLCASSQ
Castor canadensis V62 trbv MTKA01013254.1 19606 LGFKDAMVTQFPRYKTSRTGKELTLLCSQNMNHFSMYWYRQDPGLGLQLTYYSTGIGSIEKGDVFKGYHVSRKEQEHFPLTLESASTNQTSVYFCASRL
Castor canadensis V64 trbv MTKA01013254.1 42827 TDLVDMKVTQTPRYLAKRVGEKVLLECSQDMGHERMYWYRQDPDLALQLIHFSYDVDNNEKEDIPQGYNVSRKKREHFSLIVESASTKHTSLYLCASSL
Castor canadensis V65 trbv MTKA01013254.1 53625 GSVCGILLYQKPNRNICQHGTSMKIECQVDSQVSMMYWYRQFPGQSMMLIATANQGAEATYESGFTKDKFSITRPNLTFSTLTVKNMSPDDSSFYLCSAE
Castor canadensis V66 iglv MTKA01014673.1 115627 SWAEVVFTQPQSVSGYPGQTISIYCALNSGSINNNYASWYQQHAGSSPKMLIYKYNERPIGVPNRFSGSKDSSSNSASLTISELQPEDEAYYHCLSGYVSY
Castor canadensis V67 iglv MTKA01014674.1 16758 SWAEVVFTQPQSVSGYPGQTISISCTLSSGSIDNNYASWYQQHAGSSPKMLIYKYNERPIGVPNRFSGSKDSSSNSASLTISELQPEDEAYYHCLSGYVSY
Castor canadensis V68 iglv MTKA01014675.1 9573 VNSQTVVTQESSSLVSPGGTVILICGLNSGSVSTGYYPNWFKQIPGQAPYTLIYSTNCLSGVPDCFSGASTGNKASLTITGAQMEDDADYYCALFMGSGI
Castor canadensis V69 iglv MTKA01014675.1 38192 SWGQSVLTQTPSVSGNLGQSVSILCTGSSSNIGSYNVYWYQQLPGTSPKLIIYEDNKRPSGVPDRISGSKSGNSATLTIAGLRSEDEADYYCQSADD
Castor canadensis V70 iglv MTKA01014675.1 60472 VNSQTVVTQEPSLSVSPGGTVTLTCGLNSGSVSTSNYPSWYQQIPGQAPYMLIYNTNNRPSGIPDRFSGAITGNKASLTITGAKMEDDADYYCALYMGSYI
Castor canadensis V71 iglv MTKA01014675.1 71184 SWGQSVLTQRPSVSGNLGQSISILCSGSSSNIGGYYVHWYQQLPETSPKLICDDSKIPSGISDHFSFSKSGNSATLTVAGLHSEDEADYYCQSYDNSLGA
Castor canadensis V72 iglv MTKA01014675.1 136791 SLSQPVLTQMSSVSAFLGSSARLNCTLSSGFEVPGYHISWYQQKTESMPQFLLRYYSDSDKYQGPGVPSRFSGSKDASASAGILLISGLQPEDEADYYCATYHG
Castor canadensis V73 iglv MTKA01014675.1 199800 SLSQPVLTQISSVSASPGSSARLMCTLSSGFKVPGYHISWYQQKTENAPQFLLRYYSESDKYQGPGVPSRFSGSKDASANAGILLISGLQPDDEADYYCGTYHG
Castor canadensis V74 iglv MTKA01014675.1 219031 SWAQSVLTQPSSVSGNLGQKVTISCAGSSSNIGTYNVHWYQQLQGTSPKLLIYDNSKRPSLIPDRFSGSKSGNSGTLIIMGLQPEDEADYYCKSYDDNFN
Castor canadensis V75 iglv MTKA01014675.1 242084 SWAQSVLTQPSSVSGNLGQKVTISCAGSSSNIGTYNVHWYQQLQESSPRLLIYGNSNRPSGVPDRFSGSKSGNSATLTITGLQPEDEADYYCHTYDKSLSA
Castor canadensis V76 iglv MTKA01014675.1 271958 SWAQSVLTQPSSVSGNLGQKVTISCAGSSSNIGSYYVYWYQQLQGSSPKLLIYDNNNRPTGIPDRFSGSKSGSSATLTITGLQPEDEADYYCQSYDSSLSV
Castor canadensis V77 ighv MTKA01014890.1 35825 VLSQVQLQESGPGLVKHSQTLSLNCGVSGVSITTNPYFWDWIRQFPGKSLEWMGTICYYGSTSYSPSLQSRISISRDTSKNQFNLQLGSVTTEDTAMYYCA
Castor canadensis V78 ighv MTKA01014891.1 8734 QLVESRGGLVKPGGSLKLSCAASGFTFSNYAMYWVHQSPGEGLEWLSSISGNGGSTNYADSVKGRFTISREISKNTLYLQMNSQRADDTTTYYCAR
Castor canadensis V79 ighv MTKA01015107.1 36596 VLSQVQLQESGPGLVKPSQTLSLTCAVSGASISSYAWSWIRQPPGKSLEWIGYINSGGSTSYNPSLKSRISISRDTSKNQFSLQLSSVTAEDTATYYCTR
Castor canadensis V80 ighv MTKA01015108.1 36838 VQCEVKLVESGGGLVQPGGSLRISCAASGFTFSNYYMDWVRQAPGKGLEWVSLIRNKANSYTTEYNASVKGRFTISRDDEKNMLYLQMNSLRDEDTAMYYCAR
Castor canadensis V81 ighv MTKA01015110.1 74442 THSQVQLTQSGAELKKPGETVKISCKASGYTFTSYGMNWVKQEAGKGLQYIGWINTANGNTGYAEGFKGRFVISMDASVSTTYLQISSLKAEDTAVYYCA
Castor canadensis V82 ighv MTKA01015110.1 122444 VLSQVQLQESGPGLVKLSQTLSLTCAVSGASLSSYDWAGSASVLEKPEVDGIHISGGSTSYSPYLKNLITIFRDTSKNQFSLKLSAVTTEDSATYYCAR
Castor canadensis V83 ighv MTKA01015110.1 131143 VQCEVQLVESGGGLMQPGGTLKLSCAASGFTFSSYAMGWVRQAPGKGLEWIAEISSNGGSTYYPDSVKGRFNISRDNNKNQLYLQMNSLRAEDTAVYYCAR
Castor canadensis V84 ighv MTKA01015110.1 198045 VQCEVQLVESGGGLVQPGGALKLSCAASGFTFSSYAMSWVLQAPGKGLEWIAGISNSGGSTYYADSVKGRFTISRDNNKNQLYLQMNSLRAEDTAVYYCTT
