WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Carlito syrichta ABRT00000000.2 (ABRT02) 208 47 35 40 53 20 8 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Carlito syrichta V0 igkv ABRT02033622.1 5752 VNGDIILTQMPASLSASPGERISISCQASADVHGEMSWFRIKLGQRLEPLISHVTTLAPGVPTRYSSQGSGTSYAFSISTLEPGDSGEYYCMHDYGWL
Carlito syrichta V1 igkv ABRT02033623.1 12774 ARCDIQMTQSPSSLSASLGYRVTIICRASQDISTYLQWYQQKPGNTPKLLINWASNLESGFPSRFSGSWSGTDFTFTINTLQPEDVANYYCQQIYSYP
Carlito syrichta V2 ighv ABRT02046915.1 1439 VCAQVQLVQSKAEVKRPGESLKISCKTSGYSFTSNWISWIRQMSGKGLEWMGSIDPGDSETHYSPSFQGQVTISADSSVSTAYLQWRSLKISDTAMYYCAR
Carlito syrichta V3 ighv ABRT02047357.1 971 VCAQVQLVQSKAEVKRPGESLKISCKTSGYSFTSNWISWIRQMSGKGLEWMGSIDPGDSETHYSPSFQGQVTISADSSVSTAYLQWRSLKISDTAMYYCAR
Carlito syrichta V4 igkv ABRT02048075.1 1414 ASCDIQMTQSPSSLSASLGDRVTITCRASQSISRWLAWYQKKLGKPPKLLIYGASSLQTGVPSRFSGSGSGTDFILTISSLQPEDVATYYCLQ
Carlito syrichta V5 igkv ABRT02070574.1 1620 SSGDIVSSQTPLYLPVTLGEPTSISCKSSQSLLYSDENTYLYWYLLKPDQLPQLLIYLISSRASGVPERFSGSGSGTDFTLKINKVEAEEVGVYYCMQA
Carlito syrichta V6 iglv ABRT02077312.1 5050 SCTLPVLTQPPSASASLGAWVKLTCTLSREHNIYTIAWYQQQPGKALQYLIDIKNNGSHNKGDGISNHFLDSSSGADHYLTISSDQSEDNAEYYCVE
Carlito syrichta V7 trdv ABRT02082694.1 52847 VMSAVVMVPQEQAVTVPVGESTTLRCSMEGEAITSYYVNWYRKTQSNTITFIYREQNIYGPGFEDRFQGKVEVDSNQAVLTILAASETDEGSYYCAGD
Carlito syrichta V8 ighv ABRT02086807.1 25222 VCAQVQLVQSNAEVKRPGESLKISCKTSGYSFTSNWINWIRQMSGKGLEWMGSIYPGDSDTRYSPSFQGQVTISADSSVSTAYLQWRSLKISDTAIYYCAR
Carlito syrichta V9 trbv ABRT02099627.1 859 HITAGVTQFPSHRVVEKDQAVTLRCDPISGHDALHWYQHAVGKKMKFLIYFLQEYIQDKSGMSNDRVSAERTEGTYSILKIQPAELEDSGVYLCASSP
Carlito syrichta V10 iglv ABRT02110219.1 31293 SVSSYKLTQPPSVLVSLEQTSQITCGGHNIGNKNVHWYQQNPDQTPVLIIYWEYVKPSISPAQFSGSILGNMATMTISEAQARDEADYYCQVWDSSGN
Carlito syrichta V11 trav ABRT02122507.1 390 VNGQQLMQIPQFLHIQEGEDFTTYCNFSMTLTVVQWYKQRPEGSPVLLMVLAKGGEVKKQKRLTARFGESRKDSSLHITAAQIADVGTYFCAV
Carlito syrichta V12 trav ABRT02146943.1 15811 VCLVIGTAGQSIEQPTELIAMEGAVVQVNCTYRTSGFNGLSWYQQHEGREPIFLSYTVLDGLTGRGHFSSFLSRSDGYSYLLLKELQIKDSASYFCAVR
Carlito syrichta V13 trav ABRT02146943.1 39851 TAGQSIEQPTELTAMEGAVVQVNCTYKTSGFNGLSWYQQHDGRAPIFLFYIVLDGLVERGRFSSFLSRSDGYSYLLLKELQMKDSASYFCAVR
Carlito syrichta V14 trav ABRT02146946.1 24508 AKSEDQVFQPSIVASSEGAVAEIFCNHSVSNAYSFFWYLYIPGRAPRLLIKGSRPSQQGRYNMTYERFSSSLLILQVQEADAAVYYCALEHTEAGN
Carlito syrichta V15 trav ABRT02146946.1 43357 GLRAQSVTQPEDQVTVAEGDPLTVKCTYSFSGTPYLFWYVQYPNQGLQFLLKYLTGDNLVKGSYGFEAEFNKSQTSFHLKKASALGSDSALYFCAVR
Carlito syrichta V16 trav ABRT02146946.1 54540 TLSLAKTTQPIFMDAYEGQEVNISCSHSDIATNDYIYWYQQFPNQGPRFVIQGYKTNVTNEVASLFILADRESSALSLPRVALSDTAVYYCIVG
Carlito syrichta V17 trav ABRT02146946.1 62185 GTGAQSVTQPDSHITVSEGAPLQLRCNYSSSVPPYLFWYVQYPDQGLQLLLKSVSENSLVEGMKSFEAEFRKSETSFYLKKASIHLSDSAKYFCALS
Carlito syrichta V18 trav ABRT02146946.1 71340 MSRGEKVEQSPSFMSVPEGDSAVINCTYTDSASTYFYWYKQEPGEGLQLLLNIFSNMDKKQDRRLTVLLNKEDKHLSLYIADSQPGDSAVYFCAAS
Carlito syrichta V19 trav ABRT02146946.1 80084 VNSQQVEQNPQALSIQEGEKATMSCNYTNYSPGFLQWYRQDPGKGLVFLLLIRENEREKQKGRLRVTFDTTLKQGSFHITASQPTDSATYLCTAD
Carlito syrichta V20 trav ABRT02146946.1 97371 VKGENQVEQNPRFLEPQEGDVTSMSCTYSVSGFNNLQWHRQNTGAGPKHLFSMYSAGDEKQKGRLRAILLKNGSSLYITAVQPEDSAIYFCAV
Carlito syrichta V21 trav ABRT02146946.1 109295 DARGQSVTQPDGHIILSEGASMELRCNYSYGGAPYLFWYVQYRGQGLQLLLRYFSGDTLVQGIKGFEAEFKKSETSFNLKKPSAQMSDTAVYFCALS
Carlito syrichta V22 trav ABRT02146946.1 121708 GSNGDSVTQTEGQVLLSEGDFLRVNCSYETSQYPALFWYVQYLGEGPQLLLRAAKANDKGSNKGFEATYNKETTSFHLEKASVQESDSALYYCALS
Carlito syrichta V23 trav ABRT02146946.1 128592 DARAQSVIQPDVHVTVSEGASVELRCNYSYGATPYLFWYVQYPGQGLQLLLKSFSGDIHVQGIKGFEAEFMKSKSSFNLRKPSVLWSDTAKYFCVLS
Carlito syrichta V24 trav ABRT02146946.1 142764 VSKGENVEQQPSILRVQEGDNSVINCTYSDSASSYFPWYKQELRKGPQLIIDIRSNMDKKQDQRITVLINAVAKHLSLHIADTQPGDSAVYFCAAS
Carlito syrichta V25 trbv ABRT02178425.1 19412 PVNAGVTQTPMFQVLEAGQSMTLTCAQDMNHEGMYWYRQDPGLGLKLIHYSVAVGTFSKGEVPDGYSVSRSRTENFSLTLESATHSQTSVYFCA
