WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Apodemus sylvaticus LIPJ00000000.1 (LIPJ01) 56 8 1 10 12 18 3 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Apodemus sylvaticus V17 igkv LIPJ01000915.1 101783 AQCDVLITQSPSYLAASPGESVSITCKASKSINQYLAWYQQKPGKNIKLLIYSGSTLQSGIQSRFSGSRSGTDFTLTIRSLEPEDFATYHCQQHNEY
Apodemus sylvaticus V59 trdv LIPJ01003121.1 76281 TSLDVILEPVVKTFTVVAGNPATFYCTVTGGDLKNYQMSWYKKSGNNALFLVYKLNNNSTDDIMGNFKGKINTSKNQFILDIQKATMKDAGTYYCGSD
Apodemus sylvaticus V141 trav LIPJ01012377.1 68295 VGTQQLEQSPQFLNIQEGQDFTAYCNSSSTFPQLYWYRQVPGEGPVILMTLVKSGEVKGQKRIIAKFGEARKNSSLFIIRAQPRDAGTYFCAG
Apodemus sylvaticus V187 trav LIPJ01036453.1 18373 SWSLAKTTQPLAMDSYEGQEVNVSCSHTDIATSEYIYWYRQIPHQGPQFIIQGYKDYAANEVASLFISADRKLSTLSLPWVSLRDSAVYYCIVA
Apodemus sylvaticus V188 trav LIPJ01036453.1 72234 ESQGEQVKQDPSFLSVQEGASAVINCSYTDSASVYFSWYKQEPGKHLQFIIDIRSNMERKQTQRLTLLFNKKTKHLSLHIAATQPGDSAIYFCTA
Apodemus sylvaticus V189 trav LIPJ01036453.1 87656 NTHGDSVTQKQGQVTLSEDDFLFINCTYSATGYPTLFWYVQYPGEGPQFLLKVTTANNKGSSRGFEATYDKRSTSFHLQKASVQESDSAVYYCALS
Apodemus sylvaticus V190 trbv LIPJ01038233.1 85839 DGGITQTPRYQITQTARKMILACSQNMDHYWMFWYRQDAGQGLKLIYYSGSIDSTTKGDVPEGYSVSRKETQRFPLILESTSPNQTSLYFCASS
Apodemus sylvaticus V191 trbv LIPJ01038233.1 113970 LMEAAVTQSPRNKVTITGKNVTFSCHQTNNHNYMYWYRQDIGHGLRLIHYSISAGSHEKGDVPSGYKVSRPSQEDFYLMIELASPSQTSMYFCASSD
Apodemus sylvaticus V192 trbv LIPJ01038233.1 120729 HMEAAVTQSPRNKLTVTGGKVTLSCHQTNNHNNMYWYRQDMGHGLRLIHLSYGAGADSTEKGDVPDGFKASRPSLQNFSLILESASLSQTSLYFCASSD
Apodemus sylvaticus V193 trbv LIPJ01038233.1 126528 SANSEVVQSPRHITKEKGERFILKCIPISEHSIVVWYQQTQGQELKFLIQHSEKGKGEKGNMPDRFLVQQFNDYYSEINLSALELEGSAVYFCAS
Apodemus sylvaticus V194 trbv LIPJ01038233.1 129082 HMEAAVIQSPRNKMAVSGEKVTLNCNQTDNHGYMYWYRQDMGHGLRLLYYSYGADNTVKGDDPDGYKVSRPRQEDFSLILESASLSQTAVYFCASSD
Apodemus sylvaticus V195 trbv LIPJ01038233.1 141310 HTDAGVTQSPSYEVIKNGQTATLKCEPISGHNDLFWYRQTKRQGLELLSYFRSKSLMEDGGAFKDRFKAEMPDSSSSTLKIQPTELQDSAVYLCASSL
Apodemus sylvaticus V196 trbv LIPJ01038233.1 200198 STDSGVTQSPRLLVKGKEQKARMDCTPIKGHSYVYWYYKKLGEELKFLVYFQNKDIIDKTDMIGKNISAKCPTNEPCTIEIQSSKLTDSAVYFCASSQ