Castor canadensis V85 ighv MTKA01015110.1 286276 VQCEVQLVESRGGLVKPGASLKLSCAASGFTFSNYAMHWVHQAPGKELEWLSSISGDDGSTSYADLVKGRFTISRDNNKNTLYLQMTSLRAEETVTYYCAK
Castor canadensis V86 ighv MTKA01015110.1 310514 VLSQVQLQESGSGLVKPSQTLSLTCAVFGFSITTSACCWHWIRQPAEKSLEWMGRICYSGGTNYSPSLKSHITISRDMTKKQFSLQLCSVTTQDTAIYYCAK
Castor canadensis V87 ighv MTKA01015110.1 336739 FQCEVQLVESGGGLGKPGGSLKLSCAASGFTFDDYYMSWFRQAPRKGLEWLSYINWSGGSTTYADSVKGRVTISRDNNKNTLYLQMNSLRADDTATYYCAK
Castor canadensis V88 ighv MTKA01015110.1 438377 VQCEVQLVESGGDLVKPGGSLKLSCAASGFTFNDYYMSWVRQAPGNGLEWLSYITGSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRADDTTTYYCAR
Castor canadensis V89 ighv MTKA01015110.1 459427 VLSEIQLQESGLSLVKPNQILSLTCAVSGYSITTNYCWARVCQPTGKGLESVGEICYNGNTYYSTSLKSRTSISRDTSQNEFSMQLSSVTTEDTAVYYCAR
Castor canadensis V91 ighv MTKA01015110.1 506589 ASAAVSTWLGESLQMLTMTCPVSVFSVTNYEMNWLCQPSGKGLEWIGGIWSIKSTYYNPDLKSRLSISRDNSKSQVLLTLSRLRVEDASVYYCAR
Castor canadensis V92 ighv MTKA01015110.1 588600 VQCEMQLVESGGDLVQPGGSLKLFCAASGFTFSTYGMRWVHQAPGTELEWVVYISRTSGTIYYVDSAFTISRENNKNQLYLQMNNLKTEDTAIYYCAR
Castor canadensis V93 ighv MTKA01015110.1 760620 VLSQVQLQESAPGWVKPSQTLSLTCAVSGASISSYAWSWIRQPPGKSLVWIGHINSGGGTSYNPSLKSRISISRDTSKNQFSLQLSSVTAEDTATYYCTR
Castor canadensis V94 ighv MTKA01015110.1 794471 VQSQVQLQESGPGLVKPSETLTLTCTITGFSLSSYHMHWIRQPPQKGLELVGVIWNDGKTGYNSALKSRLSITRDTSKNKVTLALSSLIAEDTAMYYCAR
Castor canadensis V95 ighv MTKA01015327.1 216941 VQCELQLVASGGGLVQPGMSLKLCCAASGFTFSDSWMHWFRQAPGKGLEWLSSIIGDGGSTSYADSIKGRFTISRDNSKSTLYLQMNSLTAHDTTTYYCAR
Castor canadensis V96 ighv MTKA01015327.1 248385 VLSQVQVQESGPGLMKPSETLTLTCTITGFSLSNYNIEWVWQPPKKGLEWVGVIWSNGNTGYNTALKSRVSITRDTSKNQVTLALSNLIAEDTAMYYCAR
Castor canadensis V99 igkv MTKA01016468.1 22521 ACGDIVMTQSPGFLAVSSGETVTINCKSSQNIYNGIAWYQQKPGQAPKLLIYAASSRPSEVPDRFTGSGSGIDFILTIGNLQAEDVADYYCQQGYNCP
Castor canadensis V100 igkv MTKA01016468.1 57413 VCGDITMTQSPGSLATSVGERITINCKSSQSLLSSSNQKNYLAWYQQKKGQPPKLLVYRASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVGDYYCLQSYSA
Castor canadensis V101 igkv MTKA01016468.1 146414 ACGDIVMTQSPGSLAASAGQRVTMTCKSSQNIGKNIAWHQQEPGQPPRLLIYAASSQESGVPDCFSGSGSGTDFTLTISSLQAEDVADYYCQQGYSS
Castor canadensis V102 ighv MTKA01017399.1 96604 VLSQVQLQESGLGLVKPSQTLSLTCAVSGFSITTSAYCWHWIRQPAEKSLEWMGRICYSGGTNYSPSLKSHITISRDMTKKQFSVQLSSVTTQDTAIYYCAK
Castor canadensis V103 ighv MTKA01017400.1 17134 VLSQVQLQESGPGLVKPSEILSITCTVSGFSLSSCGVHWVCQPPGNGLEWMGVIWASGSSQYNSGLQSQLSISKDTSKSQVTLALNSLRTEDIAVYYCAR
Castor canadensis V104 ighv MTKA01017400.1 73368 VLSQVQLQESGPGLVKSSETLSLTCTVSGYSITSGNSGWNWIHQPPGKSLEWMGYISYSGSTNYSPSLKNRISISRDTSKSQFSLQLSSVTTEDTAVYYCAR
Castor canadensis V105 ighv MTKA01017915.1 101149 AAAGLRTEPDKPFKDPALTCAVSGYSINSGYYWTWLHQPPRKGLELLGQIEYDDNIYYSLSLKSRISISRDTSKKQFSLHLSSVIAENTAMYYCA
Castor canadensis V106 ighv MTKA01018297.1 17820 VQCEVQLVESGGGLVKPGGSLKLFCAASGFTFSSYAMHWVCQAPEKSLEWLSSISGSGGSTSYADSVKRRFTISRDNNKDTLYLQMNSLRADDSATYYCAK
Castor canadensis V107 ighv MTKA01018297.1 45567 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWAWIRQPKGKGLEWMGEICYDGNTSYSSSLKSRISISRDTSKSQYSLQLSSVTTEDTAVYYCAR
Castor canadensis V108 ighv MTKA01018411.1 115252 VHSQIQLTQSGAELKKPGETVKVSCKASGYTFTSYGMSWVRQEAGKGLQYMGWINTETGKPMYNEGFTERFVFSMDTSVSTAYLQINSLKSEDTAMYYCA