Carlito syrichta V26 igkv ABRT02192780.1 15319 CSGDVVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVTAEDVGIYFCHQGTNIP
Carlito syrichta V27 igkv ABRT02192782.1 59603 ARCDIQMTQSPSSISASLGDRVTITCRASQGISSNLHWYQQKPGNPPKLLIYWASSLQSGVPSRFSGSGSGTDFTLTINTLQSEDAAVYFCQHSYGTP
Carlito syrichta V28 ighv ABRT02233684.1 5312 VQCEVQLVASGGGLVQPGGSLRLSCVASEFAFSSFWMHWIRQAAEKGLEWISNMNQSGGSTNYVDSVKGLFTTSRDNAKNMFYLQMNNLQVEDIGVYFCAR
Carlito syrichta V29 ighv ABRT02233685.1 756 VQCEVQLVASGGGLVQPGGSLRLSCVASEFAFSSFWMHWIRQAAEKGLEWISNMNQSGGSTNYVDSVKGLFTTSRDNAKNMFYLQMNNLQVEDIGVYFCAR
Carlito syrichta V30 igkv ABRT02237896.1 100 ARCDIQVTQSPSSLSASVGERVTITCRASQNINNELSWYQQKPRKAPKLLIYAASTLQSGVPSRFSGSGYGKDFTLTISSLQSEDFAIYYCLQDYSAA
Carlito syrichta V31 iglv ABRT02250024.1 3123 SLSQTILTQSFSLSASPGASARLTCTLSSDISVGGKAIFWNQQKPGSPPHYLLYYHTDSIKNQGSGVSNYFSGSKDASVNAQILHISRLQAEDEADYYCMT
Carlito syrichta V32 igkv ABRT02257504.1 8672 VRCDIQMIQSPSSLPASVGDRVTLTCQASQSIGNDLSWHQQKPGKAPNLLIYEATKLNSGVPSRFSGSRSGKHYTLTISSLQPEDLGTYYCLQDYDYP
Carlito syrichta V33 trav ABRT02290529.1 1322 GTGAHSVTQPDGHITVSEGAPLELRCNYSFSYSSYLFWYVQYHNQGFELLLKYVPGNTPVKGIKGFEAEFKKSESSFHLKKSSAHLRDSAEYFCATS
Carlito syrichta V34 trav ABRT02290531.1 2318 GTRAQIVTQPEDHLSVSEGAPVQLKCNYSYSGSPRLFWYVQYPKQSLQLLLKHISGESIKGFTAEFNKREASFHLKKTSAQEEDSATYYCALS
Carlito syrichta V35 trav ABRT02290531.1 12487 VNGQQGEETLQMLSIQEGENAIMNCSYKSSITNLQWYRQDSGRGPALIILIRSNEREKHDGRLRTTLNTSAKSSFLFITASQAADTATYFCAVS
Carlito syrichta V36 igkv ABRT02318655.1 870 ARCDIQMTQSPFSLSTFVRGRVTITCQASQSIGNELSWYQQKPEKAPKLRDYAAYTLRSMVPSRFSGSGSRADYSLTISILQPEDVATYYCLQDYSPP
Carlito syrichta V37 igkv ABRT02318661.1 467 ARCDIQMTQSPFSLSTFVRGRVTITCQASQSIGNELSWYQQKPEKAPKLRDYAAYTLRSMVPSRFSGSGSRADYSLTISILQPEDVATYYCLQDYSPP
Carlito syrichta V38 ighv ABRT02320645.1 1700 VLSQVQLQESGPGLVKPSETISLTCVISGDTVSSNSATWNWIRQSPEKGLEWLARIYYSSTWYRNYAPSLQSRVTIDPDTSKNQFSLRLSSVTPEDTATYYCAR
Carlito syrichta V39 trbv ABRT02323804.1 5869 LVGSGVTQRPKHQIKAKGQRVTLRCYPMSGHLYVYWYQQSLGQALQFLIQFYNGKEREKGNFPDRFSAQQFRDYRSELNLSSLELEDSALYFCASSS
Carlito syrichta V40 igkv ABRT02328838.1 2993 ARCDIQVTQSPSSLSASVGERVTITCRASQNINNELSWYQQKPRKAPKLLIYAASTLQSGVPSRFSGSGYGKDFTLTISSLQSEDFAIYYCLQDYSAA
Carlito syrichta V41 iglv ABRT02330377.1 11886 ASSQAVVTQETSLAITPGGTVTLTCGSSTGAVTTSNYARWVQQTPYQGPRGLIGGTRNRVSGVPAQFSGSLLGGKTALTITGAQPEDKAEYYCALWFSNH
Carlito syrichta V42 iglv ABRT02330379.1 55347 SQAQSVLTQPASVSGNLGQRVTISCTGSSSNIGAGYPVHWYQQLSGAAPKLLIYSNSNRPSGVPDRFSGSKSGSSGSLTITGLQPGDEAGYFCQAYDKGLKI
Carlito syrichta V43 iglv ABRT02331904.1 6719 IWAQVIFTQPRSVSGSPGREVSISCIRSSGSIDDYYVHWYQQRPGSAPANVIYQDNQRPSGVPNRFSGSIDSSSNSALLTITGLQPEDEADYFCQSYGDNHN
Carlito syrichta V44 igkv ABRT02334751.1 25030 CSGDVVMTQSPLSLSVPLGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVAAEDVGVYYCQQHIKYP
Carlito syrichta V45 igkv ABRT02335711.1 11316 ARCDIQVTQSPSSLSASVGERVTITCRASQNINNELSWYQQKPRKAPKLLIYAASTLQSGVPSRFSGSGYGKDFTLTISSLQSEDFAIYYCLQDYSAA
Carlito syrichta V46 iglv ABRT02336551.1 35511 SLSQLVLMQPPSLFTSPGSPARLTCTLSSGFIVGGYHMSWYQYKPESHPFLLSFYSDSSKNQGFMVPRCFSGSKDTSASPEILHILGLQTEDEADYYCNA
Carlito syrichta V47 trbv ABRT02338750.1 11555 PADTAVSQTPKYLITLMGNKESLECEQRLGHDTMYWYKQDSKQFLKLMFSYNNKELIVNESVPNRFSPESPDKAHLKLHIKSLEPGDSAVYLCASTQ
Carlito syrichta V48 trbv ABRT02338750.1 25532 PADTAVSQTPKYLVTLMGNKELLKCEQTLGHNAMYWYKQDFKQFLKLMFRYNNKKLIANESVPNRFSAESPDKAHLKLHIKSLEPGDSAVYLCASSQ
Carlito syrichta V49 trbv ABRT02338751.1 7219 HTGAGVSQDPKHKVTERGQDVELRCDPISGHVSLYWYRQTLGQGLEFLIYFQSEDAVDTSGLPNDRFSVERSKGSFSRLKIQHTEKGDSAVYLCASSI
Carlito syrichta V50 igkv ABRT02338864.1 3256 NSVDVVMTQTPLSLPITLGELASISCRSSQSLQHSNGNNHLDWFLQKPGQSPQLLIYLASRRASGVPDRFSGSGSGTDFTLKINRVEAEDVGVYYCMQAIHAP
Carlito syrichta V51 ighv ABRT02339619.1 16448 VCAQVQLVQSKAEVKRPGESLKISCKTSGYSFTSNWISWIRQMSGKGLEWMGSIDPGDSETHYSPSLQGQVTISVDSSVSTAYLQWRSLKISDTAMYYCAR