Apodemus sylvaticus V197 trbv LIPJ01038233.1 210575 SFDCQVIQTPQHQFIGKGQKAKMSCIPEKGHAFVYWYQQKQNKELKFLIFFQRQEVRDRIDLFKERFLAECPLNSPCSLEIHSSERGDSAVYLCASSL
Apodemus sylvaticus V198 trbv LIPJ01038233.1 212456 FLDAAVTQTPRHLIKLKGEKAEMKCNPEKGHSAVYWYQQKQNKELTFLIYFLNQRPLDQIDMVKERFTAECPSSLLCSLGIRISEAEDSALYLCSSSQ
Apodemus sylvaticus V200 trgv LIPJ01040125.1 734 RQTSSSLEEGIMSITRPVGSSVIISCHIYRTENYVHWYRFQEGKAPQHLLYHNFISSTTVVDPTLNSEKYHVYEGTDKSYKFVLRNVEESDAALYYCATWL
Apodemus sylvaticus V201 trgv LIPJ01040125.1 6913 GRGKLEQPEISVTRAKDETAQISCKVFVESFKSVTIHWYRQKPKKGLEFLLYVLATPNHISIEKKKKMEASKNSSASISTLTIYSLEEEDEAIYYCAYG
Apodemus sylvaticus V202 trgv LIPJ01040125.1 65018 GLGQLEQPEISVTRVTDESAQISCIVSLPDFNTADIHWYRQKTNQQFEYLMYVRSRYNQRPLEGKNKKIEASKDFQTSTSTLKVNYLKKEDEATYYCALWI
Apodemus sylvaticus V203 ighv LIPJ01040691.1 7651 SYSQVQLQQSGGELVRPGASVKLSCKASGYTFTDHIMNWVKQRPGQGLEWIGRIYPVNGETNYNQKFMGKATFTVDQSSSTVYMELHSLTSADPAVYYCG
Apodemus sylvaticus V204 ighv LIPJ01040691.1 56168 IHSQVYLQQSGSELRSPGSSVKLSCKDFDSDIFPIAYMSWLRQKPGHGFEWIGDILPSIGRTNYEEKFEDRATLDADTMSNTAYLELSSLTSEDSAIYYCA
Apodemus sylvaticus V209 igkv LIPJ01045591.1 1702 DKCDIQMTQSPSSLSASVGESVTITCQASGSIYGNLAWYQQKPGKSPQLLIYNANSLAGGVPSRFSGSGSGTQYSLKINSLQPDDVASYYCQHYFGIP
Apodemus sylvaticus V212 trbv LIPJ01051337.1 28497 PVDPKIIQEPKYLVAVAGSERILICEQHLGHNAMYWYRQSAKKSLEFMFSYSYQKLMDNQTVPSRFQPHNSKKNYLDLQITALKPDDAATYLCASSQ
Apodemus sylvaticus V213 trbv LIPJ01051337.1 30473 HTGPKVLQIPSHQVIDMGQMVTLSCDPVSNHLYFYWYKQILGQQIEFLVSFYSGKVLEKSKLFKDQFLVERPDGSYFTLKIQPTTLEDSAVYFCASSL
Apodemus sylvaticus V214 trbv LIPJ01051337.1 39458 PLETAVFQTPKHRVTQVGNEVSFQCEQKLGHDTMYWYKQDSKQLLKIMFSYNNKQLIVNETVPSRFSPQSSDKAHLNLRIKSVEPDDSAVYLCASS
Apodemus sylvaticus V215 trbv LIPJ01051337.1 46012 LTNTKIIQIPRYLVTGRANKTSLECQQHLGHNAMYWYKQSTKKPPELMFLYSVKQLLLNETVSSRFLPECPDSSKLLLHISALKPEDSAVYFCASSQ
Apodemus sylvaticus V217 trav LIPJ01056054.1 49000 LKMYSAITQSPSSLTANTGDKITNTCKTNPNEKTQFSWYQQQTGLSSKALVYGTTTLVSGIPTRFRGSRSGEEFFFTIDKTEIDDSASYYCAECPG
Apodemus sylvaticus V222 igkv LIPJ01087480.1 2280 STGDIRLAQSPSSLSVTPGDGVTITCKTSEGISKYLHWYQQKPNEVPRLLIKYASESVSGIPSRFTGRGSGTDFTLSINSISSEDVGRYYCQQSNNL
Apodemus sylvaticus V227 ighv LIPJ01133024.1 1301 QLVQSGGGFIQSGGSLRLYCEGSGFTFSDYYIHWHRQSPGKRLEWVGFIRDKLRDHTTEYAASVKERFTISRDDSKNTAYLQMNHVRAEDTAMYYCARER