Castor canadensis V109 igkv MTKA01018419.1 372249 SSGDIVMTQTPLSLPVTLGEPASISCRSSKSLLHSDGTTYLYWYLQRPGQSPQLLIYKGSNRASGVPDRFSGSGSGTDFTLKISRVEVEDVGVYFCLQAVEW
Castor canadensis V110 igkv MTKA01018419.1 396627 ARCEILMTHSPLSPSASPGDRITISCKASQSIGNYLAWYQQKPGKAHKLLIYGANSLASGVPSRFSGSGSGTDFTLTINSLEPEDFESYYCQQANSNP
Castor canadensis V111 ighv MTKA01018613.1 44058 VQCAVQLVESGGGLVKPDGSLKLSCAASGFIFSDNWVHWVRQAAGKGLEWLSYIRYDGGSTSHADSVKGRFTISRDNNKNTLYLQMNSLRAEDTATYYCA
Castor canadensis V112 ighv MTKA01018798.1 19177 VQSEVQLVESGGGLVKPGGSLNLSCAASGFTFSSYGITWVCQVPGKGLEWVAVIWYHRSQNYYAESVQGRFTISRDNSKIQLYLQMNSLRVEDTAIYYCVN
Castor canadensis V114 trgv MTKA01021027.1 12991 GLGQVEQPEMSISKATHQSAQVSCNISFQNFDKVDIHWYRQKSNQRLEHLLYVRTSYNERPLAGKSKKIEASKNFQTSTSTLKINFLTKEDEAMYYCALWM
Castor canadensis V115 trgv MTKA01021027.1 110114 GSQRSSNSEETMLSVTRTTGSLAVITCDFHDEGSYIHWYQFKEGKAPQHLLYHDILSSKNVLDSGISPEKYDTYKGTDQSYKFVIRNLNQSDSGIYYCASWT
Castor canadensis V117 iglv MTKA01000900.1 496049 SVASYVLTQPSSESVTLGQTARITCGGNNIGNKNVYWYQQKTGQAPVLVIYYSSNRPSGIPDRFSGSNSGNTATLTISSTQAEDEADYYCQVWDSSNT
Castor canadensis V118 iglv MTKA01000900.1 426405 SVASYVLTQPSSASVTLGQTARITCGGSGIGNKYVYWYQQKTGQAPVLVIYRDNNRPSDIPDRFSGSNSGNTATLTISNTQAEDEADYYCQVWDSSSD
Castor canadensis V119 iglv MTKA01000900.1 421791 SVGSYVLTQPSSASVTLGQMARITCGGNSFGNKYVYWYQQKTSQAPVLVIYEDSKQLSGIPDRFSGSNSGNTATLTISRAQAEDETDYYCQVWDSNSD
Castor canadensis V120 iglv MTKA01000900.1 365758 SVASYVLTQPSSASVTLGQMARIACGGNGIANKYVQWYQQKPGQAPVLVIYGDSSQPSGIPDRFSGSNSGNTATLTISSTQAEDEADYYCQVWDSSSD
Castor canadensis V121 iglv MTKA01000900.1 357649 SVASYVLTQPSSASVTLGQTARITCGGSGIGNKYVNWYQQKIGQAPVLVIYNSNNRPSGIPDRFSGSTSGNTATLTISKAQAEDEADYYCQVWDSSSD
Castor canadensis V122 iglv MTKA01000900.1 269468 SWAQSTLTQPPSTSGSLGQTATISCTGTSNDIGKYNYVSWYQQQPGLNPKLLIYNVNSRPSGISDRFSGSKSGNTASLTISGLQPEDEADYYCASYAGSNN
Castor canadensis V123 iglv MTKA01000900.1 252221 SWAQSALTQPPSASGSLGQTVTISCTGTSNDIGKYNIVSWYQKQPGTNHKLLIYNVNSCPSGISDRFSGSKSGNTASLTISGLQPEAEADYYCASYAGS
Castor canadensis V124 iglv MTKA01000900.1 244403 SWAQSTLTQPPSASGSLGQTATISCTGTSNDIGKYNYVSWYQQQPGLNPKLLIYYVNSRPSGISDRFSGSKSGNTASLTISGLEPEDEADYYCASYTAS
Castor canadensis V125 iglv MTKA01000900.1 229918 SLASYELIQPPSASVALGQTATITCSGHALPKNYAHWYQQKPGQAPVQVIYKDSERPSGIPDRFSGSSSGTTATLTISQVQPEDEADYYCLSSESDDA
Castor canadensis V127 ighv MTKA01001250.1 134489 VQCEVQLVESGGGLVKPGGSLILSCAACAASRFTFSGYGMNWVCQGPEKKYYAESVKGRFTISRDNAKKQLYLQMNSLRFEDTAMYYCASEAIKRLL
Castor canadensis V128 ighv MTKA01001370.1 203111 RVVAGGVRGDLMQPGGTLRLSCAAFGFTSSDFYTQWVQQTPGKGLEWVGQINPNGDSMYYPDAVKGRFTLSRDNSKSQVYLQMNTLKAEDTAVYYCA
Castor canadensis V131 trgv MTKA01002573.1 64970 GLGQLEQPEMSISKATHQSAQVSCKVSSKNFDKEYIHWYRQKPNQGFEYLLYVRTSYNARTLAGKNKKIEASKNFPTSTSTLKINFLTKEDEAMYYCALWM
Castor canadensis V132 trdv MTKA01002752.1 219954 VSLDIILEPNTKTLTVLIGKPASFCCKVTGGDLKNYQMSWYKNEDNSLTLVYKLNSTSTDNLRSNFQGKIDNSKSQFILDIQKATTGDAETYYCESD
Castor canadensis V133 igkv MTKA01003159.1 5715 ACGDIAMTQSPGSLAASAGERVTINCKSSQSISSYLAWYQQKPGQPPRLLIYAASSRASGVPDRFSGSGSGTDFTLTISSLQAEDTADYYCQQHYSV
Castor canadensis V134 iglv MTKA01003428.1 272563 CADLATLPLCITWRNTKFTCTLKSDISVSSKNIYWYQQKPGIAPRWFLYYYSDSDKKLGPGVPERVSGSKDASKNSACLHISGLQPEDEADYYCSILQSNA
Castor canadensis V135 iglv MTKA01003428.1 219665 VNSQTVVTQEPSLSVSPGGTITLTCGLNSGSVSTGYYPTWYQQIPGQAPYTLIYNRNNRPSGVPDRFSGAITGNKASLTITGAKKEDDADYYCALDMGSYI