Carlito syrichta V52 ighv ABRT02340981.1 12200 VQSQVQLVQSGAEVKKPGTSVKISCKTSGYTFTGYAMSWVRQSNGEGLEWMGYIYPGSGDTDYSQKFQGRVTMTSDTSTNTAYMELSSLRPEDSGTYYCAR
Carlito syrichta V53 igkv ABRT02361330.1 3741 NSVNVVMTQTPLSLPITPGEPASISCRSSQSLQHSNGNNYLEWFLQKPGRTPQLLIYLASRRASGVPDRFSGSGSGTDFTLKINRVEAEDVGVYYCMQVIHTP
Carlito syrichta V54 igkv ABRT02361331.1 10350 ANGEIVMTQTPASLASSPGERVSLTCRASQSVSNYLTWYQQKPGQAPKLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPDDFGVYYCQQYSNW
Carlito syrichta V55 ighv ABRT02366104.1 4034 IHCDVQLVESGGGLVQPGGSLKLSCVGSGFTFSSYAMGWVRQAPEKGLEWVSLISDNGGNKYYADSVKGRSTISRDNAKNLMNLLINSLTAEDTGTYYCARE
Carlito syrichta V56 trbv ABRT02374382.1 12056 PVDTAISQTPKYLITLMGNKESLKCEQRLGHDAMYWYKQDSKQFLKLMFSYNNKELIASESVPNRFSPESPDTAHLKLHIKSLEPGDSAVYLCASSQ
Carlito syrichta V57 ighv ABRT02375023.1 49044 VQSQVQLVQSGAEVKKPGTSVKISCKASGYTFTDYDMHWVRQSNGEGLEWMGYINPSSGGTSYAQKFQGRVTMTRDTSTNTAYMELSSLRPEDLAMYYCAR
Carlito syrichta V58 iglv ABRT02376702.1 38982 QVIFTQPSSVSGSPGQEISISCKRSSGSINDYYVHWYQQRPGSAPTNVIYQDKQRPSGVPNRFSGSIDSSSNSASLTISGLQPEDEADYYCLSSEDDY
Carlito syrichta V59 iglv ABRT02376702.1 53855 SLSQPVLMQTPSLSVYTGAPARLTCTLSSGFIGGGYYISWYQQNPRSPPRFLLRFYSDSSKNKGSRVPRHFSGSKDSLANAGILHISGLQREDEAEYYCSV
Carlito syrichta V61 ighv ABRT02390005.1 31704 VQCDVQLVESGGGLVQPGGSMKLTCVASGLTFGDYYMDWVRQAPGKGLEWIVHVRNKANGYSTEYAASVKGRFTISRDDSKNSMYLQMNSLKTEDTAVYYCTR
Carlito syrichta V62 iglv ABRT02393491.1 30826 SVAKAGLTQSSSVSKGLGLTAELTCIGNSNNVGNEGVVWLQQHEGHSPKVLADRRNNRPSGISERFSASRSGSTASLTISGLQPEDEAEYYCSAWDSSLRA
Carlito syrichta V63 iglv ABRT02393491.1 51956 SLSQPVLTQSPSASASLGASTKLTCTLSNKYSSNAIAWHQQHPGKAPRFLMKVYSDGSHNKGDGIPDRFSGSSSGVDRYLTISNIESGDEAVYYCQTWGVST
Carlito syrichta V64 iglv ABRT02393492.1 36975 SLFQTILTQPSSLSASPGTSARLACNLSSDISVGGKAIFWYQQKPGTPPHCLLYNHTDSIKNQGSGVPNCFSGSKDASANAEILHISGLQAEDEADYYCMT
Carlito syrichta V65 iglv ABRT02393492.1 87253 SLSQPVLTQPSSASASLGASVKLTCTLSSEHSDYSIAWHQQQQGKAPRYLMYVPSAGSHTNADGIPNRFSGSSSGSDRYLTITNVQLEDEAVYFCETWDSSI
Carlito syrichta V66 ighv ABRT02397493.1 157792 VQCEVQLVESGGGLVQPGGSMRLSCSASGFTFSQYGMHWIRQVPENGLEWVAVIWYDGSQKYYADSVKGRFTISRDNNKNMLYLQMDSLRTEDTARYYCAS
Carlito syrichta V67 trav ABRT02409404.1 9607 SGIGQKVTQAQPAMLVQEKETLTLDCTYDTRAGDYGLFWYKQPSSGEIILLIHQDSYNQQNATESRYSLNFQRASKSISLVISASQLRDTAMYFCALRE
Carlito syrichta V68 trav ABRT02409405.1 8687 RTCGVSVTQMEGQVTALEGAFLTINCTYTATGYPALFWYVQYPGEGPQLLLKAAKANEKGSNKGFEATYKKETTSFHLEKASVQESDSALYYCALS
Carlito syrichta V69 trav ABRT02409406.1 7928 VSGKNQVEQSPQSLITLEGDNCTLQCNYTVSPFNNLRWYRQDTESGPVLLTVMFSGENTKSNGRYTATLDASVKRSSLHLTASQLSDSASYICVVG
Carlito syrichta V70 trav ABRT02409406.1 11629 VNNQHTLEQSPSYLSILEGTHAILNCTYQERSFFNFYWFRQDPGKGLVSLALTQSGQKEQGDTNVKEMLGKEKSYSIYNISAFHPGDSAMYFCAL
Carlito syrichta V71 trav ABRT02409406.1 20645 VTSQQKEVEQNTESLSVPEGATAPLNCTFSDRGSRNFMWYRQYSGKGPELLIAIYSNGDKEDGRFTVQLNKGSQYVSLLIRDSQISDSATYLCAVS
Carlito syrichta V72 trav ABRT02409406.1 46460 MSGEEDMGLRLPTLSVQEGDSFVINCTYSDTASSYLAWYKQELGKGPQLIIGIRSNEGKREDGRLTVLLNKMAKHLSLYITNTQPGDLAVYFCAES
Carlito syrichta V73 ighv ABRT02414126.1 23733 VQCEEQLVESGGGLVQPGGSLRLSCEASGFSFSNFWMNWVRQAPEKGLEWISYIDTSGRTNYADSVKGRFTTSRDNAKNMLYLQMNNLKDEDTGVYFCAR
Carlito syrichta V74 ighv ABRT02414130.1 31433 VQCDVQLVESGGGLVQPGGSLKLTCVASGFTFGDYYMDWVRQAPGKGLEWVGRVRNKANGYSTEYAASVKGRFTISRDDSKNSVYLQMNSLKTEDTAVYYCTR
Carlito syrichta V75 trbv ABRT02415813.1 22993 HTDAGVNQTPRHKVTEKGQAVTLECEPSSGHSALYWYRQTLVQGLELLIYFRSQSPVDDGVMPKTRFSAEMSNASFSSLKIQPTEPEDSALYLCSSSI
Carlito syrichta V76 igkv ABRT02419364.1 7015 ASCDIQMTQSPSSLSASLGERMSITCRASQDIRKNLGWYQQQPGKPPRPLIYYASALQSGVPSRFSGSGSGTDYTLTINNLQPEDVATYFCQQYNSNP
Carlito syrichta V77 trbv ABRT02424261.1 13797 LTEAGVTQSPRHKITEKSQAVVFWCDPVSGHNTLYWYRQSLGQGPELLIQFQNEAVLDDSQLPKDRFSVERRKGVNSTLKIQPAELGDSAVYLCASSL
Carlito syrichta V78 trbv ABRT02424262.1 14640 HITAGVTQFPSHRVVEKDQAVTLRCDPISGHDALHWYQHAVGKKMKFLIYFLQEYIQDKSGMSNDRVSAERTEGTYSILKIQPAELEDSGVYLCASSP