Apodemus sylvaticus V228 iglv LIPJ01135567.1 5022 AMSQTVVNQESSLTASPDETVTLTCGSSTGPVTTQNYAKWIQKKPHQVYTGLIGDTSNRVPGLPARFSGSLLKDKAALTITGVQTEDEAMYYCALWYSNH
Apodemus sylvaticus V230 trav LIPJ01140787.1 150763 VSSQQKVQQSPELLIVPEGGMASLNCTSSDRTVDYFWWYRQHSGKSPKALISIFSNGEKEEGRFTVHLNKASLHVSLHIRDSQPSDSALYFCAVS
Apodemus sylvaticus V231 trbv LIPJ01160771.1 2197 PFVAEVTQTPRYLVNEKGQKAHMSCSPEKGHTGFYWYQQNQKNELKLLINFRNEEIIEQTDLVKRRFSAKCSTNSRCILEILSSEEGDSALYLCASSL
Apodemus sylvaticus V236 trav LIPJ01176866.1 49889 GVRGDEVKQSPSALSLHEGTGSTLRCNFSTSMRSVQWFRQNPSGSLVNLFYLASGTKENVRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAE
Apodemus sylvaticus V238 trav LIPJ01191245.1 2497 GVRGMQVEQSPPALSLHEGAGSGLRCNFSTTMKSVQWFQQNRRGSFIHLFYLAPGMKEIGRLKTTFNSKERYSTLHIRDAQLEDSGIYFCAAE
Apodemus sylvaticus V263 igkv LIPJ01000849.1 49652 ARCDIQMTQSPSTSASLGERVTITCRASQDISSYLSWYQQKPGKSPKPMIYYATNRVDGVPSRFSGSGSGSDYSLTISNVESEDEAIYHCLQYDKY
Apodemus sylvaticus V344 ighv LIPJ01006842.1 110682 VHCEVQLVESGGGLVQPEKSLKLSCEASGFTFGGYYMAWVRQAPEKGLEWVSTISDDGVSTYYPDNLKGRFTISRDNAKNILYLQVSSLRSEDTAMYYCAR
Apodemus sylvaticus V384 ighv LIPJ01012849.1 1405 IHGKVKLVESGGALVQPGGSLTLSCAASGFTFSDFYIEWIRQAPGKGLEWIAASRNKARDYTAEYSASVNGRFTISRDISQSILYLHMKTLRTEDTATYYCARD
Apodemus sylvaticus V409 trbv LIPJ01020003.1 56756 CVDTKVMQMPRYLIKRMGDNVLLECVQDMGHERMYWYRQDPGLELQLIYFSYDVDSNSEGDISEGYRVSRKKREHFSLILESAKTHQTSLYFCASSL
Apodemus sylvaticus V418 trav LIPJ01022907.1 149889 VSGQANTVVQRPSILNIWEKETAVINCTYTNAASNYFSWYKKEEQKGFTLLTDIRSNVNRRKKGRFEVILDTNVKLVSLHITAAQTEDSAFYLCAL
Apodemus sylvaticus V419 trav LIPJ01022907.1 140318 IAGDAKTTQPDSVESTEGETVRLPCSHATISGNEYIHWYRQVPLQGPEYVIHGLQQNTTNSMAFLAITSDRKSSTLILPRVSLRDAAVYHCMLRV
Apodemus sylvaticus V429 ighv LIPJ01025672.1 130662 VLSQVQLKESGPDLVQPSQTLSLTCTVSGFSLSSYGVHWFRKPPRKGLEWLGGVWPGGSTYYNSLLSSRLSITWDNYKSQVFLKMSSLQSEDTAMYFCAR
Apodemus sylvaticus V430 igkv LIPJ01026466.1 37075 ARCDIQMIQSPSISASLGDRVSITCKASQDISSSLSWYQQKPGKSPKLLIYEANILEDGVPSRFSGSGSGSDYSLTISSLESEDASIYYCQQYDEYP
Apodemus sylvaticus V431 trav LIPJ01027777.1 15382 RTHGDSVIQIQDQVTLSENDFLFINCTYSTTGYPILFWYVQYSGEGPQLLLQVTTANNRGSNRGFEAMYDKGTTSFHLQKASVHVSDSAVYYCAMR