Castor canadensis V136 iglv MTKA01003428.1 214184 SWGQSVLTQTPSVSGNLGQSVSISCTGSSSNIGSYDVNWYQQLPGTSPKLIIYEDNKRPSGVPDRFSGSKSGNSATLTIAGLQSEDEADYYCQSVDDSIDD
Castor canadensis V137 iglv MTKA01003428.1 184424 SWAQSVLTQTPSVSGNLGQSVSISCTGSSSNIGGYNVHWYQQLPGTSPKLIIYEDSKRSSGVPDRFSGSKSGNSVTLTIAGLQSEDEADYYCHSYDNGLDA
Castor canadensis V139 iglv MTKA01003428.1 165529 VNSQTVVTQEPSLSVSPGGTVTLTCGLNSGSVSTSNYPSWYQQIPGQAPYTLIYNTNNRPSGISDRFSGAITGNKASLTITGAKIENDADYYCALYMGSGI
Castor canadensis V140 iglv MTKA01003428.1 96742 SLSQPVLTQMSSVSASLGSSARLNCTLSSGFEVLGYHISWYQQKTESTPQFLLRYYSDSGKYQGPGVPSCFSGSKDASANSGILLISGLQPEDEADYYCAIYHG
Castor canadensis V141 iglv MTKA01003428.1 9742 SWAQSVLTQPSSVSGNPGQKVTISCAGSSSNIGSNYVNWYQQLQGSSPKLLIYNNNNRPSGIPDRFSGSKSGNSATLTITGLQPEDEADYYCQSYDDNLML
Castor canadensis V142 trav MTKA01003438.1 55825 ENNGDSVTQTEGEVTLSEGAPLTMNCSYETTQYPSLYWYVQYPGEGLQLLFRVTRDGEKGSHKGFEATYSRKSTSFHLEKASVHESDTAVYYCVLS
Castor canadensis V143 trav MTKA01003438.1 34736 VSQGEKVEQHHSILNVQEGDSSVINCTYSDSASVYFPWYKQEPGKRPQVLIGIRSNQDTNNKERLMVLLSKKEKHFSPHINGTQPGDSAIYFCAAS
Castor canadensis V144 trav MTKA01003438.1 12171 VSSQQKPVEQHPESLSVWEGAMASLNCTYRDSTSTNFRWYRQYSKKGLELLVSAFSSGSIDEGRFTVHLNKASQFISLHIRGSQPSDSATYLCAV
Castor canadensis V145 trdv MTKA01003685.1 68695 SSVAQKVTQVLTARSRQMGEEVSLDCSYETSLSAYYLFWYKQLPSGEMNFLISQHSGSGNARRGRYSVHFQKSVNRISLIISDLKLEDSAKYFCTLRE
Castor canadensis V146 trdv MTKA01003685.1 49171 SSVAQKVTQVLTAKFRRMGEEVSLDCSYETSRSAYYLFWYKQLPSGEMNFLISQHSGSGNARRGRYSVLFQKSVNRISLIISDLKLEDSAKYFCTLRE
Castor canadensis V147 trdv MTKA01003685.1 27975 SSMAQKVTQVQRATSQQEGEEVSLHCTYETNLLIYELYWFKQLPSGEMIFCIRQHSSAQNARSSRYSVNFQKSAKRISLTISALQLEDSAKYFCA
Castor canadensis V148 ighv MTKA01003935.1 350576 VLSQVQLQESGLGLVKPSVTLSLTCTVSGYSITSGYDWSWICQPPGKSLECMGYITYSRGTYYSPSLKSCISISRDTSKNQFSLQLSSVTTENTALYYCAR
Castor canadensis V149 ighv MTKA01003935.1 337980 THSQVQLTQSGAELKKPGETVKVSCKASGYTFTSYAMYWVKQETGKGLQNIGWINTANGNTGYAEGFRGRFVISMEASVSTTYLQISNLKSEDTAMYYCA
Castor canadensis V150 ighv MTKA01003935.1 296501 RLEQPGAELRKPGKSLKVSCKTSGFTFTSYYMHCVRQRPSQGLDWMSWIDPEDDRTSYAQNIKGRLTLTVDRSSSTAFMELSRLTADYSAVYYCA
Castor canadensis V151 ighv MTKA01003935.1 250315 VLSQGQLQESGRGLAKPSETLTLTCTITGVSLPSCHMHWMRQPPQKGLEWVGVLWSNGNTGYNSALKFLLSITRDTSKNQVTLALSSLIAEDTAMYYCAR
Castor canadensis V153 ighv MTKA01003935.1 122244 VQCEVQLVESGGGLVQPGGALKLSCAASGFTFSSYWMIWVRQAPGKGLEWIAAINNGGGSTYYTDSVKGRFTISRDNNKNELYLQMNSLRAEDTAVYFCAR
Castor canadensis V154 ighv MTKA01003935.1 68926 VLSQVQLQESGPGLVTPSQTLSLTCDVNGYSISSGYWWNWIRQPPGKGLQWIGQIYKSESTYYNPSLKSRITITVDTSKNQFFLQLSSVTTEDTAVYYCAR
Castor canadensis V155 ighv MTKA01003935.1 30939 VLSQVQLQESGPGLVKPSQTLSLTCAVSGVSLTSYGWSWIRQPPGKSLEWMGYIYSGGSTSYNPSFKSRISISIDTSKNQLSLQLSSVTSEDTATYYCTS
Castor canadensis V156 ighv MTKA01003935.1 25970 VLSQVQLQESGAGLVKPSQTLSLTCAVSGYSITSDYYWSCIRQTPGKSLKWMAYISYGGSNYYSPSRKSDISISRDTSKNQFSLQLSSVTTEDTAVYYCAI
Castor canadensis V157 ighv MTKA01004420.1 53096 VQCEEKLEESGGGLVQLGGSLRIFCAAYGFTFSDYYMDWVCQASGKGLEWVASIRKNVNSYTREYSASVKGRFTISRDDDKNMLYLQMNSLRHEGTAMYYCVR
Castor canadensis V158 ighv MTKA01005439.1 15260 VLSQDKESGPSLVKPNQIRPLTCAVFGYSITTNYCWAWIRQPTGKGLEWMGEIYYNGNTYYSTSLKSRTSISRDPSKNEFSMQLSSVTTEDTAVYYCAR
Castor canadensis V159 ighv MTKA01005440.1 2458 VLSQVQLQESGPSLLKPSRTLSLTCTVSGFSLTSYDMNWIRKTSGKGLKWMGVIWSGRNIQYNPGHTSRLSISRDTAKSQVSLTLSSLRAEDTAIYYCARNPV