Carlito syrichta V79 trbv ABRT02424262.1 21155 LVGAMVIQNPRYRVTRVGKPVNLSCSQNLNHDAMYWYQQKRNQAPKLLFYYYDQELNKEADTSDNFQSSRPNTSFCSLHIHSPGIEESAMYLCASSR
Carlito syrichta V80 trbv ABRT02424264.1 13965 IMDGGVTQVPKYLFRKEGQAVTLECEQNLNHDSMYWYRQDPPQGLRLIYYSQVTKDVQKGDIAEGYSASREKKAFFPLTVTSTQKNQTALYFCASST
Carlito syrichta V81 trbv ABRT02424265.1 9721 CMDTEVTQSPRHLVKGKEQKAKINCIPIKGHSYVYWYHKKPEEGLKFLVYFQNQEVLEKSEVINERVSAQCPRNSSCSLEIQSTEAEDSALYFCASSE
Carlito syrichta V82 trbv ABRT02424267.1 1798 SFYAKVIQTPGHLVKGTGQKAKMDCIPQKGHTFVYWYQQNQNKELTFFIYFQNERILDQMEKDKERFSAQCLSNSPCSLEILSSEPRDSALYLCASSQ
Carlito syrichta V83 trbv ABRT02424268.1 8255 TMDAGVTQTPRNRITKTGGNITLECSQTMGHIQMYWYRQDPGLGLQLIYYSLGVNDVNKGEVSDGYNVFRKEQAKFSLSLETASTNQSALYLCASS
Carlito syrichta V84 trbv ABRT02424268.1 16150 LIDAGISQTPRHYVSGTGKKITLECSQTMGHDKMYWYRQDPGMELQLIHYSYGVNITEKGEFSSASTVSRIRKEHFPLILESASPSHTSQYLCASS
Carlito syrichta V85 trbv ABRT02424270.1 20229 LMDTKVTQTPRYLVKRMGENVLLECLQHMDHERMYWYRQDPGLGLRLIYFSYNVDSNEKGDVPEGYSVSRKKKENFSLILESANTNQTSVYLCTSSLSA
Carlito syrichta V86 trbv ABRT02424270.1 37551 LGSVLGALLFQKPSRDICQRGTSMMIQCQADSQLATMFWYRQLPGESLILIATANQGVKATYESGFTEHKFPISRPNLTFSTLTVSNVSPEDSSLYFCSAG
Carlito syrichta V87 igkv ABRT02430158.1 29208 CNGDIVMTQTAHSLPVTLGEPASISCRSSQSLLHSDGNTYLSWYLQKPGHSPQGLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQ
Carlito syrichta V88 ighv ABRT02439313.1 1012 VQCQVQLVESGRGLVQPGGSLRLSCEASGFSFSNAWMNWIRQAPEKGLEWISYINPNGGSTDYADSVKGRFTTSRDNAKNMLYLQMNNLQEEDTGVYFCAR
Carlito syrichta V89 iglv ABRT02440074.1 50698 SVTSSELTQVSAVSVALEQTVRITCQGDNIGIFGAHWYQQKSSQAPVLVIYGSSNRPSGIPERFSGSRSGNTATLTISRAQIEDEADYYCQSRDSSGNY
Carlito syrichta V90 iglv ABRT02440076.1 20364 SWAQSALTQPPSISKAPRELVSISCVGSSSDIEHSNYISWYQQHLGTAPRLLIYDVNKRPSGIPDRFSGSKSGNTASLTISELQSEDEADYYCGVNVGSTY
Carlito syrichta V91 iglv ABRT02443986.1 6141 SQAQSVLTQPASVSGNLGQRVTISCTGSSSNIGDGYYVHWYQQLSGAAPKLLIFDNSKRPSGVPDRFSGSQSGSSGSLTITGLQPEDEADYYCQSYDKDLRI
Carlito syrichta V92 iglv ABRT02443987.1 6180 ASSQAVVTQETSLDITPGGRVTLTCGSSTGTVTTSNYARWVQQMPYQILRGLIGGTSNRLSGVPARSSGSLVGGKTALTIMGAQPEDEAEYYCALWFSNH
Carlito syrichta V93 ighv ABRT02448358.1 39588 VQCDVQLVESGGDLVQPGGSLKLTCVASGFTFGDYYMHWVRQAPGKGLEWVALVRNKANGYRTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCTR
Carlito syrichta V95 iglv ABRT02456014.1 22135 SVSTNELTQSRSVSVSLGQTARMTCSGDVLAKKYTQWYQQKPGQTPVLVIYKDSERPSGVSERFSGSSSGTTVTLTISGAQAEDEADYYCQSWDSSGNH
Carlito syrichta V96 iglv ABRT02456016.1 32010 IWAQSVLTQPPSISGAPGSSISISCAGSNSDVGRYNDVSWYQQNPGTAPKLLIYGVSTRPSGVPDRFSGSKSGNTASLTISRLQIEDEAVYYCSSYTSG
Carlito syrichta V97 iglv ABRT02456016.1 95337 QSALTQPPSVSGAPAESASISCGGSSGDIGGYDLVSWYQHHLGTDLKPHIYGVRYQYSRVPDHFSSFKSGNTACLTISELHNEDEAGYYCSSYASSGI
Carlito syrichta V98 ighv ABRT02463196.1 29251 AHSQVQFVQSGAEVRKPGASVKVSCKASGYTFTSYFMHWVRQVPGQGLEWVGRIDPEDGETNYAQKFQNRVTMTSDTSSNTGYMELKSLRPEDTAIYYCA
Carlito syrichta V99 ighv ABRT02473142.1 18384 VQSQVQLVQSGAEVKKPGTSVKISCKASGYIFTSYTMHWVRQSNGEGLEWIGYIYPGNGGTSYAQKFQGRVTMTSDTSTNTAYMELSSLRPGDSATYYCAR
Carlito syrichta V100 ighv ABRT02473292.1 9897 VHCDVQLVESGGGLVQPGGSLKLTCVGSGFTFSSYHMDWIRQAPEKGLEWVSYISYDAGYTNYADSMKGRSTISRDNVKNLMNLLINSLKAEDTGIYYCV
Carlito syrichta V101 ighv ABRT02473297.1 45020 VHCDVQLLESGGGLVQPGGSLKLSCKASGFTFSDHYMSWVRQAPEKGLEWVSYISYDGGYTNYADSVKGRFTISRDNAKNLLNLLINSLKAEDTGTYYCV
Carlito syrichta V102 ighv ABRT02474757.1 225 VQSQVQLVQSGAEVKKPGTSVKISCKASGYTFTGYAMNWVRQSNGEGLEWMGRINPSSGGTNYAQKFQGRVTMTSDTSTNTAYMELSSLRPEDSATYYCAR
Carlito syrichta V103 igkv ABRT02003290.1 2917 VSCDIQMTQSPSFLSASLGDRITITCRASQGISNWLSWYQQKPGNPPKHLIYYASSLQSGVPSRFSGSRSGTDYTLTVSSLQPEDPAIYFCLQYDSYP
Carlito syrichta V104 igkv ABRT02015989.1 1122 ASCDIQMTQSPSSLSASLGERVSITCRASQDIKKYLAWYQQEPGKPPRPLIYAASSLQSGVPSRFSGSGSGTDYTLTINNLQSEDVATYFCQQYYSYP
Carlito syrichta V105 ighv ABRT02020209.1 9861 VQCEVQLVASGGGLVQPGGSLRLSCVASEFAFSSFWMHWIRQAAEKGLEWISNMNQSGGSTNYVDSVKGLFTTSRDNAKNMFYLQMNNLQVEDIGVYFCAR