Apodemus sylvaticus V452 igkv LIPJ01042042.1 3332 STGDIVLTQSPASLAVSLGQRATISCRASESVSASSYTYMHWYQQKPGQPPKLLIYLASNLASGVPARFSGSGSGTDFTLTINPVEAEDTVTYYCQQCRKLP
Apodemus sylvaticus V453 ighv LIPJ01042060.1 769 ILSQVQLQESGPSLVNPSQTLSLTCSVTGYSIYRGYDWIWIRQFPGNKMEWMGYISPAGGTGYNPSLKSRISITRDTSKNEFFLQLNSVTTEDTATYYCAR
Apodemus sylvaticus V457 trav LIPJ01056133.1 16632 TSMAQKVKQTQTSISVMEKKTVTMDCVYETRDSSYFLFWYKQRASGEMVFLIRQDSYNKENATEGRYSLNFQKSESSIGLTITATQIEDSAVYFCAMRE
Apodemus sylvaticus V459 trbv LIPJ01058172.1 45672 PTNAGVTQTPRHKVTQKGQEATLRCEPISGHNAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKDRFSAQMPNQSLSTLKIQTTQPQDSAVYLCASSL
Apodemus sylvaticus V460 trbv LIPJ01058172.1 34014 FVDMMVMQNPRYKVARVGKPVNLICSQTMNHDAMYWYQHKPKQAPKLLLYYYDENLNRETDTAKNFQSSRLNTSFCSLDIGSAGLGDSAVYLCASSR
Apodemus sylvaticus V461 trbv LIPJ01058172.1 18189 TTHGGITQTPKFLIGQERKELTLKCKQDFNHDSMYWYQQDSGKGLRLIYYSITENDLQKGDLSEGYSAFREKKPSFSLTVKSAQKNQMALYLCASSI
Apodemus sylvaticus V470 igkv LIPJ01094051.1 2294 AFGAIQMTQSISTMSASLGERVLNCQVSQDIGKYLNWYQQKSGKAPKLLIYYASNLEDGVSSRFSGSGSGTDFTLTISSLKPEDITTYYCQQYDELP
Apodemus sylvaticus V473 igkv LIPJ01113115.1 430 VDGDIVMTQSYKSISTLVGERVTLNCKASQNVYNSVAWYEQKPGHSPKLLISGASNRFTGVPDSFTGSGYGADFTLTISSVQAEDLAVYYCQQYSSSP
Apodemus sylvaticus V476 ighv LIPJ01157002.1 2410 ALAQVQLVQSGPELKQPVETVKISCKTSGYIFTDFGINWVKHAPGKGFKWIGWINTKTGKPTYAEDFKERFVFSLETSASTAYLQISSLKNEDMARYYCT
Apodemus sylvaticus V477 igkv LIPJ01172433.1 624 VRCDIQMIQNPASLSATVGQTVTITCKASEDIDYDLNWYQQKQGKSPQLMIYGATRLEDGVPSRFSGHGSGTQYSLKMNSLQADDAASYFCQQGYSTP
Apodemus sylvaticus V484 igkv LIPJ01257920.1 1393 ARCEIQMTQSPSSLSASVGESVTITCQASENINNYLAWYQQKPGKSPQLLIYYATSLQDGVPSRFSGSGSGTQFSLKISNLQPEDVASYYCQQHGYTP
Apodemus sylvaticus V485 trdv LIPJ01461584.1 321 SCLAQKATQVQSAIIKREGEEVTLDCSYETSKNFYQLYWYKQLPRGDMIFLIRQISSTHHNETSGRYSVVFRKSAQSISLIIAASRVEDSMNYFCALGEP
Apodemus sylvaticus V487 trdv LIPJ01510199.1 313 CNVAQTVTQVQSTASRKEGEEVTLDCSYETNNFVYHLFWYRKLLSEEMVFLIHQPSADTQNKRSDRYSVVFQKSFKTISLVISALQPDDSGKYFCALWEL
Apodemus sylvaticus V489 trdv LIPJ01525390.1 366 KDVLGITVTQSSPDQTVASGSEVTLLCTYDGESPNPDLFWYRKRPDRSFQFVLYRADIRSHDADFVQDRFFVEHNKTSRTFHLVISPVRLEDSAIYYCALG