Castor canadensis V161 ighv MTKA01006002.1 30758 VLSQVQLQESGPGLVKPSETLSITCTVSGFSLSSYGVYWVRQPPGNGLEWMGVIWASGSTQYNSGLQSRLSISKDTSKNQVILALSSLRTEDTAVYYCAR
Castor canadensis V162 ighv MTKA01006418.1 154075 AATGVRTYPAEAFGDLSLTCTVSGYSITSGNCVWSWICQPPGKSLEWIGYITFGGSTNYSSSLKSRISITRDTSKNQFSLQLSSVTTEDTAVYYCAR
Castor canadensis V163 ighv MTKA01006418.1 79216 VLFQVQLQETGPELVKPSLTLSVSCAVSGYSITSSYCCTWICQLPGKGLAWMGHICYSGKIYNSPYLKNCISISRKASKNQYFLQESSRNTEDKARYYCAR
Castor canadensis V164 ighv MTKA01006418.1 70681 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFTSAYNWSCFWLPPGKSLEWMGYISYGGSTSYNPSLKSHISIIRDKSKNQFSLQLSSVTTEDTNVYYCAR
Castor canadensis V165 ighv MTKA01006418.1 16429 VQSQVQLQESGPSLVKPNQTLPLTCAVSGYSITNNYCWASIWQPHRKGLEWMGYICSNGNTYYGPSLKSHSSIFRNTSKNEFSMQLSSVTTEDTAVYYCAR
Castor canadensis V166 ighv MTKA01006702.1 27602 VQCEVQLVESGELGEAWGSLKLSCAASGFTFSSYAMHWVRQAPEKSLEWLSYISGSGGSTSYADSVKGRFTISRDNNKNTLYLQINSLKDDYTATYYCAK
Castor canadensis V167 ighv MTKA01006835.1 42773 VQCEVQLVESGGGLVQPGGALKLSCAASGFTFSSYAMSWVRQAPGKGLEWIAGISNSGGSTYYADSVKGRFTISRDNNKNQLYLQMNSLTAEDTAVYYCTT
Castor canadensis V168 ighv MTKA01006961.1 70138 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFDGYSMDWVRQAPGKGLEWLSYISYDGGSTSYADSVKGRFTISRDNNKNTLYLQMSSLRADDTATYYCAR
Castor canadensis V169 ighv MTKA01007033.1 138229 HIKGVWTLLFPPSQILKLTCSFSGFSLSTTNIGVSWIRQPPGKTLEWLANIWWDDDKYYNPALKSRLTISKDSSNSQVFLTMTTTEAADTAIYYCAR
Castor canadensis V170 ighv MTKA01007033.1 110303 VLSQVNLKQWGSDLVKPSQSLSLTCAVYGYSITSGYDWTWIRQPPGKSLEWMGYIRYDGSTNYSPSLKSHISISRDTSKNQFSLQLSSVTTEATAVYYCAR
Castor canadensis V171 ighv MTKA01007033.1 72468 AGPEIRTRTAAALRDSVPNLCCLCASVSCYGWSWIHQLPGKSLEWMGYINYGGSTSYNPSFKSRISISGDTSKNQLSLQLSSVTSGDTATYYCTS
Castor canadensis V172 ighv MTKA01007033.1 34339 IWCEVELGESGGGFVQPGVSMRLSCAASRFTFSDYTMHWVCQAPGKELEWVTHIRSKTNSYETNYIESVNSRFTISRDDLKSIVYLQMNNLREEDTAMYYCT
Castor canadensis V173 ighv MTKA01007199.1 235961 VQCEVQLMESGGGLVPPGGSLKLSCAASGFTFSDYYMDWVCQAPGKGLECVGHTSKEGGSMYNPDSVKGRFTISGDNSKSQLYLQMSLKAEGTAMYYCV
Castor canadensis V175 ighv MTKA01007199.1 71773 VQCQVQLVESGGGLVQPGGALKLSCAASGFTVSSYWMNWVRQAPGKGLEWVATISGGSTYYLDSVKGRFTISTDNNKNQLYLQMSSLRAEDTAVYYCAR
Castor canadensis V176 ighv MTKA01007199.1 7033 VLSQVQLKESGPGLVKPLETLSLTCTVSGYSITSGNYVWSWVRQPPGKSLQWIGYITSGGSTNYSPSLKSRISITRDTSKNQFSLQLSSLTTEDTAVYYCSR
Castor canadensis V178 ighv MTKA01007396.1 151680 AASGVRTWPGEDLTDPVLTCRVSGYSIISDYYWSWIRQPPGKSLEWMGYKSYGGITSYSPSLKSHISSTRDTSKNQFSLQLSSVTIEDTAVYYCAR
Castor canadensis V179 ighv MTKA01007396.1 75195 VQCDVQLVESRGSLVQPGRALKLSCAASGFTFSNYYMDWVCQAPGKGLEWIAEISSSGGSTYYPDSVKGRFTISRDNNKNQLYLQMNSLRAEDRAVYYCTK
Castor canadensis V180 ighv MTKA01007396.1 42781 LQLQESGPGLVKPSKTLSLTCAVLGYSITTTGYCWASIWQPPFKELEWIGHICYDGSTGYTPSLSAQVTISRDTSKNQFSLQLSTVTTDDMALYYCVR
Castor canadensis V181 ighv MTKA01007396.1 17544 VQSQVQLQESGPGLVKPSETLTLTCTITGFSLSSYHMHWIRQPPQKGLELVGVIWNDGKTGYNSAPKSRLSITRDTSKNQVTLALSSLIAEDTAMYYCAR
Castor canadensis V183 trav MTKA01007485.1 30112 VSGQQLNQSPQFVSIQEGEDASMNCSSSSTLSKMLWYKQDPGGSLVLLIDVYKSGELTKRGKLTAQLGGTRKDSFLTISAAVPGDSGTYFCAC
Castor canadensis V184 igkv MTKA01008199.1 31367 SNGEIVLTQSPASTAVFEGESVTITCSASSSVSTSYLHWYQQKPGDSPKLLVYRTSNLASGVPARFSGTGSGTSYSLTISTLETDDIATYYCQQTS
Castor canadensis V185 igkv MTKA01008199.1 3788 STSDIVLTQSSGILLVPPGDKVTITCRASEHTGIDLHWYQQKVDQAPKLLINYTSQSISGIPSRFSGSGSGTEFTLTISSLEHEDAATYYCQQG