Carlito syrichta V106 ighv ABRT02020357.1 4275 VQCEVQLVASGGGLVQPGGSLRLSCVASEFAFSSFWMHWIRQAAEKGLEWISNMNQSGGSTNYVDSVKGLFTTSRDNAKNMFYLQMNNLQVEDIGVYFCAR
Carlito syrichta V107 igkv ABRT02039549.1 1156 VRCDIQMIQSPSSLPASVGDRVTLTCQASQSIGNDLSWHQQKPGKAPNLLIYEATKLNSGVPSRFSGSRSGKHYTLTISSLQPEDLGTYYCLQDYDYP
Carlito syrichta V108 igkv ABRT02056649.1 5412 ARCDIQMTQSPLSLSASLGDRVTITCRASQDISNYLHWYQQKPGNPPKPLIYRASSLQSGVPSRFSGSGSGTDFTLTINTLQSEDAAVYFCQHGYGTP
Carlito syrichta V109 iglv ABRT02069033.1 460 ASSQAVVTQETSLAITPGGTVTLTCGSSTGAVTTSNYARWVQQNPYQVPRGLIGDTSNRVSGVPARFSGSLLGGKAALTITGAQPEDEAEYYCALWFSNH
Carlito syrichta V110 iglv ABRT02077311.1 7316 CLSQPVLTQPPSASASLGASTKLTCTLSSGYSSYAIAWQQQQPGKAPQYLMEVYSDGSHNKGDGIPNRFSGSSSGADRYLTISNVQSEDEADYYCQTWDGSS
Carlito syrichta V111 trdv ABRT02082694.1 100011 KGMLCVKMTQSSPDQTVASGSQVVLLCTYDAEFSNPDLYWYRMGPDHSFQFVLYRDISKSLNADFTQGRFSVKHSQTQKTFHLVISPVKTEDSATYYCGF
Carlito syrichta V112 ighv ABRT02105000.1 14560 AHSQVQLKTRTEVGKPGASVKVSCKASGYIFTSYYMYWMQQVPEQGLEWMGSVDTKDGTPNYAQMFQCSITMIGDTSVKTTYMELKSLSLEDTAIYYCVR
Carlito syrichta V113 trav ABRT02118690.1 299 GTRAQIVTQPEDHLSVSEGAPVQLKCNYSYSGSPRLFWYVQYPKQSLQLLLKHISGESIKGFTAEFNKREASFHLKKTSAQEEDSATYYCALS
Carlito syrichta V114 iglv ABRT02120391.1 52285 SVTSSVLTQVSAVSVTLGQTAKITCQDDILEILNANWYQQKPGQAPVLIIYDSSDRPSGIPERFSGSKSGNTATLTISMAQAEDEADYYCQILDINTSY
Carlito syrichta V115 iglv ABRT02126406.1 7250 SWAQSGLTQEASVSESVRQKVTLSCTGERNNVGSYTVGWYQQISHNTPKTVMLGSTRPSGIPDRFSGSKSGNTASLTISDLQPEDEAIYYCSTWDSSLG
Carlito syrichta V116 trbv ABRT02145803.1 4298 HTQPKVTQTPSHQVIEMGQRVILRCDPISGHLYFYWYQQILGQKVEFLFYIYNDNISEKSERHSGSYITLKIQPTKLQDSAVYFCASS
Carlito syrichta V117 igkv ABRT02147061.1 15127 VSCDIQMTQSPSFLSASLGDRITITCRASQGIINWLSWFQQKPGNSPKQLIYKASNLQSGVPSRFSGSGSGTDFTLMISNLQPEDVATYFCLQYDSVS
Carlito syrichta V118 igkv ABRT02245081.1 3981 ANGEIVMTQTPTSLASSPGERVSLDCRASQSVSNYLAWYQQKPGQAPKLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPDDFGVYYCQQYNNWP
Carlito syrichta V119 ighv ABRT02256570.1 9736 VCAQVQLVQSKAEVKRPGESLKISCKTSGYSFTSNWISWIRQMSGKGLEWMGSIDPGDSETHYSPSFQGQVTISADSSVSTAYLQWRSLKISDTAMYYCAR
Carlito syrichta V120 ighv ABRT02256572.1 2223 VCAQVQLVQSKAEVKRPGESLKISCKTSGYSFTSNWISWIRQMSGKGLEWMGSIDPGDSETHYSPSFQGQVTISADSSVSTAYLQWRSLKISDTAMYYCAR
Carlito syrichta V121 ighv ABRT02265554.1 39757 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTNYDITWVRQAPGQGLEWMGWVNTNNGNTDYAQKFQGRVKMTRDTSTSTACMELSSLSPEDTAVYYCAR
Carlito syrichta V122 iglv ABRT02270943.1 102322 SWAQSALTQPLSVSRAPGESVSISCGGGSDNIRGYDLVSWYQQHLVTAPKLLIYGVSYRHSGVPDHFSGFKSGNTACLAISGLQNEDETDYYCGSYAGSGI
Carlito syrichta V123 trav ABRT02292217.1 2829 SGIAQKVIQAQQAVLVQEKEVVTLNCTYDTTVRSYSLFWYKQPSSGEMILLIHQLSYDRENATEGRYSLNLRKSSKSISLVISALQLGDSAMYFCALMQ
Carlito syrichta V124 igkv ABRT02319399.1 6233 ARCDIQMTQSPSSLSASLGDRVTITCWASQGISIYLQWYQQKPGNPPKLLIYGASKLQSGVPSRFSGRGFGIDFTLTINTLQPEDVGNYYCQQSTSYP
Carlito syrichta V125 igkv ABRT02319400.1 6234 ARCDIQMTQSPSSLSASLGDRVTITCWASQGISIYLQWYQQKPGNPPKLLIYGASKLQSGVPSRFSGRGFGIDFTLTINTLQPEDVGNYYCQQSTSYP
Carlito syrichta V126 igkv ABRT02319401.1 6234 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISIYLQWYQQKPGNPPKLLIYGASKLQSGVPSRFSGRGFGIDFTLTINTLQPEDVGNYYCQQSTSYP
Carlito syrichta V127 igkv ABRT02319608.1 2387 ASCDIQMTQSPSSLSASLGDRVTITCRASQSISRWLAWYQKKLGKPPKLLIYGASSLQTGVPSRFSGSGSGTDFILTISSLQPEDVATYYCLQ
Carlito syrichta V128 igkv ABRT02319609.1 2386 ASCDIQMTQSPSSLSASLGDRVTITCRASQSISRWLAWYQKKLGKPPKLLIYGASSLQTGVPSRFSGSGSGTDFILTISSLQPEDVATYYCLQ
Carlito syrichta V129 igkv ABRT02319610.1 2387 ASCDIQMTQSPSSLSASLGDRVTITCRASQSISRWLAWYQKKLGKPPKLLIYGASSLQTGVPSRFSGSGSGTDFILTISSLQPEDVATYYCLQ
Carlito syrichta V130 igkv ABRT02319614.1 2387 ASCDIQMTQSPSSLSASLGDRVTITCRASQSISRWLAWYQKKLGKPPKLLIYGASSLQTGVPSRFSGSGSGTDFILTISSLQPEDVATYYCLQ
Carlito syrichta V131 igkv ABRT02330097.1 6671 SNGGVVMTQIPLTLSITPGELTSISCRSSQSLLDSSGHTYLEWYLQKPGQPPQPLMYSVSNRASGVPDKFSGSGSGSDFTLKISRVEAEDVGVYYCMQA
Carlito syrichta V132 igkv ABRT02330470.1 5395 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISNNLHWYQQKPGHPPKLLIKLASNLQSGVPSRFSGSGSGTDFTLTINTLQPEDIANYYCQQSNSYP
Carlito syrichta V133 ighv ABRT02335790.1 37188 VHCDVQLVEPGEGLVRPGGSLKLSCEASGFTFSDYAMSWVRQAPEKGLEWVSFISYDGENTYYTDSVKGRSTISRDNAKYLLNLLINSLKVGDTGTYYCAR
Carlito syrichta V134 igkv ABRT02335862.1 8907 ARYDIQMTQSPTSLSASLGDRVTITCWTNQGIGNNLHWYQQKPGNPPKLLIYLASSLQSGVPSRFSGSRSGTDFTLTINTLQPEVVANYYCQQSN
Carlito syrichta V135 ighv ABRT02335925.1 18600 VQCKVQLVESGGGLVQPGGSLKLTCVASGFTFRDYHMVWVRQAPGKGLEWVGVVRNKANGYSTEYAASVKGRFTISTDDSKNSVYLQMNSLKTEDTAVYYCAT
Carlito syrichta V136 iglv ABRT02339901.1 3945 ASSQAVVTQETSLAITPGGTVTLTCGSSTGAVTTSNYASWVQQTPYQVPRGLIGDTSNRVSGVPARFSGSLLGGKAALTITGVQPEDEAEYYCALWFSNH
Carlito syrichta V138 ighv ABRT02340724.1 13363 VQCEVQLVESGGGLVQPRGSLRLSCEATGFAFNSFWMYWIRQAPEKGLEWISYINPNSGSTGYADSVKGRFTTSSDNAKNMLFLQMNNLQKEDTGVYFCAK
Carlito syrichta V139 ighv ABRT02340968.1 349 VQCDVQLLESGGGLVQPGGSLKLTCVASGFTFGNYYMHWVRQAPGKVLEWVGFVRTKANGYSTEYAASVKGRFTISRDDSKNSVYLQMNSLKTEDTAVYYCTR
Carlito syrichta V140 ighv ABRT02354065.1 13175 VQCEVQLVESGGGLVQPGGSLRLCCEASRFPFSSFWMYWICQAPQKELEWLSNINQNGGSTNYADSVKGRFTTSRDNTKTMLYLQMNNLQKEDTGVYFCAK
Carlito syrichta V141 igkv ABRT02354257.1 11133 ASCDIQMTQSPSSLYASLGERVSITCRASQDIRKYLAWYQQQPGKPPRPLIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDIATYFCQQYDSTP
Carlito syrichta V142 ighv ABRT02356730.1 11169 VHCDVPLVESGGGLFQPGGSLKLSCKVSGFTFSDYDMSWVHQAPEKGLKWVSFISYNGRNTYYADSVKGRSTISRDNIEKLLNLLINSLTAEDIAIYFCAR
Carlito syrichta V143 ighv ABRT02361038.1 12629 VQSQVLLVQSGAEVKKPGTSVKISCKASGYTFTNYNMHWVRQSNGKGLEWIGYIYPGNGGTSYAQKFQGRVTMTSDKSTNTAYMELSSLRPEDLAMYYCAR
Carlito syrichta V144 ighv ABRT02361338.1 22643 VHCDVQLVESGGGLVQPGGSLKLSCVGSGFTFSNHAMGWVRQAPEKGLEWVSSISYHGGYTTYADSVKGQSTTSRDNAKNLMNLLINSLKAEDTGIYYCV
Carlito syrichta V145 igkv ABRT02374497.1 60621 ASGNTVLTQSPNFLSVSLKDSISIVCRASESISDYLSWYQKKPGQPPKLLIYDANDRYSDVSPRFNGMQSGTEFIFTISSVEVDDAGSYYCQQDHTVP
Carlito syrichta V146 trdv ABRT02377353.1 1594 SSRANTVTQVQTTITVQEGEPATLNCLYETKGTFYSLYWYKQSLSGGMIFLIYQDSSKANAKQGRYSVNFEKAKKFIQLTISFSQLKDSANYFCVLFE
Carlito syrichta V147 trav ABRT02377355.1 70545 TTIDAKTTQPDSMDCAEGEAASLPCNHSTISGNEYIYWYRQILFQGPEFVIHGLKNNVTNEMASLIIPADRKYSTLILPHVTLRDTAMYYCIVVV
Carlito syrichta V148 trav ABRT02377355.1 61751 GSRAQLVTQHDAHITVSEEAPLELRCNYSYSGTPYLYWYVQPPGQSLQFLLKYITGATLVEGIKGFEAEFKKSETSFHLRKSSAHWSDTAEYFCAVN
Carlito syrichta V149 trav ABRT02377355.1 43276 VNTQQLEQSPRFLSIQEEEDFSTYCNSSNPFPSLQWYRQEPGESLVHLMTLVKGGEVKEQKRLTFKFGEARMSSSLHITKAQPGDAGLYLCAR
Carlito syrichta V150 trav ABRT02377355.1 36587 VRVQMKVDQSPQILIVQEGRNVSMMCNCSISIISVQWFQQKSGEPLIALFYISLEMQQKGRLKSTVNTKERYSHLYIRDSQPEDSATYFCAVE
Carlito syrichta V151 trav ABRT02377355.1 15070 VRSQRLEQSPQVLIIQEGEDVTINCNSSESLYSVHWYRQKHREGLIFLMMLLKGGEQKNHDKIAATLNEKKQQSSLHIMTSQPSYSGTYFCAVE
Carlito syrichta V152 trdv ABRT02377355.1 7464 FSISQKVIQSQLATSRQGGENVELDCSYDTNVSYYILYWYKKYPRGEITFLIFQDTDAKTNTAETKYSVSIQKATKTIQLTISSAQPKDSATYFCCLKE
Carlito syrichta V153 trav ABRT02377357.1 105684 NSNGDSVTQTESPVTLSEGTSMILNCTYQTTYSVSFLFWYVQYLNKAPQLLLKSSSENQRENQGFQANHVKSDSSFHLKKPSLQISDSAVYYCAVT
Carlito syrichta V154 trav ABRT02377357.1 99199 SSMSREVTQAQASISALEKEDVTLDCEYKAPSFSYYLFWYKQPSSGEMIFLIDQESYNEQSAMKGRYSLNFQKSASSINLTITALQLGDSAVYFCALRD
Carlito syrichta V155 trav ABRT02377357.1 79699 LSGEDQVRQSPPTLRLQEGDSSRLNCTYTVSSFRGLLWYRQYPRKGPELLFSLYSVGDEKQEERLRAMLTKKESVLHIMDLRPEDSAAYLCAVE
Carlito syrichta V156 trav ABRT02377357.1 64707 VSSKQEVKQSPASLSVPEGNILVINCSFTDTAIYYLQWFRQEPGKGLKSLLLIQSSQREQTNGRFNTLLDKSAGHSTLYITASQPADSATYLCAV
Carlito syrichta V157 trav ABRT02377357.1 48333 VRGMQVEQSPPALSLQEGASFTMRCNFSTSVNNVQWFRQNPDGRLINLFYIPTGTKKSGRLSATTVTKERQSSLSISSSQTTDSAIYFCAVEPQCSP
Carlito syrichta V158 trdv ABRT02377357.1 23107 SSVAQEVTQAQQAVSKQEGETVTLNCLYETSRVVYYISWYKQLPSREIVLLIQLGSTNQYAENGRYSVHLQKEDKSINITISALQVEDSAKYFCTLWE