Castor canadensis V186 igkv MTKA01008200.1 48441 VIGDIQMTQSPSLLSASPGERVTITCHASQGISKWLAWYQQKPGKAPKLLIYTASNLESGVPSRFSGSGSGTDFTLSISSLEPEDVATYYCQQYDELP
Castor canadensis V187 igkv MTKA01008200.1 28368 SSGDVALTQSPLSLPTTPGEPASISCKSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYLVSNQFSGIPNRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTNDP
Castor canadensis V188 igkv MTKA01008514.1 56088 TTGELSVTQTSSSLSLNPGESTTLSCRVSQGVGSYLAWYKQKPAQIPRLLVFSASTRATDALIRFSGSGSGTDFTLTISSLEPEDVAVYYCQPFGSWS
Castor canadensis V189 ighv MTKA01008860.1 22713 VHAQVRLEQPGAELRKPGASVKVSCKTSGFTFTNSYMHWVRQRPSQGLEWMGQIDPENDKTKYAQNFQGRLTLTVDRSSSTAFMELSRLTADDSAVYYCA
Castor canadensis V190 ighv MTKA01009560.1 232626 VHTQVLLEQPKAELRRPGASVKVSCKTSGFTFTSYYMHWVRQRPSQGLEWMGWIDPEDDETKYAQNFQGRLTLTVDRSSSTAFMELSRLKADDSAVYYCA
Castor canadensis V191 ighv MTKA01009560.1 191757 VLSQVQLQESRPGLVKPSQTLSLTCAVSGFSITTSPYCWDWICQLPGNFLEWMGTICYDGSTGYSPSLKSCISISRDMSKDQFTLQLSSMTTKDTAMYYCGR
Castor canadensis V192 ighv MTKA01009560.1 138210 VQCEVQLVESGGGLVKPGRSLKLSCAASGFTFDDYGMGWIRQAPEKGLEWLSSINWSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRADDTATYYCA
Castor canadensis V193 ighv MTKA01009560.1 63914 VQCEVQLVESVGGLVPPGGSLKLSCAASGFTFNDCYMDWVHQAPGKGLDWVGQIRKDGGSTYYPDSVKGRFTISRDNSKSQLYLQMNSLKAEDTAMYYCV
Castor canadensis V194 ighv MTKA01009560.1 23011 VLSQVQLQESGPGLVKPSENLSLTCAVSGASISSYYWSWIRQPPGKSLEWMGYISSGGGTSYNPSFKSRISISRDTSKNQLSLQLSSVTTEDTATYYCTS
Castor canadensis V195 igkv MTKA01009671.1 9253 TTGELSVTQTSSSLSLNPGESTTLSCRVSQGVGSYLAWYKQKPAQIPRLLVFSASTRATDALIRFSGSGSGTDFTLTISSLEPEDVAVYYCQPFGSWS
Castor canadensis V196 igkv MTKA01009836.1 88052 SSSDIVLTQSSGILLVPPGDKVTITCRASEHTGIDLHWYQQKVDQAPKLLINYTSQSISGIPSRFSGSGSGTEFTLTISSLEHEDAATYYCQQG
Castor canadensis V197 igkv MTKA01009836.1 10898 AYGDIVMTQSPSSLAASAGERVTINCKSSQSISSYLAWHQQKPGQPPRLLIYAASNRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCQQHYSY
Castor canadensis V198 trav MTKA01010471.1 119073 VSSQQKEVEQHPESLSVPEGAMASLNCTYRDSASQNFGWYRQYPGKGLKLLVSTFSSGNKDEGRYTAHLNKASRYFSLHIRGSQPSDSATYLCAV
Castor canadensis V200 trav MTKA01010471.1 29345 VSGKTQVEQSPGSLTVLQGENCTLQCNYTVSPFNNLRWYRQDRGKSPFSLMITNFKENKVSSGRYTATLDANTKHSSLYITDSQPSDTASYICVVS
Castor canadensis V201 igkv MTKA01011520.1 41468 ACGDIVMTQSPGSLAASERDRVTMTCKSSQSIGKSITWYQQKPGQPPRLLIYAASSRASGVPDRFSGSGSGTDFTLTISSFQAEDVADYYCQQYYSS
Castor canadensis V202 igkv MTKA01011520.1 21259 VCGDITVTQSPASLAASVGERITINCKSSQSLLSSSNQKNYLAWYQQKPGQPPKRLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDMADYYCQQYYSF
Castor canadensis V203 ighv MTKA01012235.1 35551 VQCEVQLVESGGGLVKPGGSLILSCAACAASRFTFSGYGMNWVCQGPEKKYYAESVKGRFTISRDNAKKQLYLQMNSLRFEDTAMYYCASEAIKRLL
Castor canadensis V204 trdv MTKA01012727.1 27319 SSVAQKVTQGQEAMSRHEGEKVTIDCSYETSLSSYYLFWYKQLPSGEMNFLISQHSSSQNTKSGPYTVSFQKSAKRISLIISALKREDSAKYFCALWE
Castor canadensis V207 trbv MTKA01013253.1 13991 YVSSSTVSTDTEVTQSPRHVVKQKAKIDCIPVKGHSYVYWYRKKLEEELKFLLYFQNEDIMEKTEFINERVSAQCPANSSCSVEIQSTELADSGLYFCASSQ
Castor canadensis V208 trbv MTKA01013253.1 3649 CFDTKVAQTLRHLVKMKGKKVKMLCIPPKGHTVIYWYQNHNKDLKFLICFQNQQLLDQIDMIKGHFIAECPPNSPCSLEIQSSDTGDSALYLCASSQ
Castor canadensis V209 trav MTKA01014688.1 169993 VSQGEKVEQHPSILSVKEGDRSVINCTYSDTASDYFLWYKQEPGKRPQLITDIRSNRVSNQKQRLLVLLNKKEKHISLHIEGTQPGDSAVYFCAVR
Castor canadensis V210 trav MTKA01014688.1 120665 RSSGDSVTQTKGPLTLIEGSPMFLNCTYQTTYSDTFTLWYVQYLNEAPQLLLKSATESQKIENQGFQATLVKKDNSFHLQKSSLQLSDSAVYYCTMR