Carlito syrichta V159 trav ABRT02377357.1 7760 VSSISNVEQNPWSLHVQEGDSTNFTCRFPSSSFYALHWYRWEPAKSPTILFVMTLNGDEKKEGRVKVTLNTKEGYSHLHIKGSLPEDSATYLCAV
Carlito syrichta V160 trav ABRT02377357.1 2550 VNGQQLMQIPQFLHIQEGEDFTTYCNFSMTLTVVQWYKQRPEGSPVLLMVLAKGGEVKKQKRLTARFGESRKDSSLHITAAQIADVGTYFCAV
Carlito syrichta V161 trav ABRT02377358.1 7752 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRGNTYYLFWYKQPPSGEMIFLIRQDSYNEQDETKGRYSLNFQKSTSSINLTITASQLMDSAVYFCALSK
Carlito syrichta V163 trbv ABRT02381834.1 2438 SVDSGVIQSPRHLIKVKREMAILKCYPISGHKSVYWYQQVPGQNPQFLISYYEKMENEKGNIPHRFLAQQFGDYHSELNVSSLELGDSALYLCASSL
Carlito syrichta V164 trav ABRT02382460.1 46307 SSAEVKVEQSPLSLSTQEGEDCTISCNYSSSGSDRLYWYRQGLGKSLEALFVLLSNGAVKQEGRLTASLDTKARLSTLHIAALQHGHAATYFCAV
Carlito syrichta V165 iglv ABRT02386594.1 9797 SLSQPVLTQPSSASASLGASVKLTCTLSSEYSNYNIAWHQQQQGKAPRYLMYVSSDGSHSNADGISSRFSGSSSGADRYLTISNVHSEDEANYYCQTWGSGI
Carlito syrichta V166 iglv ABRT02401873.1 56262 SVPSYELTQSPSVSVFPQQTLRITCEGNIIGNKNVYWYQQKPGQAPVLVIYYSNRRPSGIPERFSGSNLGNTASLTISGAQTGDEADYYCQVWDNYK
Carlito syrichta V167 iglv ABRT02401873.1 6482 SMASSELIQLPSASVALGRAASITCQGGGMRSYPANWYQQKLGQAPLLVIYVSNNRPTGIPEQFSGSKSGDRATLSIRAAQVRDEADYYSQSWYHCWY
Carlito syrichta V168 iglv ABRT02401875.1 18513 SVTSSELTQVSAVSVALGQTARITCQGDDLETYYAHWYQQKPGQAPVLVIYDSSNRPPGIPERFSGSDSGNTAILTISGAKAEDEADYYCQSFDSSGSY
Carlito syrichta V169 trav ABRT02402127.1 3536 SSMTQTVSQSQPEMSVQEAETVTLNCIYDTSDSNYYLFWYKQPPSRQMIPIIRQEAYKQQNATENRFSVNFQRAAKSFSLKISESQLGDAAIYFCAYL
Carlito syrichta V170 trav ABRT02402128.1 4035 PSIAQTVSQSQPEMSVQEAETVTLNCLYDTSDSNYYLFWYKQPPSRQMIPIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISESQLGDAAMYFCAYL
Carlito syrichta V171 trav ABRT02402132.1 20596 ASGQQPNQSPQSMSIQEGEDISMNCTSSSTFNTWLWYKQDPGKGPVLLITLYKSGELTRNGKLTAQLGRTRKDSFLNISDSEPADAGTYFCAG
Carlito syrichta V172 trav ABRT02402132.1 16425 VSSEDKVVQSPPYLVVHEGDSATLKCNYEVTNFQNLQWYKQEKKSPTFLLKLISSGVQKKSGRLSSILDKKELLSILNITATQIGDSATYLCALE
Carlito syrichta V173 trav ABRT02402132.1 13547 HGRASWITSQETEVYGTEGKTVNLYCNYSASSQSYADLYWFRQYPNQAPEYILYRGWGYSGKGDANFATERFYSMTTAYTTNLYIRSLVPADTALYYCALRE
Carlito syrichta V174 trav ABRT02402133.1 15700 IMGDAKTTQPNSMETTEGETVHLPCNHSTISGSEYIFWYRQIPSQGPEYVVHGLKGNVTVEMASLIISADRKSSSLILPHVALRDTAVYYCIVR
Carlito syrichta V175 trav ABRT02402133.1 4257 VSSQEVEQSPRSLTIQEGEALTINCNSSKIFYGFHWYWQKYGEGLIFLMKLQKGGEEKSHKKITFKLDEKKQQSSLHITAAQPSHSGIYFCAVD
Carlito syrichta V176 ighv ABRT02403562.1 8059 VQSQVQLVQSGAEVKKPGTSVKISCKASGYTFTNYLMHWVRQSNGEGLEWIGYIYPGNGGTSYAQKFQGRVTMTSDTSTNTAYMELSSLRPEDSAMYYCAR
Carlito syrichta V177 trgv ABRT02403726.1 174715 HLEQPQLSSTKTLSKTARLECVVSGVPISTTSIYWYQERPEQAIQLLMYILTNNTVKRETGVASNKFEIERRPETSTSTLTIHNVEKQDAATYYCAFWK
Carlito syrichta V178 trgv ABRT02403726.1 158489 GLGVTKVEQSQISVPTEVKKSVKIYCKVSSKKFETEVIHWYRQKPNQALDHLIQVASTKSPTRVQMNKRSNKFEARKNSQTFTSILTINFVEKDDVAIYYCAGWD
Carlito syrichta V179 trgv ABRT02403727.1 57936 SQMSSNFDRRTVSVTKQTGSSVVITCDIREQSIFYIHWYLFQEGKAPQHLLYYDFLSFKVVIDPEISPGKYHAYEDTGKSCKFVMENLKESDSGVYYCATWN
Carlito syrichta V180 trgv ABRT02403727.1 47629 SQISSNAGGRATSVTRSTGTPGLITCDFLETSFFYIHWYLVQEGKAPQRLLYYDTTNSQVFLESGISQGKYDAYKGTGISWKFLLRNLQESDSGVYYCATWT
Carlito syrichta V181 trgv ABRT02403727.1 630 NQASSNLEAEIMLVARPKGASVAITCDIFGENIFHVYWYIFQEGKTPQCLLYSDFSIYRVVVESEISSGKYDAYGTEKRSWKFILRNLNENDSGVYYCATWN
Carlito syrichta V182 trgv ABRT02403728.1 9807 SQASANMGVTMKSFTGTTGSSALIICDIPGLSNSYIHWYIFQEGKAPRQLLYYDSSTSWVTVESGISSGKYQGFKGRGSSWNFLLQNLQESDSGVYYCAT
Carlito syrichta V183 trgv ABRT02403728.1 2525 SQISSILDRTTMSVARLTGPSAVIICDILGSSFLYISWYQFQEEKTPQCLLYYDSSTSRIVLESGIGLGKYDAHKGTGSSWKFILRILNESESGVYYCAAWT
Carlito syrichta V184 trgv ABRT02403732.1 45334 SQVSSNTGGRMKSVTRTTGSSTLIICDNLQSSSPYIHWYLFQEGKDPRHLLYYDHSTYSVTLDSGISSWKYDAYKGSESSWNFVLKNLQESDSGVYYCATWT
Carlito syrichta V185 trav ABRT02403755.1 19380 GIGAQSVTQPEGHITVSEGAPLQLRCNYSSSYSPYLFWYVQYPNQGLQLLLKYVSGNTLVKGIKDFEAEFKKSETSFHLKKSAAHLRDSAEYFCALS
Carlito syrichta V186 trav ABRT02403755.1 3684 DTRAQSVTQPDVHITVSEEASVELRCNYSYVITPYLFWYVQYPGQGLQLLLEYYSGDSQVQGIKGFVADFEKSQSSFNLRKPSVHWSDAAEYFCAIS
Carlito syrichta V187 trav ABRT02403756.1 6847 RTCGDSVTQMEGQVTVPEGAFLTINCTYTATGYPTLFWYVQYPEEGPQLLLKAAKANDKGSNKGFEATYKKETTSFHLEKASIQESDSALYYCALN
Carlito syrichta V188 ighv ABRT02410116.1 23236 VQCEEQLVESGGGLVQPGGSLRLSCEASGFSFSRFVMHWIRQAPEKGLEWISYIGTSGGTNYADSVKGRFTTSRDNAKNMLYLQMNILKDEDTGVYFCAS
Carlito syrichta V189 ighv ABRT02411129.1 56428 VHCDVQLVESGGGLFQPGGSLKLSCKASGFTFSDYGMNWVRQAPEKGLEWVSFINYNGRNTYYADSVKGRSTISRDNAKNLLNLLINSLTAEDTAIYFCAR
Carlito syrichta V190 igkv ABRT02412688.1 10453 SSGDIVLTQTPLSLPVTLGEPTSISCKSSQSLLYSDENTYLYWYLLKPDQSPQLLIYLVSNRASGVPERFSGSRSDTDFILKINKVEAEEVGVYYCMQA
Carlito syrichta V192 igkv ABRT02430157.1 12999 ARCDIQMTQSPSSLSASLEDRVTITCRASQSISSWLAWYQQKLGKRPKLLIYRASSLQTGVPSRFSGSGSGTDFTLTISNLQPEDVATYFCEQYDRAP
Carlito syrichta V193 igkv ABRT02430158.1 69710 ACGDIVMTQSPGSLSASPGEKVTINCKSSQSLLYSNNNKNYLAWYQQKPGQAPRLLIYWASTRESGIPNRFSGSGSGTDFTLTISSIQGEDVADYFCQQSYSTP
Carlito syrichta V194 igkv ABRT02430158.1 54847 CNGDIVMTQTAHSLPVTLGEPASISCRSSQSLLHSNGNTYLSWYLQKPGHSPQGLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Carlito syrichta V196 iglv ABRT02432289.1 101845 SQAQSVLTQPASVSGNLGQRVTISCTGSNSNIGDGYYVHWYQQLSGTAPKPLIYSNSNRPSGVPDRFSGSKSGSSGFLTITELQPEDEADYYCSSYDKDLKI
Carlito syrichta V197 trav ABRT02432995.1 6501 MRSQQKEVEQNPESLSVPEGTTASLNCTFSDRSSQYFMWYRQHSGRGPELLMSIYSTGDKVDGKFTVQLNKASQYVSLLIRDSQPSDSATYLCAVS
Carlito syrichta V198 trav ABRT02432996.1 22377 MSGDENVGLHHPTLGVQEGDTSVINCTYSDSASTYFAWYKQELGKGPQHIIDIRSNMDKKQDQRLTVLLNKTVKHLSLHITDTQVGDSAVYFCAEN
Carlito syrichta V199 trav ABRT02432996.1 18787 SGISQKITQAPPAMLVQEKEAVNLSCTYDTNDASYGLFWYKQPSSGEMIFLIRQFSYDQKNATEGRYSLNFQKTSKSINLVISASQLEDSAMYFCALRE
Carlito syrichta V200 trav ABRT02432996.1 1522 KIRGDSVTQMEGQVVLSEGTFLTINCTYTSTTYPTLFWYVQYPGEGPQLLLKAAKANEKGSNKGFEATYKKETTSFHLEKASVQESDSALYYCVLG
Carlito syrichta V201 ighv ABRT02440138.1 26923 VQCDVQLLESGGGLVQPGGSLKLTCVASGFTFGNYYMHWVRQAPGKGLEWVGVVRTKANGYSTEYAASVKGRFTISRDDSKNSVYLQMNSLKTEDTAVYYCTR
Carlito syrichta V202 ighv ABRT02440798.1 71845 AHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMNWVQQVPGQGLEWVGGIDPEDGETSYAQKFQNRVTVTSDTSSNTVYMELKSLRPEDTAIYYCAR
Carlito syrichta V203 ighv ABRT02444543.1 13312 VQCQVQLVQSGAEVKKPGTSVKISCKASGYTFTDYAMHWVQQSNGEGLEWMGIIYTSSGGTSYAQKFQGRVTMTRDTSTNTAYMELSSLRPEDSGIYYCAR
Carlito syrichta V204 iglv ABRT02457638.1 29414 SVASYVLTQPPSVSVSPQQTARITCEGNNIGNKNAYWYQQKPDQAPVLVIYEDNKRPSGIPERFSGSNSGNMATLTISGAQTGDEADYYCQVWDSYK
Carlito syrichta V205 iglv ABRT02457639.1 43390 SVMSSELTQLSAVSVALGQTVRVTCQGSNIRIFDAHWYQQKPGQAPVLVIYDNSNRPSGIPERFSGSKLRNTAGLIISRAQAEDEADYYCQSLDSSGI
Carlito syrichta V206 ighv ABRT02457647.1 10706 VQSQVQLVQSGAEVKKTGTSVKISCKASGYTFTNYLMHWVQQSNDEGFEWMGDINPNSGGTSYAQKFQGRVTMTSNTSTNTAYMELSSLRPEDSAMYYCV
Carlito syrichta V207 ighv ABRT02457647.1 1117 VESQVQLVQSGAEMKKPGTSVKISCKASGYTFTNYDMNWVRQSNREVLEWMGYIYPASGATSYSQKFQGRVTMTSDTSTNTAYMELSNLRPDDSAMYYCVR
Carlito syrichta V208 iglv ABRT02463057.1 30686 FCALPVLTQPPSASASLGASVKLTCTLSSEHSTYTIAWYQQQPGKAPRYLMYVKSDGSHNNGDGIPVRFSGSSSGADRYLIISNIQSEDEAEYHCGE
Carlito syrichta V209 iglv ABRT02463057.1 4905 SWAQSALTQPPSISKAPRELVSISCVGSSSDVGLSNYISWYQQHLGTAPKLLIYDVNKRYTGILDRFSGSKSGNTASLTISGLLIEDEAIYYCGVDVGSPL
Carlito syrichta V210 ighv ABRT02470669.1 1965 VQSQVQLVQSGAEVKKPGTSVKISCKASGYTFTNYNMHWVRQSNGKGFEWMGRINPSSGGTNYAQKFQGRVTMTSDTSTNTAYLELSSLRPEDSATYYCAR
Carlito syrichta V211 ighv ABRT02471770.1 6396 VHCDVQLVESGGGLVQPEESLKLSCEASGFTFSDYAMGWVRQAPEKGLEWVSSISYDGGNTYYAESVKGRFTISRDNTKNLMNLLLNSLKAEDTGTYYCA
Carlito syrichta V212 ighv ABRT02471773.1 13083 VHCDVQLVESGGGLVQPGGPLKLSCKASGFTFSNHDMSWVRQAPEKGLEWVSTISNTGRSTYYADSVKGRSTISRDNAKNLLHLQINSLTAEDTGIYYCVR
Carlito syrichta V213 ighv ABRT02472505.1 4104 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTNYGIQWVRQAPGQGLEWMGWVNTNNGNTNYAQKFQGRVKMTRDASTSTAYMELSSLSPEDTAVYYCAR