Castor canadensis V211 trav MTKA01014688.1 103018 LHGKDEVEQSPETLRLLEGDGGSLNCNCVINYFRGLHWYRQDPGTGPRFLFSLHLAGKEKDKDRLKATLSKMGSCLHITDPKSKDSATYLCAMSS
Castor canadensis V212 trav MTKA01014688.1 79090 VRGMQVEQSPSTLILQEGNNSTLQCNFSSSVNNVQWFLQNPGGRLINLFSVPSGTKRNGRLTATTVTKERRSSLYISSSQTTDSATYFCAVD
Castor canadensis V213 trav MTKA01014688.1 55574 GSGAQSVTQIESHVTVSEGAPLELRCNYSYGATPFLFWYIQYPNQGLQLLLKYIGGDLLVKGIKGFEAEFRKSETSFHLKKASAHLSDTAEYFCAVS
Castor canadensis V214 trav MTKA01014688.1 9107 VVTDSKATQPNSMESTEDEPVHLPCNHSTISGNEFIYWYRQIPLQGPEYIIHGLKDNVTNRMAFLAIPADRKSSTLILPHASLRDTGVYYCILR
Castor canadensis V215 trav MTKA01014690.1 75289 VIQGEKVEQYPSILSVHEGDHSVINCTYSDSGSTYFPWYKQEHGKGPQLIIDIRSNRDTSNKDRLMVLLNKKEKHFSLHINGTQPGDSAVYFCVAS
Castor canadensis V216 trav MTKA01014690.1 6830 KTSEDSVTQKEGKVTVTEGMFLTINCTYAATGYPSLSWYVQYPGEGPELLFKVTRAGEKGAHKSFEATYNKETTSFHLEKASVQESDMAVYYCALS
Castor canadensis V217 trav MTKA01014693.1 9628 DTTAQLVTQPDVQITVTEGASLELRCNYSYSYTSAPYLYWYVRYPGLGLQLLLKYLSGDTMVQGIKGFEAEFRKSESSFHLSKHSVHWSDTALYFCALG
Castor canadensis V218 trdv MTKA01014695.1 13564 SSVAQKVTQVQTATSMQEGKKVTLDCSYETNWLAYYLYWYKQLPSGEMNFLISQFYNSGNARSGRYLVNFQKSAKHISLTVSALQKEDSAKYFCALWE
Castor canadensis V219 trav MTKA01014697.1 7289 VIQGKKVEQYPSVLSVHEGNHSVINCNYSDSGSYYFSWYKQEPGKGPQLIIDIHSNQDTNSKDRLMVLLNKKDKHFSLHISGTWPGDSAIYFCAAS
Castor canadensis V220 trav MTKA01014698.1 2331 DIATQTVTQPDVQVTVIEGASLELRCTYSYTGSLYLFWYVQYPGQDIQVLLKYLSGKPLFQGIKGFEAEFKKSESSFHLRKPSVHWSDAAWYFCALS
Castor canadensis V221 trbv MTKA01014912.1 908663 PSEAEVTQTPRHLIKLRGQKVTSRCSPFSGHSTVYWCQKAPGQGPQLLFGYYNELEQSKRNVPHRFSAQQFHDYRSRLSFSALELGDTGTYLCASSL
Castor canadensis V222 ighv MTKA01015330.1 32923 VQCEVQLVESGGGLVQPGGALKLSCAASGFTFSSYDMSWVRQAPGKGLEWIAAIYSAGSTYYADSVKGRFTISRDNNKNQLYLQMNSLRAEDTAVYYCTT
Castor canadensis V223 ighv MTKA01015330.1 23955 VQCEVQLVEPGGGLVQPGGSMRLSCAASGFTFSDYYMNWVRQAPAKGLEWVGFSRNKAKSYTTEYNASVKGRFTISRDNDKSMLYLQMNSLSAEDMAVYYCAK
Castor canadensis V224 ighv MTKA01015331.1 163779 VQCEVQVVESGGGLVKPGGSLKLSCAASGFTFDDYSMYWVRQAPGKGLEWLSYISYDGGSTSYADSVKGRFTISRDNNKNTLYLQMNSLRAEDTATYYCAK
Castor canadensis V225 ighv MTKA01015331.1 128351 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSSYGMHWVRQAPEKSLEWLSYISGSGGSTSYADSVKGRFTISRDNNKNTLYLQMNSLRADDTATYYCAR
Castor canadensis V226 ighv MTKA01015331.1 63295 VQCEVQLVEPGGGLVQPGGSMRLSCAASGFTFSDYYMNWVRQAPAKGLEWVGFSRNKAKSYTTEHNASVKGRFTISKDNDKSMLYLQMNSLSAEDMAVYYCAK
Castor canadensis V227 ighv MTKA01015331.1 17900 AATGVRTCPGEASQTLSLTCTVSGYSITSGNSWIWIHQPPGKSLEWMGYITYSGGTYYSPSLKSRISITRDTSKNQFSLQLSSVTTENTAVYYCAR
Castor canadensis V229 ighv MTKA01016112.1 440375 VQCEVQLVVSGGGLVKPGGSLKLSCAACGFNFSEYYMYWVCQAPGKGLELLSYINGDGGSTNYADSVKGRFTISRDNSKNTLYLQMNILRADDTATYYCAR
Castor canadensis V230 ighv MTKA01016112.1 388660 VLSKVQLQESGPGLVKLSQTLSLTCAVSGASISSYDCSWIRQPPGKSLEWMGYISSSGGTSYNPSLKSCISISRDTSENQFYLQLSSVTSEDRATYYCTS
Castor canadensis V231 ighv MTKA01016112.1 318372 VQCEVQLVESGGGLVQPGGALKLLCAASGFTFSSYGMSWVHQAPGKGLEFIAAISSGGSTYYLDSVKGRFTISRDYIKNKLYLQMNSLRAKDTAVYYCAR
Castor canadensis V232 igkv MTKA01016468.1 438619 ACGDIMVTQSPASLAASVGERVTINCKSSQSLLYSSNQKNYLAWYQQKPGQPPKLLIYWASTQASGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCQQYYSY
Castor canadensis V233 igkv MTKA01016468.1 393652 AYGDIVMTQSPGSLAASAGETVTINCKSSQSISSYLAWHQQKQGQPHRLLIYAASNRATGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCQQYYSS
Castor canadensis V234 igkv MTKA01016468.1 377320 ACGDIAMTQSPGSLDASAGERVTINCKSSQSISSYLAWYQQKSGQPPRMLIYAASNRASGVPDRFSGSGPGTDFTLTISSLQAEDVADYYCSSIIVF
Castor canadensis V235 igkv MTKA01016468.1 313850 VCGDITVTQSPASLAASLGERITINCKSSQSLLSSSNQKNYLAWYQQKPGQPPRMLIYAASNRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCQQYYSS
Castor canadensis V236 igkv MTKA01016468.1 290818 ACGDIVMTQSPGSLAASAGERVTINCKSSQSISSYLAWYQQKPGQPPRLLIYAASNRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCQQYYSS
Castor canadensis V237 igkv MTKA01016468.1 275178 VCADITMTQSPAYLAASVGERITINCKSSQSLLYSSNQKNYLAWYQQKPGQPPKLLIFWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDMADYYCQQHYNY
Castor canadensis V238 igkv MTKA01016468.1 179122 ACGDIVMTQSPGFLAVSSGETVTINCKSSQNIYNGIAWYQQKPGQAPKLLIYAASSRPSEVPDRFTGSGSGIDFTLTIGNLQAEDVADYYCQQGYNCP
Castor canadensis V239 trav MTKA01016817.1 45959 EKVEQHLSILSVHEGDHSVTNCTYSDSASVYFPWYKQEPGKVPQLIIDIRSNRDTSNKDRLMVLLNEKEKNFSMHISGTWPGDSAIYFCAASA
Castor canadensis V240 trav MTKA01016817.1 38119 VSGKTQVKQSPGSLTVLQGENCTLQCNYTVSPFNNLRWYRQNTGRGPISLMIMTYKESKTSTGRYTATLDENAKHSSLYITDSQPSDTASYICVVS
Castor canadensis V241 iglv MTKA01017538.1 31973 SVASYVLTQPSSASVTLGQMARITCGGNGIGSKTVNWYQQKPGQAPVLGIYRDSNWPSGIPDRFSGSNSGNTATLTISSTQAEDETDYYCQVWDSSSD
Castor canadensis V242 trbv MTKA01017550.1 2343 QTKAGVSQSPMHRVTEKGQNVTLRCDPISDHVTLYWYQQNPGQGPEFLIYFQNEFATDTSGMPNDRFSAERPEGSSSTLKIKSAEQEDSALYLCASSL
Castor canadensis V243 trav MTKA01017660.1 99276 VIQGEKVEQHPSILSVHEGDHSVINCTYSDSASAYFPWYKQEHGKGPQLIIDLRSNRDTSNKDRLMVLLNKKDKHFSLYINGTRPGDSAVYFCAAS
Castor canadensis V244 trdv MTKA01017662.1 18228 SSLAQKVTQVQPAISRQEGEKGILHCSYETNLSEYDLFWYKQLPSGDVIFCIHQSSSAQKAENGRYSVNFRKSVKHISLIISGLQLEDSAKYFCALWE
Castor canadensis V245 iglv MTKA01017890.1 23475 SWRQSVLTQTPSVSGNLGQKVSILCTGSSSNIGGYYVQWYQQLPGTSPKLICDDSKIPSGVSWSNFLCSKSGNSATLTIAGLHSEDEADYYCQSYDNSLGA
Castor canadensis V246 iglv MTKA01018065.1 48267 SLSQPILNQMSSVSASLGSSARLTCTLSNGFKVPAYHIFWYQQKTESGPQFLLRYYSDSSKYQEPGVPSRFSGSKDASANAGILLFSGLQPEGEADYYCTTYHS
Castor canadensis V247 iglv MTKA01018065.1 32043 SWAQSGLTQPSSVSGNLGQKVTISCAGSSSNIGSNYVNWYQQLQGSSPKLLIYNNNNRPSGIPDRFSGSKSGNSATLTITGLQPEDEADYYCQSYDDNLNA
Castor canadensis V249 ighv MTKA01018234.1 13179 VQCEVQLVESGEGLVKTGGSLKLSCAASGFTFSDYWMYWFRQAPGKGLEWVSRIKNKDDNYGTDYSASVKDRFTISRDDAKSNMYLQMTSLREEDTAVYYCA
Castor canadensis V250 iglv MTKA01018312.1 29534 SLASYELIQPPSASVALGQTATITCSGHALPNRYAYWYQQKPGQAPVQVIYKDNERPSGIPDRFSGSSSGTTATLTISRAEPEDEADYYYCLSDESDDA
Castor canadensis V251 igkv MTKA01018419.1 74711 TQCDIQMTQSSSSLAATTGERVTITCQASQGINKWLAWYQKKAGNAAKLLIYKASDLQSRVPSRFSGSGSGTDFTLTISNLDPEDTATYYCQRYDSYP
Castor canadensis V252 trav MTKA01020396.1 3979 RAHGNSVTQKEGEVTLSEGAFLTINCTYTAKGYPELSWYVQYPGESLQLLFRVTKSGEKGSHRGFEATYNRETTSFHLEKATVHKSDSARYYCVLG
Castor canadensis V253 trav MTKA01020397.1 12136 GSSGESVTQMEGQVFLSEGNSLIVNCSYETKQYPALFWYVQYPREGPQLLFRVARAGEKGSHKGFEATYSKETTSFHLEKASVHESDSAVYYCALG
Castor canadensis V254 trav MTKA01020435.1 4908 VSSQQKEVEQHPESLSVPEGAMASLNCTYRDSASQNFGWYRQYPGKGLKLLVSTFSSGNKDEGRYTAHLNKASRYFSLHIRGSQPSDSATYLCAV
Castor canadensis V255 trav MTKA01020436.1 12571 RTCGDSVMQKEGEVTMSEWAFLTINCTYTTKSYPELSWYVQYPGEGPQLLFRVTRAGEKGSHKGFEATYDRETTSFHLEKASVLESDVAVYYCALS